Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C004008.843ON51751725280.0
NCAS0A02540singletonON53951721440.0
NDAI0K004008.843ON55348418060.0
KAFR0B03930singletonON55547317520.0
KNAG0J002608.843ON55047316990.0
NDAI0E002808.843ON54950916310.0
CAGL0M03003g8.843ON55850316160.0
KAFR0B039408.843ON54751015940.0
YML116W (ATR1)8.843ON54248215600.0
Suva_13.4678.843ON54351315500.0
KNAG0G034308.843ON54251215340.0
NCAS0B002908.843ON54251115310.0
Smik_13.188.843ON54545415310.0
YMR279C8.843ON54051215290.0
Suva_13.278.843ON55350015200.0
Skud_13.4518.843ON53950615190.0
Smik_13.4928.843ON54350915070.0
Skud_13.258.843ON53747114980.0
CAGL0B02343g8.843ON53747214710.0
TDEL0B005508.843ON53747714450.0
SAKL0D01386g8.843ON52147514230.0
Kpol_541.168.843ON52846914210.0
KLTH0C03806g8.843ON52549114180.0
Kwal_27.102458.843ON51550613890.0
KAFR0A028408.843ON52047213790.0
TPHA0C047908.843ON55651413710.0
TBLA0D032708.843ON55051013341e-180
TBLA0D03280singletonON58046612821e-171
TBLA0C01160singletonON60049610961e-143
Smik_15.560na 1ON5164788111e-101
KLTH0C10560gna 1ON5154807943e-99
YOR378Wna 1ON5154517901e-98
Suva_8.435na 1ON5154727865e-98
Skud_15.545na 1ON5164447866e-98
TDEL0G04950singletonON5124787822e-97
KLLA0B00352gna 1ON4984687733e-96
Kwal_23.6547na 1ON5114447534e-93
KNAG0D00130na 1ON5654475141e-57
SAKL0C06116gsingletonON1851904125e-47
KAFR0C04860na 1ON5344654332e-46
CAGL0L02519gna 1ON5294264227e-45
NCAS0A05720na 1ON5634743631e-36
NDAI0K02730singletonON6044843613e-36
SAKL0F00440gsingletonON5444801455e-09
Smik_6.24na 2ON5444971359e-08
Suva_10.11singletonON5404561313e-07
NDAI0D010202.242ON5922311242e-06
Skud_6.16na 2ON5494761232e-06
Kwal_34.15746na 3ON5182531223e-06
KLLA0C18931gna 3ON5532591125e-05
KLTH0D16962gsingletonON5711471054e-04
NCAS0C03460na 4ON6302171054e-04
KLTH0H16214gsingletonON551124990.002
ZYRO0C01430g8.272ON590463970.003
Kpol_1039.192.242ON573144970.004
TDEL0G03260singletonON612212970.004
KLLA0E24113g8.570ON575135960.004
YPR198W (SGE1)singletonON543166950.005
KAFR0J009302.242ON566202950.006
Kwal_26.6697singletonON577222940.008
TDEL0A024902.473ON55483940.009
SAKL0A08228gsingletonON569149910.016
TPHA0F012902.242ON562238900.022
ZYRO0G21890gsingletonON57688880.041
SAKL0D04510gna 5ON53192880.042
NDAI0D016805.284ON516128880.042
Smik_16.81na 4ON625226870.053
YGR224W (AZR1)na 4ON613141870.053
KNAG0I019102.242ON598177870.061
Suva_9.712.241ON561214860.067
TDEL0D06610singletonON497111860.074
KLTH0H05456gna 6ON56888850.088
CAGL0G08624g2.242ON583233850.098
NCAS0G029902.242ON581142850.10
KLTH0G09372g2.242ON551241840.10
KLTH0C10142gsingletonON573245840.11
TBLA0G025502.242ON613142840.11
Kwal_14.1585na 6ON57088840.11
KLLA0A04631g8.272ON57993840.13
AGR076C8.272ON686428840.14
YKR105C (VBA5)singletonON582147840.14
SAKL0C05588gsingletonON677147840.14
Smik_2.434na 7ON474301820.18
TBLA0E037902.241ON550202820.20
YBR293W (VBA2)na 7ON474310820.21
Klac_YGOB_Anc_2.2412.241ON602129810.25
NCAS0C036002.242ON572217810.25
YIL120W (QDR1)2.242ON563235810.26
SAKL0E08756g2.242ON565144810.28
Kwal_26.9616singletonON562139800.31
TDEL0F039908.272ON631111810.32
NDAI0B037702.242ON571141800.38
Kpol_416.5singletonON607155790.44
KLTH0C10120gsingletonON651154790.45
CAGL0B02079gna 4ON624163790.47
Kpol_543.448.272ON64384790.53
SAKL0A00726gsingletonON598203790.54
TBLA0B044808.570ON608238790.55
Kwal_23.48242.242ON553147780.56
KLLA0E09879gsingletonON630287780.67
TBLA0E038002.242ON608236770.75
KLTH0B00132gsingletonON568145770.75
KLTH0E16720gsingletonON574209770.82
Skud_7.560na 4ON642159770.85
KLLA0F03311g2.242ON542144770.89
Smik_17.11singletonON544147761.0
TDEL0B019008.446ON68756761.0
Kwal_14.728singletonON568143751.3
Skud_16.503singletonON543171751.4
ABL210CsingletonON478111751.6
KLTH0B00594gsingletonON618127751.6
KNAG0F03480singletonON548194741.9
YOR306C (MCH5)8.783ON521105732.3
Skud_15.4748.783ON522119732.4
ZYRO0G21868gna 6ON620122732.5
SAKL0H16808g8.272ON65748723.3
Smik_13.118.858ON58658723.3
ZYRO0A00330gsingletonON576180723.7
TDEL0B039906.155ON481101713.8
ZYRO0A13618gsingletonON529230714.1
Smik_18.10singletonON53187714.3
KNAG0B049005.284ON516164714.6
AAR192Cna 5ON500144714.7
TPHA0B037705.284ON520130714.8
ZYRO0E10230gsingletonON558185704.9
Kpol_1051.155.284ON501135696.4
TPHA0G031502.473ON60061697.3
TPHA0O008001.451ON627133697.4
Kwal_23.48142.241ON529128697.9
SAKL0B12716gsingletonON632147698.1
Skud_2.423na 7ON560385688.6
KLLA0F17776gna 8ON553194688.9
Suva_13.208.858ON58458689.1
Ecym_45063.245ON64859689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00400
         (517 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      978   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   830   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               700   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   679   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   659   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      632   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   627   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   618   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   605   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   601   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   595   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      594   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   594   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   593   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   590   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   589   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   585   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   581   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   571   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   561   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   552   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   551   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   550   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   539   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   535   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   532   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   518   e-180
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   498   e-171
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   426   e-143
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   317   e-101
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   310   3e-99
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   308   1e-98
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   307   5e-98
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   307   6e-98
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   305   2e-97
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   302   3e-96
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   294   4e-93
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   202   1e-57
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   163   5e-47
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     171   2e-46
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   167   7e-45
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            144   1e-36
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   143   3e-36
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    60   5e-09
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    57   9e-08
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    55   3e-07
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    52   2e-06
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    52   2e-06
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    52   3e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    48   5e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    45   4e-04
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    45   4e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    43   0.002
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    42   0.003
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    42   0.004
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               42   0.004
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    42   0.004
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    41   0.005
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    41   0.006
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    41   0.008
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    41   0.009
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    40   0.016
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    39   0.022
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    39   0.041
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    39   0.042
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    39   0.042
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    38   0.053
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    38   0.053
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    38   0.061
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    38   0.067
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    38   0.074
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    37   0.088
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    37   0.098
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    37   0.10 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    37   0.10 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    37   0.11 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    37   0.11 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    37   0.11 
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    37   0.13 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    37   0.14 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    37   0.14 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    37   0.14 
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    36   0.18 
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    36   0.20 
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    36   0.21 
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    36   0.25 
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    36   0.25 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    36   0.26 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    36   0.28 
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    35   0.31 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    36   0.32 
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    35   0.38 
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    35   0.44 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    35   0.45 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    35   0.47 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    35   0.53 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    35   0.54 
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    35   0.55 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    35   0.56 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    35   0.67 
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    34   0.75 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    34   0.75 
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    34   0.82 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    34   0.85 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    34   0.89 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    34   1.0  
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    34   1.0  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    33   1.3  
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    33   1.4  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    33   1.6  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    33   1.6  
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    33   1.9  
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    33   2.3  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    33   2.4  
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    33   2.5  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    32   3.3  
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    32   3.3  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    32   3.7  
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...    32   3.8  
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    32   4.1  
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    32   4.3  
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               32   4.6  
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    32   4.7  
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               32   4.8  
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    32   4.9  
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    31   6.4  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    31   7.3  
TPHA0O00800 Chr15 complement(151545..153428) [1884 bp, 627 aa] {...    31   7.4  
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    31   7.9  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    31   8.1  
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    31   8.6  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    31   8.9  
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    31   9.1  
Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {O...    31   9.6  

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/517 (93%), Positives = 484/517 (93%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ
Sbjct: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW
Sbjct: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA
Sbjct: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240
           PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM
Sbjct: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240

Query: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREV 300
           GAIIGVVGLILFNFVWNQGPVNGWAKPY                 YELKFPISPLLPREV
Sbjct: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREV 300

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
           TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV
Sbjct: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
           GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI
Sbjct: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXX 480
           ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS       
Sbjct: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVG 480

Query: 481 XXXXXXXXXFLNLCYDLWRKRKSRLDDIRSLNTNDSA 517
                    FLNLCYDLWRKRKSRLDDIRSLNTNDSA
Sbjct: 481 LGGLGACVAFLNLCYDLWRKRKSRLDDIRSLNTNDSA 517

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/517 (76%), Positives = 444/517 (85%), Gaps = 2/517 (0%)

Query: 3   NKEPIVSSSQKKTLS--CDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           N++  +S ++K+  S   DS+L++ +PWQN  YF S  KEYFFIFTCM ANLLNQAGQTQ
Sbjct: 23  NEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQ 82

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           VLSTMNVISESFHSD G QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW
Sbjct: 83  VLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 142

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +LLCGFAD+TH+DTFFIVCRAFQGLGISFILPN+MGL+GNIYKVGTLRKNIVIS+IG+TA
Sbjct: 143 SLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTA 202

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240
           PTGACMGALWGGLI TE+++QWPWIFYAYAL   VNLIMA+YSVP  +PTNVHNFAMDW+
Sbjct: 203 PTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWI 262

Query: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREV 300
           G+IIGVVGLILFNFVWNQGPV GW K Y                 YELK+PISPLLP EV
Sbjct: 263 GSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEV 322

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
           TKNGQILTIL ILFLGWG+FGIWTFYY+AFQLNLR+YSP+W G T+FMFIIWG+IAA IV
Sbjct: 323 TKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIV 382

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
            FTI +VGPA+LLFFSALGFTMGSLMLSVTPIHQ YWRMN+GMQIIL FGMDLSFPASSI
Sbjct: 383 AFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSI 442

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXX 480
           ILSDHLPMQYQGMAGSLVNT+INY+TSLCLGMGTTVERQINK+GE+LL+GYRS       
Sbjct: 443 ILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVG 502

Query: 481 XXXXXXXXXFLNLCYDLWRKRKSRLDDIRSLNTNDSA 517
                    F+NLCY LW KR+ RL D++S++T+DS 
Sbjct: 503 LGGLGSCIAFINLCYTLWMKRRDRLADLKSVSTDDSV 539

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/484 (69%), Positives = 397/484 (82%)

Query: 21  LLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQT 80
           L EN++ WQN  YF S  KEY F+ TCM ANLLNQAGQ+QVLS MNVIS+SFHS  G QT
Sbjct: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115

Query: 81  WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCR 140
           WLMASFPLVSGSFILISGR+GDIYGLK+ MIGG+IFMIIW+L+CGF +Y HSDTFFIV R
Sbjct: 116 WLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVAR 175

Query: 141 AFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSR 200
           AFQGLGISFILPN+MGLVGNIYKVGTLRKN+VISLIGI APTG+C GALWGGLI TE+ +
Sbjct: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235

Query: 201 QWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGP 260
           QWPWIFYAYA+AA V L+M  Y+VP+N+PTNV+ F MDW+G+++GV+GLILFNFVWNQGP
Sbjct: 236 QWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295

Query: 261 VNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSF 320
           + GW K Y                 YE+K+   PLLP+ VT+NG ILTIL +LFLGWGSF
Sbjct: 296 IVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355

Query: 321 GIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGF 380
           GIWTFYY+AFQLNLR YSP+W+G T F+FII+G++AA  V  TI +VGPA+LLFFSA+GF
Sbjct: 356 GIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGF 415

Query: 381 TMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNT 440
           T GS+++SVTP+HQTYWR   GMQIIL FGMDL FPASSIILSD+LPMQYQGMA SLVNT
Sbjct: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475

Query: 441 IINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXXXXXXXXXXFLNLCYDLWRK 500
           I+NYSTSLCLGMGTTVERQINK+G++LL+GYR+                FLN+C+D+W K
Sbjct: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSK 535

Query: 501 RKSR 504
           R ++
Sbjct: 536 RNAK 539

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/473 (66%), Positives = 379/473 (80%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           +  K   +S  +  +   +   +N+TPWQN  YF S  KEY FI TCM +NLLNQAGQTQ
Sbjct: 42  VSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQ 101

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
             STMNVI  +F++D  ++TWLMASFPLVSGSFIL+SGRIGDIYGLK+TMIGG I MIIW
Sbjct: 102 ATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIW 161

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +L+CGFA+Y+ S TFFI+CRAFQGLGI+F+LPN+MGLVGNIYKVG+LRKNIVIS IG+ A
Sbjct: 162 SLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCA 221

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240
           PTGA  GA W GLIAT++ +QWPWIFYAYA A  +NL++AIYS+P+ VP NVH F+MDW 
Sbjct: 222 PTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWT 281

Query: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREV 300
           G+++GV+GLILFNFVWN+ P+ GW K Y                 YE+KF  SPLLP+ V
Sbjct: 282 GSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAV 341

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
           T N  I+ IL  +F+GWGSFGIWTFYYYAF LNLR Y+PL AGA+H MFI+WG+IAAF V
Sbjct: 342 THNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTV 401

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
            FTI RVGP+VLLF S + FT+GS+MLS+TP+HQTYW+M  GMQIIL+FGMDLSFPASSI
Sbjct: 402 AFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSI 461

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS 473
           ILSD LPM+YQGMAGSLVNTI+NYSTSLCLGMGTT E Q+NK G +LL+GYR+
Sbjct: 462 ILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRA 514

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/473 (64%), Positives = 374/473 (79%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           +E K+   + S+ +  S     +N TPWQN  YF +  +EY FI TCM A LLNQAGQ Q
Sbjct: 35  VEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQ 94

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
             + MN+++++F+S    QTWLMASFPLVSGSFIL+SGRIGDIYGLKKT+IGGY+ ++IW
Sbjct: 95  ATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIW 154

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +L+CGFA+YTH+D FFI+CRAFQGLGI+FILPN+MGL+GNIYK  TLRKN VIS +G+ A
Sbjct: 155 SLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA 214

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240
           P GA +G +W GLIA E+ +QWPWIFYAYA+   +N++MAIYS+P  VPTN+H F MDW 
Sbjct: 215 PIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWT 274

Query: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREV 300
           G+ IGVVG+ILFNFVWNQGP++GW K Y                 YE+KF  SPLLP EV
Sbjct: 275 GSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEV 334

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
            KN  I  IL  +F+GWGSFGIWTFYYYAFQLNLR+YS +WAG T FMF+IWG+IAAF+V
Sbjct: 335 IKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLV 394

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
             TI RVGP+VLL FS  GFT+G +MLSVTP+HQ+YW+MN+GMQIILSFGMDLSFPASSI
Sbjct: 395 ALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSI 454

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS 473
           ILSD LP QYQGMAGSLVNT++NYSTSLCLG+G+T E Q+NK G + L+GYR+
Sbjct: 455 ILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRA 507

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/509 (59%), Positives = 384/509 (75%), Gaps = 4/509 (0%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           E  E  + SS+++    D+ + + + WQN  YFQ+  +EY FIF+CM + LLNQA   Q 
Sbjct: 41  EVSEDELPSSEQE----DNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQT 96

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           LS MN+I++SF S+ G +TWL+ASFPLVSGSFILISGRIGDIYGLKKT+IGGY+F IIW+
Sbjct: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           L+ GF DY+H+D FFI+ RAFQGLGI+FILPN+MG+VGNIYK  T RKNIVIS+IG +AP
Sbjct: 157 LISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAP 216

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
            GA MG+L+ GLI TE+ +QWPW FYA+A+A+ +NL ++IYS+P N+PTN+H FAMDW+G
Sbjct: 217 IGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIG 276

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVT 301
           +I+ V+GLIL NFVWNQGP+ GW K Y                 YE+K+  SP+LP EVT
Sbjct: 277 SIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEVT 336

Query: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361
           KN  I+ IL  LFLGWGSFGI++FYY++F LNLR+YS LWAG T+FMF IWG++AA IVG
Sbjct: 337 KNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 396

Query: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421
             I R+  +V+LFFS + F +G +MLSVTP+ QTY+RMN+G  IILSFGMD+SFPA++II
Sbjct: 397 AFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 456

Query: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXX 481
           LSD L MQYQGMAGSL NT++NYS SLCLGMGTTVERQINK+G+E+L+GYR+        
Sbjct: 457 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGL 516

Query: 482 XXXXXXXXFLNLCYDLWRKRKSRLDDIRS 510
                    + +   LW KRK RL   R 
Sbjct: 517 AGLGIVISGIYMAEVLWAKRKERLSSNRD 545

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/503 (62%), Positives = 380/503 (75%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
            N + +  +S+    S D   EN +P+QN +YF++  KE  FI +CM A LLNQAGQTQ 
Sbjct: 47  SNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQS 106

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           LSTMNV+++ F S+   Q WLMASFPLVSGSFILISGR+GDIYGLKK +  GYI M +W+
Sbjct: 107 LSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWS 166

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           ++CG A YT+SD FFIVCR+FQGLGI+FILPNIMGLVGNIYKVGTLRKNIVIS IG  AP
Sbjct: 167 IICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAP 226

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
            GA +GAL+GGLI TE + QWPW+FYA+ +A+FVN+++A+YS+P NVPTN++N  MDW+G
Sbjct: 227 AGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIG 286

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVT 301
           +++GV GL+L N VWNQ P+ GW + Y                 YE+K+  SPLLP  V 
Sbjct: 287 SLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVL 346

Query: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361
           +N +IL IL  LF GWGSFGIWT+YYYAFQLNLR Y+PLWAG THFMF+IWG++AAF+V 
Sbjct: 347 ENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVA 406

Query: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421
            TI +VGPAVLL FS + F  GS+MLSVTP+HQTYWRMNVGMQIILSFGMDLSFPASSII
Sbjct: 407 LTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSII 466

Query: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXX 481
           LSD LPMQYQGMAGSLVNT++NYSTSLCLGMG TVE+Q N  G +LL+GYRS        
Sbjct: 467 LSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGL 526

Query: 482 XXXXXXXXFLNLCYDLWRKRKSR 504
                    + L  D+  KR  +
Sbjct: 527 ASAGVCVSLVFLVTDIIAKRHRK 549

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/510 (59%), Positives = 378/510 (74%), Gaps = 6/510 (1%)

Query: 7   IVSSSQKK---TLSCD--SLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           ++S S KK   +++ D  S + N++ WQ+  YF+S  +EY FI TCM ANLLNQAGQTQ 
Sbjct: 35  VLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQT 94

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           LSTMNV+++S +SD   +TWLMASF L SGSFIL+SGRIGDIYGLK T IGG I   IW+
Sbjct: 95  LSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWS 154

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           +LCG + YT + TFFI+CRAFQGLG++F+LPN+MGLVGNIY VG++RKNIVIS IG  AP
Sbjct: 155 ILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAP 214

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
            G   G +WGGLI   +  QWPWIF+A A+A F+NLIM IYS+P +VPTN++N  MDW+G
Sbjct: 215 VGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIG 274

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVT 301
           +++GV+GLIL NFVWNQ P++GW+K Y                 YELK   SPLLP EVT
Sbjct: 275 SLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVT 334

Query: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361
           KN  I+TI+  LFLGWG+FGIWTFYYYAF LNLR++SPLWAG+THF+FII+GS+ A  V 
Sbjct: 335 KNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVA 394

Query: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421
           FTIN+VGP+VL   S++GFT G+++ SVT   QTYWR ++GMQIIL+ GMDLSFP SSII
Sbjct: 395 FTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSII 454

Query: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXX 481
           LSD LPMQYQGM+GSLVNTI NY+TSLCLGMGTT E Q N  G+++L+GYR+        
Sbjct: 455 LSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGL 514

Query: 482 XXXXXXXXFLNLCYDLW-RKRKSRLDDIRS 510
                   F  +  DLW R RK R ++ + 
Sbjct: 515 GALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/482 (57%), Positives = 365/482 (75%), Gaps = 11/482 (2%)

Query: 2   ENKEPIVSSSQKK-----------TLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFA 50
           E + P+  SS+             T S D +++++  WQN  YF+   +EY FIFTCM +
Sbjct: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS 78

Query: 51  NLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTM 110
            LLNQAG TQ LS MN++S+SF S+  +++WLMASFPLVSGSFILISGR+GDIYGLKK +
Sbjct: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138

Query: 111 IGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKN 170
           + GY+ +IIW+L+CG   Y+ SDTFFI+ RAFQGLGI+F+LPN++G++GNIY  GT RKN
Sbjct: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198

Query: 171 IVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPT 230
           IVIS +G  AP GA +G L+ GLI TE  +QWPW FYAY++AAF+N +++IY++P  +PT
Sbjct: 199 IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPT 258

Query: 231 NVHNFAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKF 290
           N+H+F+MDW+G+++GV+GLIL NFVWNQ P++GW + Y                 YE++F
Sbjct: 259 NIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRF 318

Query: 291 PISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFI 350
             +PLLPR V K+  ++ I+  LF GWGSFGI+TFYY+ FQLN+R Y+ LWAG T+FMF+
Sbjct: 319 AKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFL 378

Query: 351 IWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFG 410
           IWG IAA +VGFTI  V P+V LFFS + F +GS+M SVTP+H+TY+R  +G  IILSFG
Sbjct: 379 IWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFG 438

Query: 411 MDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRG 470
           MDLSFPASSII SD+LPM+YQGMAGSLVNT++NYS SLCLGMG TVE Q+N  G+ LL+G
Sbjct: 439 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKG 498

Query: 471 YR 472
           YR
Sbjct: 499 YR 500

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/513 (56%), Positives = 371/513 (72%), Gaps = 6/513 (1%)

Query: 1   MENKEPIVSSSQKKTLSC------DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLN 54
           M+ ++ +V SS+ + ++        + + N +PWQ+  YF S  +E  FI TCM A LLN
Sbjct: 24  MKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLN 83

Query: 55  QAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 114
           QAGQT  L+ MNV+S+SF+S+   Q WLMASFPLV+GSFILISGR+GDIYGLKK ++ GY
Sbjct: 84  QAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGY 143

Query: 115 IFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVIS 174
           + +I+W+L+CG + Y+++D FFI CRAFQGLGI+FILPN+MGLVG++YKVG+ RKN+VIS
Sbjct: 144 VTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVIS 203

Query: 175 LIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
            IG  AP G   G L+GGLI  E S QWPW+FYA+A+A F+N+I+A YS+P N+PTNVH 
Sbjct: 204 FIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHG 263

Query: 235 FAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISP 294
           F+MDW G+++ V+GLILFNFVWNQ P  GW   Y                 YE+K+   P
Sbjct: 264 FSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVP 323

Query: 295 LLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGS 354
           LLP  VTKN  ++ IL  +FLGWGSFGIWTFYY +FQLNLR+YSP+W G T+F+F+I+G+
Sbjct: 324 LLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGT 383

Query: 355 IAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLS 414
           IAAF+V  +I RVGPA LL F+ + F +GS+M SV P+ Q++W++N GMQ IL FGMDLS
Sbjct: 384 IAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLS 443

Query: 415 FPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSX 474
           FPASSIILSD LPM+YQGMAGSLVNT+INYS SLCLGMG TVE QINK G++LL+GYR  
Sbjct: 444 FPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGA 503

Query: 475 XXXXXXXXXXXXXXXFLNLCYDLWRKRKSRLDD 507
                          F  +    W  R+ R  D
Sbjct: 504 IYLGVGLASLGVLISFTYMLETFWNNRRDRQKD 536

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/512 (55%), Positives = 370/512 (72%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           +EN +     S  +T +  +  + +  WQ+  YFQ+  +EY F+ TCM + LLNQA   Q
Sbjct: 29  VENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQ 88

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
            LS MN++++SFHS+   QTWLMASFPLVSGSFILISGR+GDIYGLK +++GG IF IIW
Sbjct: 89  TLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIW 148

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
            L+ GF +YTHSDTFFIV R+FQGLG++FILPN+MG VGNIYK  T RKNIVISLIG  A
Sbjct: 149 ALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACA 208

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240
           P GA MGA + GLI T++   WPW FYA A+A+ + L+ A+YS+P ++PTNVH F+MDW+
Sbjct: 209 PVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWI 268

Query: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREV 300
           G+ + VVGLIL NFVWNQGP++GW K Y                 YE+ +  SPLLPR +
Sbjct: 269 GSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVI 328

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
           T+N  ++ IL  LFLGWGSFGI++FYY+AF LNLR+YS +WAG T+FMF IWG +A+ +V
Sbjct: 329 TQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVV 388

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
           G +I ++  +++LFFS + F +G +MLSVTP+ QTY+RMN+G  IILSFGMD+SFPA++I
Sbjct: 389 GLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAI 448

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXX 480
           ILSD LP QYQGMAGSL NT++NYS SLCLGMG+TVE QIN+ G++LL+GYR+       
Sbjct: 449 ILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIG 508

Query: 481 XXXXXXXXXFLNLCYDLWRKRKSRLDDIRSLN 512
                     + +C  LW  RK R++     N
Sbjct: 509 IASLAVILSLIYMCERLWIDRKERMESTSETN 540

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/511 (57%), Positives = 370/511 (72%), Gaps = 6/511 (1%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTP------WQNEQYFQSHLKEYFFIFTCMFANLLN 54
           +  +  I+     + +  D + +  TP      WQN  YFQ+  +EY FIF+CM + LLN
Sbjct: 23  ITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLN 82

Query: 55  QAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 114
           QA   Q LS MN+I++SF+S+ G +TWL+ASFPLVSGSFILISGRIGDIYGLKKT++GGY
Sbjct: 83  QAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGY 142

Query: 115 IFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVIS 174
           IF IIW+++ G   Y+HSDTFFIV RAFQGL I+FILPN+MG+VGNIYK  + RKNIVIS
Sbjct: 143 IFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVIS 202

Query: 175 LIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
           +IG +AP GA  G+L+ GLI TE   QWPW FYA+A+A+  NL ++IYS+P +VPTNVH 
Sbjct: 203 MIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHG 262

Query: 235 FAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISP 294
           FAMDW+G+++ V+GLIL NFVWNQGP+ GW   Y                 YE+K+  SP
Sbjct: 263 FAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESP 322

Query: 295 LLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGS 354
           LLP EVTKN  I+ IL  LFLGWGSFGI++FYY++F LNLR+YS LWAG T+FMF IWG+
Sbjct: 323 LLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGT 382

Query: 355 IAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLS 414
           +AA IVG  I ++  A +LF S + F +G +MLSVTP+ QTY+RMN+G  IILSFGMD+S
Sbjct: 383 VAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMS 442

Query: 415 FPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSX 474
           FPA++IILSD L MQYQGMAGSL NT++NYS SLCLGMGTTVERQINK+G +LL+GYR  
Sbjct: 443 FPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502

Query: 475 XXXXXXXXXXXXXXXFLNLCYDLWRKRKSRL 505
                           + L   LW KRK  L
Sbjct: 503 EYLGIGLAGLGIIITAIYLGEILWGKRKQHL 533

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/454 (59%), Positives = 357/454 (78%)

Query: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGT 78
           D ++E +  WQN +YF+   +EY FIFTCM + LLNQAG TQ LS MN++S+SF S+  +
Sbjct: 50  DEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNS 109

Query: 79  QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIV 138
           ++WLMASFPLVSGSFILISGR+GDIYGLKK ++ GY+ +IIW+L+CG  +Y+ SDTFFI+
Sbjct: 110 KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFII 169

Query: 139 CRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATES 198
           CRAFQGLGI+F+LPN++G++GNIY  GT RKNIVIS +G  AP GA +G L+ GLI TE+
Sbjct: 170 CRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEN 229

Query: 199 SRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQ 258
             QWPW FYA+++A+ +N  ++IY++P N+PTN+H+F+MDW+G+++GV+GLIL NFVWNQ
Sbjct: 230 PNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQ 289

Query: 259 GPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWG 318
            P++GW++ Y                 YE+ F  SPLLP  V K+  ++ I+  LF GWG
Sbjct: 290 APISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWG 349

Query: 319 SFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSAL 378
           SFGI+TFYY+ FQLN+R+Y+ LWAG T+FMF+IWG IAA +VGFTI  V P+V LFFS +
Sbjct: 350 SFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMV 409

Query: 379 GFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLV 438
            F +GS+M SVTP+H+TY+R  +G  IILSFGMDLSFPASSII SD+LPM+YQGMAGSLV
Sbjct: 410 AFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLV 469

Query: 439 NTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           NT++NYS SLCLGMG TVE Q++  G+ LL+GYR
Sbjct: 470 NTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYR 503

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/512 (57%), Positives = 366/512 (71%), Gaps = 8/512 (1%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           E    IVSS++   ++ DS      PWQ+  YF S  KE  FI TCM A LLNQAGQT  
Sbjct: 37  EEVTTIVSSTKSTQVTNDS------PWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHA 90

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           L  MNV+S+SF+S+   Q WLMASFPL +GSFILISGR+GDIYGLKK +I GY+ +I+W+
Sbjct: 91  LCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWS 150

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           ++ G + Y++SD FFI  RAFQG+GI+FILPNIMGLVG++YKVG+ RKNIVIS IG  AP
Sbjct: 151 IISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAP 210

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
           TG   G L+GGLI TE   QWPW+FYA+ +A F++L+MA YS+P NVPTN+H  +MDW G
Sbjct: 211 TGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTG 270

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVT 301
           + + ++GLILFNFVWNQ P+ GW KPY                 YE K+   PLLPR +T
Sbjct: 271 SALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMT 330

Query: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361
           KN  ++ IL  +FLGWGSFGIWTFYY +FQLNLR+YSP+W G T+F+F+I+GS+AAF V 
Sbjct: 331 KNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVA 390

Query: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421
           F+I R+GPA+LL FS + F  GS+M SV P+ Q+YW++N  MQ IL FGMDLSFPASSII
Sbjct: 391 FSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSII 450

Query: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXX 481
           LSD LPMQYQGMAGSLVNT+INYS SLCLGMG TVE QINK+G +LL+GYR+        
Sbjct: 451 LSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGL 510

Query: 482 XXXXXXXXFLNLCYDLWRKRKSRLDDIRSLNT 513
                      +  +LW + +   D  RSL  
Sbjct: 511 ASLGVVISVTYMLENLWNRHRKSED--RSLEA 540

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/500 (55%), Positives = 365/500 (73%), Gaps = 2/500 (0%)

Query: 15  TLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHS 74
           T S D +++    WQN  YF+   +EY FIFTCM + LLNQ+G TQ LS MN++++SF S
Sbjct: 54  TNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS 113

Query: 75  DVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDT 134
           D  +++WLMASFPLVSGSFILISGR+GDI+GLK  ++ GY+ +IIW+L+CG   Y+ SDT
Sbjct: 114 DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173

Query: 135 FFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLI 194
           FFIV RAFQGLGI+F+LPN++G++GN+Y  GT RKNIVIS IG  AP GA +G  + GLI
Sbjct: 174 FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233

Query: 195 ATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNF 254
            T +  QWPW FYAY + A +NLI++IY++P N+PTNVH F+MDW+G+ +GV+GL+L N 
Sbjct: 234 GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNL 293

Query: 255 VWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILF 314
           VWNQ P++GW + Y                 YE+ F  SPLLP+ V K+  ++ I+  LF
Sbjct: 294 VWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLF 353

Query: 315 LGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLF 374
            GWGSFGI+TFYY+ FQLN+R+Y+PLWAG ++FMF+IWG IAA +VGF+I RV P+V LF
Sbjct: 354 FGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLF 413

Query: 375 FSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMA 434
           F+ + F +GS+M SVTP+H+TY+RM +G  IILSFGMDLSFPASSII SD+LPM+YQGMA
Sbjct: 414 FAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMA 473

Query: 435 GSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXXXXXXXXXXFLNL- 493
           GSLVNT++NYS SLCLGMG TVE Q++  G+ +L+GYR                  L + 
Sbjct: 474 GSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533

Query: 494 -CYDLWRKRKSRLDDIRSLN 512
            CY    + K+  +D RS++
Sbjct: 534 ECYIKDHRAKAVAEDKRSMS 553

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/506 (56%), Positives = 365/506 (72%), Gaps = 4/506 (0%)

Query: 2   ENKEPIVSSSQKKTLSCDS----LLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAG 57
           E  + IVS+ ++ T    S     + N +PWQ+  YF S  KE  FI TCM A LLNQAG
Sbjct: 26  EEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAG 85

Query: 58  QTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFM 117
           QT  L  MNV+S+SF S+   Q WLMASFPL +GSFILISGR+GDIYGLKK ++ GY+ +
Sbjct: 86  QTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVII 145

Query: 118 IIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIG 177
           I+W+++ G + Y+++D+FFI CRAFQG+GI+FILPNIMGLVG++YKVG+LRKN+VIS+IG
Sbjct: 146 IVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIG 205

Query: 178 ITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAM 237
              PTGA  G ++GGLI TE   QWPW+FYA+ +A F++++MA YS+P NVPTNVH  +M
Sbjct: 206 ACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSM 265

Query: 238 DWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLP 297
           DW G+++ V+GLILFNFVWN+ P+ GW K Y                 YE+K+   PLLP
Sbjct: 266 DWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLP 325

Query: 298 REVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAA 357
             VTKN  ++ IL  +F+GWGSFGIWTFYY +FQLNLR+YSP+W G T+F+F I+G+IAA
Sbjct: 326 HAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAA 385

Query: 358 FIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPA 417
           F V F+I R+GPA+LL F+ + F  GS+M SV P+ Q+YW++N  MQ +L FGMDLSFPA
Sbjct: 386 FFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPA 445

Query: 418 SSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXX 477
           SSIILSD LPMQYQGMAGSLVNT+INYS SLCLGMG TVE QINK+G+ +L GYR+    
Sbjct: 446 SSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYL 505

Query: 478 XXXXXXXXXXXXFLNLCYDLWRKRKS 503
                          +   +W +RK 
Sbjct: 506 GIGLASLGVLISVTYMLETVWNERKK 531

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/509 (56%), Positives = 368/509 (72%), Gaps = 6/509 (1%)

Query: 1   MENKEPIVSSSQKKTLSC------DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLN 54
           M+  + +V S++ + ++        + + N +PWQ+  YF S  KE  FI TCM A LLN
Sbjct: 24  MKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLN 83

Query: 55  QAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 114
           QAGQT  L  MNV+S+SF+S+   Q WLMASFPL +GSFILISGR+GDIYGLKK ++ GY
Sbjct: 84  QAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGY 143

Query: 115 IFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVIS 174
           + +IIW+++ G + Y++SD FFI CRAFQGLGI+FILPNIMGLVG++YKVG+LRKN+VIS
Sbjct: 144 VIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVIS 203

Query: 175 LIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
           +IG  AP G   G ++GGLI TE   QWPW+FYA+++A F++L+MA YS+P NVPTNVH 
Sbjct: 204 VIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHG 263

Query: 235 FAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISP 294
            +MDW G+ + V+GLILFNFVWNQ P+ GW + Y                 YE+K+   P
Sbjct: 264 LSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVP 323

Query: 295 LLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGS 354
           LLP  VTKN  ++ IL  +FLGWGSFGIWTFYY +FQLNLR+YSP+W G T+F+F+I+GS
Sbjct: 324 LLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGS 383

Query: 355 IAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLS 414
           IAAF V F+I R+GPA+LL F+ + F  GS+M SV P+ Q+YW++N  MQ IL FGMDLS
Sbjct: 384 IAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLS 443

Query: 415 FPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSX 474
           FPASSIILSD LPMQYQGMAGSLVNT+INYS SLCLGMG TVERQINK+G+ LL+GYR+ 
Sbjct: 444 FPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAA 503

Query: 475 XXXXXXXXXXXXXXXFLNLCYDLWRKRKS 503
                             +  + W K K 
Sbjct: 504 IYLGIGLASLGLLISVTYMLENFWNKHKE 532

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/471 (56%), Positives = 353/471 (74%), Gaps = 6/471 (1%)

Query: 3   NKEPI-VSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           N+E + +S+   + ++ D        WQN  YF++   EY FIFTCM + LLNQAG TQ 
Sbjct: 36  NEETVTISTDHGEEMTVDK-----QRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQT 90

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           LS MN+I+ SF S+  ++TWLMASFPLVSGSFILISGR+GDIYGLKK +  GY+ +IIW+
Sbjct: 91  LSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           L+CG   Y+ SDTFFI+ RAFQGLGI+F+LPN++G++GNIY  GT RKNIVISL+G  AP
Sbjct: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
            GA +G L+ GLI T++ +QWPW FYAY + + +NL +++YS+P N+PTN+ +F+MDW+G
Sbjct: 211 VGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIG 270

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVT 301
           + +GV+GL+L NFVWNQ P++GW + Y                 YE +F  SPLLPR V 
Sbjct: 271 SALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVL 330

Query: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361
           K+  ++ I+  LF GWGSFGI+TFYY+ FQLN+R+YS +WAG T+FMF+IWG IAA +VG
Sbjct: 331 KDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVG 390

Query: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421
             I +V P+V LF S + F +GS+M SVTP+H+TY+R  +G  IILSFGMD SFPASSII
Sbjct: 391 IYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSII 450

Query: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
            SD+LPM+YQGMAGSLVNT++NYS SLCLGMG TVE  ++  G+ +L+GYR
Sbjct: 451 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYR 501

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/472 (56%), Positives = 351/472 (74%), Gaps = 5/472 (1%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           ++   IV   Q  T + D     +  WQN +YF S LKEY F+ +C  + LLNQAG  Q 
Sbjct: 28  QDNNDIVDEKQCDTQAID----GNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQT 83

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
              MN++++S  S  G Q WLMA+FPL+SGSFILISGRIGDIYGLKKT++ GY+F+I+W+
Sbjct: 84  QPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWS 143

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           L+CG   Y HSD+FFIV RAFQGLGIS ILPNI+G+VG+IY  G+ RKN+VISLIG  AP
Sbjct: 144 LICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAP 203

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
            GA +GA++ GLI TE + QWPW FY+YA+ A +N +++I+ +P  +PTNVH   MDW+G
Sbjct: 204 IGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIG 263

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPI-SPLLPREV 300
           + +GVVGLI+ NFVWNQ P++GW   Y                 YEL F   +PLLP+EV
Sbjct: 264 SGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEV 323

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
            K+ + + +L  LF GWGSFGI++FYY+ FQLNLR+Y+PLWAG T+FMF+IWG +AA +V
Sbjct: 324 LKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVV 383

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
           GFTI +V P+++LF S + F  GS+++SVTPIHQTY+R ++GM IILSFGMDLSFPASSI
Sbjct: 384 GFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSI 443

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           +LSD LP+QYQGMAGSLVNT++NYS S CLG+   VE+ +N  G+++L+GYR
Sbjct: 444 LLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYR 495

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/477 (56%), Positives = 341/477 (71%), Gaps = 5/477 (1%)

Query: 2   ENKEPIVSSSQKKTLSCDS-----LLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQA 56
           EN+     S + K L+ +      + E  +PWQ+  YF+    E  F+ +CM   LLNQA
Sbjct: 20  ENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQA 79

Query: 57  GQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIF 116
           G T  LSTM V+     S     +WLMASFPLVSGSFILISGR+GDIYGLKK ++ GYI+
Sbjct: 80  GSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIW 139

Query: 117 MIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLI 176
           + IW+L+CG + ++H+DTFFI  RAFQGLGISF+LPN++G+VGNIYK GT RKNIVISLI
Sbjct: 140 LTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLI 199

Query: 177 GITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFA 236
           G+ AP GA  G L+ G++       WPW FYAY +AAF+  I++ + +P ++P NV+ FA
Sbjct: 200 GMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFA 259

Query: 237 MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLL 296
           MDW+G+ +GV GL+LFNFVWNQ  V GWA  Y                 +E+K+   PLL
Sbjct: 260 MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLL 319

Query: 297 PREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIA 356
           P+EVT++  I+ IL  L  GWGSFGIW FYY+ F L LRNYSP+WAG T FM  I G IA
Sbjct: 320 PKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIA 379

Query: 357 AFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFP 416
           A  VGF+I RVGPAVLLFFS + FT GS++LSVTP+H+TY+R  +G  +ILSFGMDLSFP
Sbjct: 380 ALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFP 439

Query: 417 ASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS 473
           A+SIILSD L MQYQGMAGSLVNT++NYS SL LG+G T+ERQINK+G+ LL G+R+
Sbjct: 440 AASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRA 496

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/475 (57%), Positives = 343/475 (72%), Gaps = 5/475 (1%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPW---QNEQYFQSHLKEYFFIFTCMFANLLNQAGQ 58
           ++KE    S+   T   D  +++   W   Q+  YF +  KEY FIF  M + LLNQAG 
Sbjct: 13  QSKELGTQSATAFTEHSDVQVDDK-KWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           TQ LS +N++S++F S    QTWLMASFPLVSGSFIL+SG+IGDIYGLKKT++ GY+  I
Sbjct: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGI 178
           IW+L+CG   YT S  FFI+ RAFQGLGI+FILPNIMG+VGNIY  GT RKN+VISLIG 
Sbjct: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191

Query: 179 TAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMD 238
            AP GA MG L+ GLI T S R W W FYAY + A +N+ ++I+ +P  +PTNV   +MD
Sbjct: 192 CAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMD 250

Query: 239 WMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPR 298
           W+G+ IG++G+ILFNFVWNQGP+ GW   Y                 YE K+   PL+PR
Sbjct: 251 WIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPR 310

Query: 299 EVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAF 358
               N ++L  L  +F GWGSFGIWTFYY+ F LNLR Y+PLWAG ++FMF+IWG IAA 
Sbjct: 311 PAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAI 370

Query: 359 IVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPAS 418
            VG+TI R+ P+++LF S L F  G +MLSVTP+ QTY+RM +GM IILSFGMDLSFPAS
Sbjct: 371 SVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPAS 430

Query: 419 SIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS 473
           SIILSD LPM+ QGMAGSLV+T+INYS S+CLG+  TVE QINK G++LL+GYR+
Sbjct: 431 SIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRA 485

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/469 (55%), Positives = 339/469 (72%)

Query: 4   KEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLS 63
           +E I S          S+   ++  +N  YF S  +EY FIF+CM + LLN AG TQ LS
Sbjct: 18  EETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLS 77

Query: 64  TMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLL 123
            MNV++   HS    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK +I GY+ ++IW+L+
Sbjct: 78  IMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLI 137

Query: 124 CGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTG 183
            G + Y+HS  FFI+ RAFQGLGIS +LPN++GL+G IYK GTL+KN+VIS++G  +P G
Sbjct: 138 TGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIG 197

Query: 184 ACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAI 243
           A +G L+ GL+ATES   WPW FYAY LAAF+N  ++ YS+P N+PTNV+  +MDW+G+ 
Sbjct: 198 ATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSF 257

Query: 244 IGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKN 303
            GV+GLILFNFVWNQ P +GW   Y                 YEL++  +PLLP E+ +N
Sbjct: 258 TGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRN 317

Query: 304 GQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFT 363
            Q++ IL  +  GWGSFGIWTFYY++F LNLRNYSPLWAG ++F+F+I G+I A   GF 
Sbjct: 318 RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 377

Query: 364 INRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILS 423
           + ++ PAVLL FS +GF +G ++ SVTP+HQTY+R  +G  IIL  GMDLSFPASSIILS
Sbjct: 378 MKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILS 437

Query: 424 DHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           D+LP Q+QGMAGSLVNT+INYS SL LG+  TVE+  NK G +LLRGYR
Sbjct: 438 DNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYR 486

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/491 (53%), Positives = 339/491 (69%), Gaps = 1/491 (0%)

Query: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGT 78
           D LL + +  QN  YF    KEY F+ + M + LLNQA   Q     +++SE   +    
Sbjct: 29  DMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQ 88

Query: 79  QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIV 138
           Q WLMASFPLVSGSFIL+SG++GDIYGLKKT++GGY  ++IW+L+CG + Y H+  FFIV
Sbjct: 89  QAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIV 148

Query: 139 CRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATES 198
            R+FQGLGI+F+LPN+ G+VGNIYK  T  KN+V S+IG  AP GA +G L+ GLI TES
Sbjct: 149 ARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES 208

Query: 199 SRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQ 258
              W W FYAY + A +N ++A Y +P+N+PTNVH F MDW+G+ +GV GLI+FNFVWNQ
Sbjct: 209 -EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQ 267

Query: 259 GPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWG 318
            P +GW   Y                 +E +F   PLLPR V  N +++ IL  LFLGWG
Sbjct: 268 APTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWG 327

Query: 319 SFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSAL 378
           SFGIWT+YY AF LNLR+Y+PLWAG ++FMF I+G+IAAF+VG TI++ GPA++L  S +
Sbjct: 328 SFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVI 387

Query: 379 GFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLV 438
            F +G +MLSVTP+ QTY+RM++G  +ILSFGMDLSFPASSIILSD LP QYQGMAGSLV
Sbjct: 388 AFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLV 447

Query: 439 NTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXXXXXXXXXXFLNLCYDLW 498
           NT+INYS SLCLG+  T ERQ+NK G +LL+GYR+                      D W
Sbjct: 448 NTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWW 507

Query: 499 RKRKSRLDDIR 509
            +R+ R   I+
Sbjct: 508 TRRRERSVRIK 518

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/506 (52%), Positives = 344/506 (67%), Gaps = 5/506 (0%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTP---WQNEQYFQSHLKEYFFIFTCMFANLLNQAGQ 58
           EN E + SSS       D   E   P    QN  YF    KEY F+ + M + LLNQA  
Sbjct: 10  ENWEKLQSSSAAGE-ERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAAT 68

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           TQ     +V+S+  ++ V  Q WLMASFPLVSGSFIL+SG++GDIYGLKKT++GGY+ ++
Sbjct: 69  TQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVV 128

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGI 178
           IW+L+CG + Y H+  FF+V R+FQGLGI+F+LPN+MG+VGNIYK  T  KN+V SLIG 
Sbjct: 129 IWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGA 188

Query: 179 TAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMD 238
            AP GA +G ++ GLI   +   W W FYAYA+ A +N ++A++ +P N+PTNV+ + MD
Sbjct: 189 CAPIGATLGCVFSGLIGARTDL-WGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMD 247

Query: 239 WMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPR 298
           W+G+ IGV GLILFNFVWNQ P+ GW   Y                 YE++F   PLLP 
Sbjct: 248 WIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPH 307

Query: 299 EVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAF 358
            V  N +++ IL  LF GWGSFGIWTFYY +F LNLR+YSPLWAG T+FMF IWG +A+ 
Sbjct: 308 SVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASL 367

Query: 359 IVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPAS 418
           +VG+TI++ GPAV+LF S + F  G +ML+VTP+HQTY+RM +G+ IILSFGMDLSFPA+
Sbjct: 368 LVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAA 427

Query: 419 SIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXX 478
           SIILSD LP QYQGMAGSLV+T+I+YS SLCLG+  T E Q+NK G +LL+GY++     
Sbjct: 428 SIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVG 487

Query: 479 XXXXXXXXXXXFLNLCYDLWRKRKSR 504
                         +  D W  R+ R
Sbjct: 488 IGLASLGVVISGAFMIEDWWTSRRKR 513

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/472 (54%), Positives = 346/472 (73%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           E+ +  +S  +     C+ ++   + WQ+  YF++  +EY F+ +CM   LLNQA   Q 
Sbjct: 11  EHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70

Query: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           LS MNV+S+SF+S    QTWL+ASFPLV+GSFILISGRIGDIYGLKKT+IGGYIF+IIW+
Sbjct: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           L+CGF  Y+ SDTF I+ RAFQGLGI+F LPN++G +GNIY VG+LRKN+VISLI  +AP
Sbjct: 131 LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAP 190

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241
            GA +G  + GLI TES  QWPW FYA+A+A   NL+++IYS+P N+PTNV+ F MDW+G
Sbjct: 191 VGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIG 250

Query: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVT 301
           + + V GLILFNF WNQGP+ GW   Y                 YE+ F  SPL+ RE+T
Sbjct: 251 SALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREIT 310

Query: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361
            +  ++  +  LFLGWGS+GIW+FYY++F LNLR+YSP+WAG ++F+F I+G +A+  VG
Sbjct: 311 HSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVG 370

Query: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421
            +I ++   V+L FS + F +G+ +LSV P+ Q+Y+++ +    IL  G+D SFPA++II
Sbjct: 371 ISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATII 430

Query: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS 473
           LSD LPM+YQGMAGSL  T++NYS SLCLGMG TVERQINK G+++L+GYRS
Sbjct: 431 LSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/514 (50%), Positives = 346/514 (67%), Gaps = 4/514 (0%)

Query: 1   MENKEPIV-SSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQT 59
           +++ E +V + S+K   +  S    S   Q  QYF S L E+ FIFTC+   LLNQAG T
Sbjct: 37  IDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTT 96

Query: 60  QVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMII 119
           Q +S MN+I+E F S+   Q WL ASFPLVSGSFIL+ GR GDIYGLKK ++ GY  + I
Sbjct: 97  QSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTI 156

Query: 120 WTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGIT 179
           W+++CG   YTHSD FFIV +AFQGLG+SFILPNI+GLVG IY+ G+++KNI IS IG  
Sbjct: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216

Query: 180 APTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDW 239
           AP GA  G L+ G++  +  + WPW FYA+A+ +F+  +   + VP+NVPTN +N  MDW
Sbjct: 217 APLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDW 276

Query: 240 MGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPRE 299
           +G+ +GVVGL+LF+FVWNQ P++GW K Y                 YE+ +   PLLP+ 
Sbjct: 277 IGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYEINYAEVPLLPKA 336

Query: 300 VTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFI 359
           +T N  I+ IL  +F+GWG+FGIW+FYY++F LNLR++SP+W G  +F FI+ G   A  
Sbjct: 337 ITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASC 396

Query: 360 VGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASS 419
           VGF I  + P+++L  S  GFTMG+L+ +VTP  QTYWR   GM ++L  GMDLSFPASS
Sbjct: 397 VGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASS 456

Query: 420 IILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXX 479
           IILSD LP +YQGMAGSLVNT++NYS S CLG+ TTVE+QIN +G++LL+GYR+      
Sbjct: 457 IILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGV 516

Query: 480 XXXXXXXXXXFLNLCYDLWR--KRKSRL-DDIRS 510
                      L +    W   K K++L +DI S
Sbjct: 517 GIGTLGISIASLYMFETFWTDYKEKTKLANDIES 550

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  518 bits (1334), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 246/510 (48%), Positives = 344/510 (67%), Gaps = 1/510 (0%)

Query: 8   VSSSQKKTLSCDSLL-ENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMN 66
           ++SS  + LS D+   + S+ +QN  YF++  +E+ FIF+ M   LL+QAG TQ LS MN
Sbjct: 41  LNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMN 100

Query: 67  VISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGF 126
           V+++   S    Q WLM+SFPL  GSFIL+SGR+GDIYGLKK ++GGYI   +W+++CG 
Sbjct: 101 VLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGL 160

Query: 127 ADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACM 186
           + Y H+D FFI  RAFQGLG++F LPN++GL+G IY+ G  RKN++IS+IG  +PTGA +
Sbjct: 161 SSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATL 220

Query: 187 GALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGV 246
           G L+ GL        WPW FYA+ L +FVNLI++ Y +P ++PTN+H   MDW+G+++GV
Sbjct: 221 GGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGV 280

Query: 247 VGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQI 306
            GLI+ NFV+NQ P+ GW   Y                 YE+K+  +PL+P+ ++ N  +
Sbjct: 281 FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 340

Query: 307 LTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINR 366
           L IL  LF GWGSFGIWTFYY++F+LNLR+YSPLWAG+++F+F+I GS  A + G TI +
Sbjct: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK 400

Query: 367 VGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHL 426
           + P+VL   S +GF  G+++ + TP++QT++R  +G   +L  GMD SFPASSIILSD L
Sbjct: 401 IKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSL 460

Query: 427 PMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXXXXXXX 486
           PMQYQGMAGSLVNT+INYSTS+CLGM  TVE + N  G++LL GYR+             
Sbjct: 461 PMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAV 520

Query: 487 XXXFLNLCYDLWRKRKSRLDDIRSLNTNDS 516
                 +   LW+ R   L++ +  +   S
Sbjct: 521 CVSGGYMIECLWKDRVLSLEENKQTDIESS 550

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  498 bits (1282), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/466 (48%), Positives = 333/466 (71%), Gaps = 7/466 (1%)

Query: 14  KTLSCDSLLENSTPWQNE------QYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNV 67
            ++S DS + NS   Q+E      +YF++   EY FI +CM +  ++QAG TQ LS MN+
Sbjct: 67  SSVSNDSDI-NSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNI 125

Query: 68  ISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFA 127
           ++E  +++   Q WLMASF L  GSFIL+SGR+GDIYGLKK ++GGY  + IW+L+CGF+
Sbjct: 126 LAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFS 185

Query: 128 DYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMG 187
            Y+H+D FFI  RAFQGLG++F+LPN +GL+G IY+ G+++KN++I  +G  +P GA +G
Sbjct: 186 SYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLG 245

Query: 188 ALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVV 247
            L+ G+I T+  +QWPW FY++ + +F N+I++ YS+P N+PTN++N +MDW+GAI+G+ 
Sbjct: 246 GLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIF 305

Query: 248 GLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQIL 307
           GL++ NFV+NQ P+ GW   Y                 YE+K+  +PL+P+ ++ N  +L
Sbjct: 306 GLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGML 365

Query: 308 TILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRV 367
            IL  LF GWG+FG WTFYY++F LN+R Y+  WAG ++F+FI+ G   A + GF + +V
Sbjct: 366 MILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKV 425

Query: 368 GPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLP 427
            P+V+L+ S +GF  G +ML+VTPIHQ+Y++  +G+  +L  G+DLSFPA+SIILSD LP
Sbjct: 426 PPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALP 485

Query: 428 MQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRS 473
           +QYQGMAGSLV TI NYSTS+CLGM  +VE   N  G+ +L+GYR+
Sbjct: 486 IQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRN 531

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 304/496 (61%)

Query: 22  LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81
           +  S   +    F++  +E+ F+   +    L+Q G TQVLSTMN+++E  H+    Q W
Sbjct: 104 ITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPW 163

Query: 82  LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRA 141
           LMA+FPL  G  ILISGR+GDI+GLKK ++ GYI   IWTL+CGF+ Y HSD  FIV R 
Sbjct: 164 LMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRT 223

Query: 142 FQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQ 201
           FQGLG++  LPN+  L+G IYK    +KN++  +IG  +P GA +G ++ GL    + + 
Sbjct: 224 FQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKN 283

Query: 202 WPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGPV 261
           WPW FY++A+ AF+N I+A + +P ++  N     MDW+G+ +G+ GL++ NFV+NQ P+
Sbjct: 284 WPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPI 343

Query: 262 NGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSFG 321
           +GW+  Y                 YEL     PL+P+ +  N +++ IL  LF GWG F 
Sbjct: 344 DGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFA 403

Query: 322 IWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFT 381
           IWTFYY+AFQLNLR+YSPLWA +++F+ II G+I   I    + R+ P +LLFFS LGF 
Sbjct: 404 IWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFL 463

Query: 382 MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTI 441
            G+++ +VTPIHQT++R   G   +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  
Sbjct: 464 GGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVA 523

Query: 442 INYSTSLCLGMGTTVERQINKTGEELLRGYRSXXXXXXXXXXXXXXXXFLNLCYDLWRKR 501
           INY+TS+C+GM  +     N  G++LL G+R+                 L +   +W  R
Sbjct: 524 INYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDR 583

Query: 502 KSRLDDIRSLNTNDSA 517
             ++ + + +NT+  +
Sbjct: 584 NQKMKENKLINTDSES 599

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  317 bits (811), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/478 (37%), Positives = 277/478 (57%), Gaps = 18/478 (3%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61
           EN +  V + +K     D +L +    Q E+  +S L E  F+     A L+ QAG  Q 
Sbjct: 10  ENLDMNVETLKKD----DEVLSDEFDVQEEKP-ESLLWESAFVGVLCSAQLMTQAGLGQS 64

Query: 62  LSTMNVISESF-HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           L+ +++I +SF  ++ G  +W  +++ L  G+FILI+GR+GDI+G KK  + G+ +  +W
Sbjct: 65  LAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +LL GF+ Y++   FF  CRAFQG+G +F+LPN + ++G  YK G  RKN+V SL G +A
Sbjct: 125 SLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASA 182

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTN--VHNFAM- 237
           P G  +GA++  ++   +   WPW ++   +A F+  +   Y +P     N  V +F + 
Sbjct: 183 PGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240

Query: 238 ---DWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISP 294
              D+ G++ GVVGLILFNF WNQGPV GW  PY                  E +    P
Sbjct: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRAAF-P 299

Query: 295 LLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGS 354
           LLP     +     +L  +  GW SFGIW FY + F  + R  +PL + A      I G 
Sbjct: 300 LLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGF 358

Query: 355 IAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLS 414
            AA + GF ++   P+ ++FF+   FT+G+++++  P+HQTYW       I++ +GMD+S
Sbjct: 359 CAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 418

Query: 415 FPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           FPA++I+LSD +P ++QG+A SLVNT++NYS S+ LG+  T+E  +N  G  +L+GYR
Sbjct: 419 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYR 476

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  310 bits (794), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 177/480 (36%), Positives = 268/480 (55%), Gaps = 25/480 (5%)

Query: 9   SSSQKKTLSCDSLLENSTPWQNEQYFQSH----------LKEYFFIFTCMFANLLNQAGQ 58
             +QKK    D L   ST  Q ++  Q H          L E  F+     A L+ QAG 
Sbjct: 7   EENQKKD---DGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGL 63

Query: 59  TQVLSTMNVISESFHS-DVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFM 117
            Q ++ +++I +SF + + G  +W  A++ L  G+FILI+GR+GD+YG KK  I G+ + 
Sbjct: 64  GQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWY 123

Query: 118 IIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIG 177
            +W+LL GF+ Y++   FF  CRAFQG+G + +LPN + ++G  Y  G  RK +++SL G
Sbjct: 124 ALWSLLAGFSVYSN-QIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFG 181

Query: 178 ITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPE----NVPTNVH 233
            TAP G  +GA++  +    +   WPW ++A  +  F   +  I  +P      + T+V 
Sbjct: 182 ATAPAGFVLGAVFSSIFGQLT--WWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVS 239

Query: 234 NFA-MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPI 292
            +  +D  G++ GV+GL+L NF WNQGPV GW  PY                  E + P 
Sbjct: 240 TYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESRAP- 298

Query: 293 SPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIW 352
            PLLP     +     +LG +  GW SFGIW +Y++ F   LR +SPL   A      I 
Sbjct: 299 HPLLPLSALSSDAAF-VLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAIS 357

Query: 353 GSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMD 412
           G  AA   GF I RV  ++++ F+   FT+G ++++  P+ Q YW       I++ +GMD
Sbjct: 358 GLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMD 417

Query: 413 LSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           +SFPA++I+LSD +P ++QG+A SLVN ++NYS S+ LG+  TVE ++N  G  LL+GYR
Sbjct: 418 MSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYR 477

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  308 bits (790), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 171/451 (37%), Positives = 267/451 (59%), Gaps = 14/451 (3%)

Query: 29  QNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESF-HSDVGTQTWLMASFP 87
           Q+E+  +S L E  F+     A L+ QAG  Q L+ +++I  SF  ++ G  +W  +++ 
Sbjct: 32  QDERP-KSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYS 90

Query: 88  LVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGI 147
           L  G+FILI+GR+GDI+G KK  + G+ +  +W+LL GF+ Y++   FF  CRAFQG+G 
Sbjct: 91  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 149

Query: 148 SFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
           +F+LPN + ++G  YK G  RKN+V SL G +AP G  +GA++  ++   +   WPW ++
Sbjct: 150 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLA--WWPWAYW 206

Query: 208 AYALAAFVNLIMAIYSVPEN-VPT-NVHNFAM----DWMGAIIGVVGLILFNFVWNQGPV 261
              +A FV  +   + +P   +P+ +  +F +    D+ G++ GVVGLILFNF WNQGPV
Sbjct: 207 IMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPV 266

Query: 262 NGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSFG 321
            GW  PY                  E +    PLLP     +     +L  +  GW SFG
Sbjct: 267 VGWQTPYTYALLIVGTFFLVIFAYIESRAAF-PLLPFAALSSDTAF-VLSCIAAGWASFG 324

Query: 322 IWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFT 381
           IW FY + F  + R  +PL + A      I G  AA   GF ++   P+ ++ F+   FT
Sbjct: 325 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFT 384

Query: 382 MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTI 441
           +G+++++  P+HQTYW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNT+
Sbjct: 385 VGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 444

Query: 442 INYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           +NYS S+ LG+  T+E ++N  G + L+GYR
Sbjct: 445 VNYSISIGLGIAGTIESRVNDGGAKPLKGYR 475

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  307 bits (786), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 175/472 (37%), Positives = 273/472 (57%), Gaps = 14/472 (2%)

Query: 8   VSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNV 67
           + +S + T + D +L N    Q+E    S + E  F+     A L+ QAG  Q ++ +++
Sbjct: 12  LETSAETTKTDDEVLLNQFELQDETP-GSLVWEAAFVGVLCSAQLMTQAGLGQSIAPLHI 70

Query: 68  ISESF-HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGF 126
           I +SF  ++ G  +W  +S+ L  G+FILI+GR+GDI+G +K  I G+ +  +W+LL GF
Sbjct: 71  IGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGF 130

Query: 127 ADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACM 186
           + Y++   FF  CRAFQG+G +F+LPN + ++G  YK G  RKN+V SL G +AP G  +
Sbjct: 131 SVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAPGGFVL 188

Query: 187 GALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPE-NVPT-NVHNFAM----DWM 240
           GA++  ++   +   WPW ++   +A F+  +   + +P   +P+ +  +F M    D+ 
Sbjct: 189 GAVFSSMLGQLA--WWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFA 246

Query: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREV 300
           G++ GV+GLILFNF WNQGPV GW  PY                  E +    PLLP   
Sbjct: 247 GSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLLPFAA 305

Query: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360
             +     +LG +  GW SFGIW FY + F    R  SPL + A      I G  AA   
Sbjct: 306 LSSDAAF-VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTT 364

Query: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420
           GF ++    + ++ F+   FT+G ++++  P+HQTYW       I++ +GMD+SFPA++I
Sbjct: 365 GFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATI 424

Query: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           +LS+ +P ++QG+A SLVNT++NYS S+ LG+  T+E Q+N  G   L+GYR
Sbjct: 425 MLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYR 476

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  307 bits (786), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 167/444 (37%), Positives = 257/444 (57%), Gaps = 13/444 (2%)

Query: 36  SHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESF-HSDVGTQTWLMASFPLVSGSFI 94
           S L E  F+     A L+ QAG  Q L+ +++I +SF  ++ G  +W  +++ L  G+FI
Sbjct: 39  SLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFI 98

Query: 95  LISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNI 154
           LI+GR+GDI+G KK  + G+ +  +W+LL GF+ Y++   FF  CRAFQG+G +F+LPN 
Sbjct: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNA 157

Query: 155 MGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAF 214
           + ++G  YK G  RKN+V SL G  AP G  +GA++  L+   +   WPW ++   +A F
Sbjct: 158 IAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQLA--WWPWAYWIMGIACF 214

Query: 215 VNLIMAIYSVPENVPTNVHNFA------MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPY 268
              I   + +P     + H  +      +D+ G++ GV+GLILFNF WNQGPV GW  PY
Sbjct: 215 FLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPY 274

Query: 269 XXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYY 328
                             E +    PLLP     +     +L  +  GW SFGIW FY +
Sbjct: 275 TYILLIVGTVFLAIFAFIESRAAF-PLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTW 332

Query: 329 AFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLS 388
            F  + R  +PL + A      + G  AA   G+ ++R  P+ ++ F+   FT G+++++
Sbjct: 333 QFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIA 392

Query: 389 VTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSL 448
             P+HQTYW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNT++NYS S+
Sbjct: 393 TAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISI 452

Query: 449 CLGMGTTVERQINKTGEELLRGYR 472
            LG+  T+E  +N  G + L+GYR
Sbjct: 453 GLGIAGTIESNVNDGGAKPLKGYR 476

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  305 bits (782), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/478 (37%), Positives = 272/478 (56%), Gaps = 15/478 (3%)

Query: 2   ENKEPIVSSSQKKTLSC--DSLLE--NSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAG 57
           E++    S   ++++SC  +S  E  +   W     F    KEY F+FT + A   NQAG
Sbjct: 8   EDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAG 67

Query: 58  QTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFM 117
            T +L  +NV+S+SFH       +L+ S+P+V GSF+LI GR+G+++G K+T++GGYI +
Sbjct: 68  GTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIIL 122

Query: 118 IIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYK--VGTLRKNIVISL 175
           I+ +LL G + Y+ S  F+++CRAFQG+G++ ILPN        Y+      RK I+ ++
Sbjct: 123 ILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTI 182

Query: 176 IGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNF 235
           IG  A TGA +G    G+  T S   W W +Y Y +AA + L ++ YSVP+N+ T  +  
Sbjct: 183 IGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNI-TKKNKP 241

Query: 236 AMDWMGAIIG-VVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISP 294
            ++ +G       GL++ N   N   V      +                 +ELKF   P
Sbjct: 242 CLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDP 301

Query: 295 LLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGS 354
           +  +E+  N  +  +L  +F GWG++GIW+ Y++ F LNLRNYSPL AG+T+   +I G 
Sbjct: 302 VFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGY 361

Query: 355 IAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLS 414
           +A   +   + R GP + L FS+LGFT   ++LSVTPIHQ+Y+R  +G  I L+ G+D S
Sbjct: 362 VAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFS 421

Query: 415 FPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
           FP+S+IIL + LP +Y  M   L N I NY+ S   G+  +  R ++    EL++ YR
Sbjct: 422 FPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSSI--ELIKYYR 477

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  302 bits (773), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 171/468 (36%), Positives = 263/468 (56%), Gaps = 14/468 (2%)

Query: 11  SQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISE 70
           S KK  S +   ++S   QN + + S LKE F I     A L+ QAG  Q +  + +I +
Sbjct: 2   SSKKLNSHEE--QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGD 59

Query: 71  SFH-SDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADY 129
           SF   + G  +W  ++F L  G+FILI+GR+GD +G KK  + G+++  +W++L GF+ Y
Sbjct: 60  SFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVY 119

Query: 130 THSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGAL 189
           ++   FF  CRAFQG+G +F LPN + ++   Y+ G  ++N++ SL G  AP+G  +GA+
Sbjct: 120 SN-QIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAV 177

Query: 190 WGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFA-----MDWMGAII 244
           +  L++  +   WPW ++   +  F+  +     +P + P +          +D  G++ 
Sbjct: 178 FSSLLSEFA--WWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVT 235

Query: 245 GVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNG 304
           GVVGLILFNF WNQGPV GW   Y                  E +    PLLP     + 
Sbjct: 236 GVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAK-HPLLPVRKLSSD 294

Query: 305 QILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTI 364
            I  ++G +  GW SFGIW +Y +    NLR+  PL + A      I G  AA    F +
Sbjct: 295 TIF-VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLL 353

Query: 365 NRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSD 424
            R  P+ ++  + + FT+GS++++  P+ QTYW       I++ +GMD+SFPA++IILS 
Sbjct: 354 TRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILST 413

Query: 425 HLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472
            +P  +QG+A SLVNTIINYS S+ LG   T+E QI+   ++LL+GYR
Sbjct: 414 AMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYR 461

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  294 bits (753), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 163/444 (36%), Positives = 251/444 (56%), Gaps = 12/444 (2%)

Query: 35  QSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFH-SDVGTQTWLMASFPLVSGSF 93
           QS ++E  F+     A L+ QAG  Q ++ + +I  SF  S+ G  +W  A++ L  G+F
Sbjct: 34  QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTF 93

Query: 94  ILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPN 153
           ILI+GR+GD++G KK  + G+++  +W+LL GF+ Y++   FF  CRA QG+G +F+LPN
Sbjct: 94  ILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPN 152

Query: 154 IMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAA 213
            + ++G  Y  G  RK +V S+ G TAP G  +G+++  + +  +   WPW ++A   A 
Sbjct: 153 SIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFSQLA--WWPWAYWAMGTAC 209

Query: 214 FVNLIMAIYSVPENVPTNVHNFA-----MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPY 268
            V  +  I  +P+  P  +   A     +D  GA  G++GL L NF WNQGPV GW  PY
Sbjct: 210 LVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPY 269

Query: 269 XXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYY 328
                             E +    PLLP        +  +LG +  GW SFGIW FY++
Sbjct: 270 TYALLIVGFVFLLVFSLIESRARF-PLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFW 327

Query: 329 AFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLS 388
            F  + R+ SPL   A      I G  AA   G+ ++ V    ++  + + FT+G ++++
Sbjct: 328 QFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVA 387

Query: 389 VTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSL 448
             PI+QTYW       II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNT++NYS SL
Sbjct: 388 TAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISL 447

Query: 449 CLGMGTTVERQINKTGEELLRGYR 472
            LG   T+E ++N  G   L GYR
Sbjct: 448 ALGFAGTIETRVNNKGANRLEGYR 471

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  202 bits (514), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/447 (29%), Positives = 219/447 (48%), Gaps = 20/447 (4%)

Query: 23  ENSTPWQNEQYF--QSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFH----SDV 76
           E+  P   E+     S L E  F+     + +L  AG  Q +  M+VI E F     SD 
Sbjct: 59  EHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDS 118

Query: 77  GTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFF 136
           G   W    +    GSF+LI+G++GD+ G K   + GY ++ +W+LL GF+ Y  S  FF
Sbjct: 119 G---WCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFF 175

Query: 137 IVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIAT 196
             CRA QG+G +F   + + ++G  Y     RKN + S  G     G  +G ++  L   
Sbjct: 176 FFCRAAQGIGAAFTFTSALSILGKSYP-PCKRKNFIFSFFGACGSFGVVLGMVFSALFTQ 234

Query: 197 ESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHN---FAMDWMGAIIGVVGLILFN 253
            +   W W +++ A+A  V +I++I+ +P +V         F  D++GA + V GL+LF+
Sbjct: 235 LA--HWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFS 292

Query: 254 FVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLP-REVTKNGQILTILGI 312
             WNQ P  G+ + Y                  E K    PLLP   ++ N   L +L  
Sbjct: 293 VAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETKVD-DPLLPWTHISAN--TLKVLLA 349

Query: 313 LFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTIN-RVGPAV 371
           +F  + SF +W  Y + F L  +  + L A A      + G  AA      +N  V   +
Sbjct: 350 IFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQI 409

Query: 372 LLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQ 431
            +  S L F +  ++++     QTYW       I++SFG+D+SFP+++++LS+ +P +++
Sbjct: 410 RMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFK 469

Query: 432 GMAGSLVNTIINYSTSLCLGMGTTVER 458
           G+  SLV  ++NY+T+L      +V R
Sbjct: 470 GLGASLVGAVLNYATALGPPTAASVLR 496

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  163 bits (412), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 114/190 (60%), Gaps = 34/190 (17%)

Query: 48  MFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLK 107
           M + LLNQ G TQ L  +NV+S  F S    QT L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 108 KTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTL 167
            T++ GY  +I+W+ +CG   Y  S  FF++ RAFQGLG++F+LPN+MG V N+Y  G++
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 168 RKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPEN 227
           RKN+V                                  YAY +A  +N+ + ++++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 228 VPTNVHNFAM 237
           +PTNV   AM
Sbjct: 147 IPTNVRGQAM 156

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 425 HLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELL 468
           ++P   +G A      ++ YS  +CLG+  TVE +++K G + L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  171 bits (433), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 127/465 (27%), Positives = 230/465 (49%), Gaps = 21/465 (4%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           ++  EP  +S  K   S + +L  +    +E       KE   +        ++  G  Q
Sbjct: 15  LQPHEP--TSPVKVVPSHNEILSKT----DEHPLNMQFKEIIIVLLISSGQFISLLGAVQ 68

Query: 61  VLSTMNVISESF--HSDVGTQT-WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFM 117
            +  M  I+ +F    D   +  W  A++   + +F++I+G++GDI G K   I GY ++
Sbjct: 69  GIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYAWL 128

Query: 118 IIWTLLCGFADYTHSDT-FFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLI 176
            +W+LL GF+ Y  ++  FF  CR  QG+G +F+ P  + L+G  Y     RKN V S  
Sbjct: 129 TLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYP-PCKRKNYVFSFY 187

Query: 177 GITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVP-ENVPTNVHN- 234
           G   P G   G+++  L    ++  W W +++ A+   +  I++   +P +N P    + 
Sbjct: 188 GACGPFGIVAGSVFSALFTQLTT--WAWTYWSMAVTCLIITILSYIFIPKDNTPKRERSA 245

Query: 235 -FAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKFPIS 293
            ++ D++G   G+ G+ILF+ VWNQ P++ +  PY                  + +    
Sbjct: 246 FYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSRVK-D 304

Query: 294 PLLP-REVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIW 352
           PL+P + +  N  ++  L ++F G+  F IW FY + F L  +N S L A A      I 
Sbjct: 305 PLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGIS 362

Query: 353 GSIAAFIVGFTINRVGPAVLLFFSAL-GFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGM 411
           G  AA      +N+  P  L   +A+  F + ++++S   + +TYW       +I++ G+
Sbjct: 363 GIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGL 422

Query: 412 DLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTV 456
           D++FP+++++LS+ +  + QG+A +L  T +NY T+L  G+ T +
Sbjct: 423 DVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI 467

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  167 bits (422), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 120/426 (28%), Positives = 211/426 (49%), Gaps = 18/426 (4%)

Query: 35  QSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDV---GTQTWLMASFPLVSG 91
           ++ ++E F +   + + L+   G  Q +     + E +  +    G   W  AS+ L S 
Sbjct: 33  KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSA 92

Query: 92  SFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSD-TFFIVCRAFQGLGISFI 150
             +LI+G++GD+ G K+ ++ G+I++ IW+L+ GF+ Y   +  F+   RA QG+G  FI
Sbjct: 93  VMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFI 152

Query: 151 LPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYA 210
           +PN + ++G  Y    L+K I+ S+ G+   TG  +G  +  L A  +  +W W ++A A
Sbjct: 153 VPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT--KWAWNYWALA 210

Query: 211 LAAFVNLIMAIYSVPENVPTNVHNFA-----MDWMGAIIGVVGLILFNFVWNQGPVNGWA 265
               +  + AI  +P +   +  N        D++GAI GV GL+LF+  + Q    GW+
Sbjct: 211 CVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWS 270

Query: 266 KPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTF 325
            P+                  + +    PL+P +  +   ++ IL  ++ G+ SF IW  
Sbjct: 271 PPHTYITLIIGVILILIAMFVDWRVD-DPLVPLQHLR-ADVVVILICVYFGFLSFVIWAN 328

Query: 326 YYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFT---INRVGPAVLLFFSALGFTM 382
           +++ F   + N SPL   A      I GSI A I   T   +N   P +++         
Sbjct: 329 WFWQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVP 387

Query: 383 GSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTII 442
             LM +VTP + TYW       II  F +D++ P ++++ SD +  + QG+A SL+ T+I
Sbjct: 388 NILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVI 446

Query: 443 NYSTSL 448
           +Y+ S+
Sbjct: 447 SYAISI 452

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/474 (26%), Positives = 218/474 (45%), Gaps = 37/474 (7%)

Query: 11  SQKKTLSCDSL----LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMN 66
           SQ+    C +L     ++     N     S L+E  FI     +  ++ A  +Q +  M+
Sbjct: 38  SQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMD 97

Query: 67  VISESFH--SDVGTQT-WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLL 123
            I+  F   +D   +  W  A+F +  G+FI+ +G++ D+ G K   I GY +  +W+LL
Sbjct: 98  AITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLL 157

Query: 124 CGFADYTHS--DTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
            G + Y      TFF   R  QG+G + + P+ + L+G  Y   + +KNIV SL G   P
Sbjct: 158 VGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYP-PSCKKNIVFSLYGFCVP 216

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYAL-AAFVNLIMAIYSVPENVPTN--------- 231
            G  +G ++  +    +   W W +++ A+ +AF  LI   Y  P+ +  +         
Sbjct: 217 LGVVVGGVFSAIFTQLA--HWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAW 274

Query: 232 VHNFAMDWMGAIIGVVGLILFNFVWNQGPVNGW----AKPYXXXXXXXXXXXXXXXXXYE 287
            H    D++G  + V  L+LF   WNQ    G+     + Y                 + 
Sbjct: 275 FHLPKFDYLGTFLYVASLLLFAVCWNQA--TGFKFKSVQVYVTLIVSLVCFVAMVIVEFY 332

Query: 288 LKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHF 347
           +  PI P   R++  + Q +  L ++F  + SF IW FY + +   +RN + L   A   
Sbjct: 333 VDDPIIP--ARKI--HPQTIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFV 388

Query: 348 MFIIWGSIAAFIVGFTINRVGPA-VLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQII 406
              I G IAA      I+   P  + L   A  F +  ++       ++YW       II
Sbjct: 389 PLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIII 448

Query: 407 LSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQI 460
           +S G+D+SFP+++++LS+ +P + +G++ +LV T +NY T    G+G  + + I
Sbjct: 449 ISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGT----GIGPPIAQTI 498

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 112/484 (23%), Positives = 212/484 (43%), Gaps = 68/484 (14%)

Query: 35  QSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFH---SDVGTQTWLMASFPLVSG 91
            S+L +  FIF    +  +  A  +Q +  M+ +S  F    +      W+ ASF +  G
Sbjct: 66  NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCG 125

Query: 92  SFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFI-VCRAFQGLGISFI 150
           +FI+++G++ DI   +   I GY++  +WTL+ GFA Y   +  F+ +CR  QG+G + +
Sbjct: 126 AFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALL 185

Query: 151 LPNIMGLVGNIYKVGTL------------------------------------------- 167
            P+ + L+   Y V                                              
Sbjct: 186 FPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDI 245

Query: 168 ---RKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSV 224
               K+I  SL G  AP G  +G ++  +    ++  WPW +++ ++   +  I++ + V
Sbjct: 246 ICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLAT--WPWNYWSMSIVTTLLSILSYFYV 303

Query: 225 PENVPT-----------NVHNFAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXX 273
              +P            N  NF  D++G I+G+  LILF   W+Q  +  +   +     
Sbjct: 304 VVPIPVEKLDSNPNSLKNWKNF--DFLGVILGISALILFGVSWDQATMYKFKTIHVYLTL 361

Query: 274 XXXXXXXXXXXXYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLN 333
                       +E  F  +P++P      G I  +L ++F  + SF  W FY +     
Sbjct: 362 LFSLVSFIAMIIWEYYFN-NPIIPIRQIHPGTIKALL-VVFFSYISFTQWLFYTWKLFTE 419

Query: 334 LRNYSPLWAGATHFMFIIWGSIAA-FIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPI 392
           +++ SP+          + G I+A F +   + RV   + L   A  F +  ++L    +
Sbjct: 420 VKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLLTCKL 479

Query: 393 HQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGM 452
             +YW       I +S G+D+SFP+++++L++ +P + QG+  +LV +++NY T++   +
Sbjct: 480 DSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPI 539

Query: 453 GTTV 456
             T+
Sbjct: 540 AQTI 543

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 94/480 (19%), Positives = 183/480 (38%), Gaps = 53/480 (11%)

Query: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGT 78
           DS+  N   +QN   F  ++     + +C F +L+N    T VLS    I  ++  +  T
Sbjct: 10  DSIRSN---FQNIS-FHRYINLVLIMVSCAF-DLINV---TAVLSATRDIENTYQIEFTT 61

Query: 79  QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIV 138
            +W + ++ +    FI   GR+GDI G     +       I +L+C   +   +   F V
Sbjct: 62  ASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAV 118

Query: 139 CRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATES 198
            RA QG+  + I+P+   L+  +     ++    I   G +   G  +G + GG   T +
Sbjct: 119 FRALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFG--IGFIIGGAF-TLT 175

Query: 199 SRQWPWIFYAYALAAFVNLIMAIYSV---------PENVPTNVH---NFAMDWMGAIIGV 246
              +  IFY       V  I++ +S+          ++ P         ++D++G+ + +
Sbjct: 176 RIGYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFI 235

Query: 247 VGLILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKF---------------- 290
              IL      +G    W KP                  + + +                
Sbjct: 236 SSTILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVY 294

Query: 291 ----PISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATH 346
                I  L+P++V      + I   +F  +G      +    +   +   SPL A    
Sbjct: 295 NYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKL 354

Query: 347 FMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIH----QTYWRMNVG 402
              ++   I   ++    + + P   +        +GS++L    +H      YW++   
Sbjct: 355 LPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIIL--IQLHLITDNLYWKIFFC 412

Query: 403 MQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINK 462
            Q +++FG  + FP S  IL    P +Y+G+A  ++ T   +   +   + T++   IN+
Sbjct: 413 SQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 103/497 (20%), Positives = 196/497 (39%), Gaps = 64/497 (12%)

Query: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGT 78
            +L E     Q   Y Q ++        C F +LLN A    ++S ++ +++ ++    T
Sbjct: 11  KALQEIRNKCQKSPY-QLNVNVGLIFLGCTF-DLLNVA---SMISLIDDLAKKYNISYTT 65

Query: 79  QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIV 138
            +W + S+ +    FI   GR+GDI G             I +LLC       +   F V
Sbjct: 66  ASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNFPA---FAV 122

Query: 139 CRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATES 198
            RA QG+  + ++P    L+  +     ++K   I   G ++  G  +G + GG  A  +
Sbjct: 123 FRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFAA-T 179

Query: 199 SRQWPWIFY-AYALAAFVNLIMAIYSV--------PENVPTNVHNFAMDWMGAIIGVVGL 249
              +  IFY  +A+ + +++I   ++         P+ +       ++D++G++I V G 
Sbjct: 180 KIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGS 239

Query: 250 ILFNFVWNQGPVNGWAKP----------------------YXXXXXXXXXXXXXXXXXYE 287
           IL      +G    W +P                      Y                 +E
Sbjct: 240 ILIVVGLTEGG-ESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFE 298

Query: 288 LKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLN--LRNYSPLWAGAT 345
               +  L+P +V      + I  +L     +  +++  Y   Q +      SPL AG  
Sbjct: 299 ---KVQLLIPVDVLFMKNFIPI--VLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVK 353

Query: 346 HFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTM---GSLMLSVTPIH----QTYWR 398
               II   +   +  F   ++ P V +   ALGF++   GS++L    +H      +W+
Sbjct: 354 LVPLIICMVVGNALCAFESTKLKPRVGV---ALGFSLALAGSIIL--IQLHLIKDNVFWK 408

Query: 399 MNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVER 458
           +    Q ++ FG+ + +P +  I     P Q +G+A  +  T       +   +  +V  
Sbjct: 409 IFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLG 468

Query: 459 QIN--KTGEELLRGYRS 473
            IN  K  E+ ++ +R+
Sbjct: 469 DINEMKGKEDAIQNFRT 485

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 95/456 (20%), Positives = 175/456 (38%), Gaps = 55/456 (12%)

Query: 22  LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81
           LE       +  +Q ++        C F +LLN A    ++S ++ +++ +     T +W
Sbjct: 13  LEKIRNRCQKSTYQLNVNVALIFLGCTF-DLLNVA---SMISLIDDLAQKYDISYTTASW 68

Query: 82  LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRA 141
            + S+ +    FI   GR+GDI G          F  I +LLC       +   F V RA
Sbjct: 69  SLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPA---FAVFRA 125

Query: 142 FQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQ 201
            QG+  + ++P    L+  +     ++K   I   G ++  G  +G + GG  A  +   
Sbjct: 126 IQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIG--LGLIIGGAFAA-TKIG 182

Query: 202 WPWIFYAYALAAFVNLIMAIY---------SVPENVPTNVHNFAMDWMGAIIGVVGLILF 252
           +  IFY      F+  I+A +           P          ++D++G++I V G IL 
Sbjct: 183 YKGIFYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILI 242

Query: 253 NFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELKF-------------------PIS 293
                +G    W +P                  +   +                    + 
Sbjct: 243 VVGLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEKVQ 301

Query: 294 PLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNL--RNYSPLWAGATHFMFII 351
            L+P +V      + I  +L     +  +++  Y   Q +      SPL+AG      II
Sbjct: 302 LLIPVDVLFMKNFIPI--VLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLII 359

Query: 352 WGSIAAFIVGFTINRVGPAVLLFFSALGFTM---GSLMLSVTPIH----QTYWRMNVGMQ 404
              I   +  F   ++ P V +    LGF++   GS++L  T +H      +W++    Q
Sbjct: 360 CMVIGNGLCAFESTKLKPKVGV---VLGFSLALAGSIIL--TQLHLIKEDMFWKIFFSSQ 414

Query: 405 IILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNT 440
            ++ FG+ + +P +  I     P + +G+A  +  T
Sbjct: 415 ALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQT 450

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 106/231 (45%), Gaps = 15/231 (6%)

Query: 11  SQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISE 70
           S   T+  +  LE ++         S+ +++  +F  +     +  G       +  + +
Sbjct: 71  SSLDTVPDEEKLEQTSESTAPYTLLSYKQKWGMVFLLVMCGFWSSLGSPIYYPALRQLEK 130

Query: 71  SFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYT 130
            F+ D       +  + L  G    +SG + D++G +  ++GG +  ++ ++  G A   
Sbjct: 131 EFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI--GLA--- 185

Query: 131 HSDTFFIVC--RAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGA 188
            + ++ ++C  R  Q +GIS  +    G+VG+ + +   R   V +  G+    G C G+
Sbjct: 186 CAPSYGVICFLRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGLVL-LGQCFGS 243

Query: 189 LWGGLIATESSRQWPW--IFYAYALAAFVNLIMAIYSVPENVPTNVHNFAM 237
           L G ++    + +W W  IF+  A+ + V LI+A +++PE   T V N ++
Sbjct: 244 LIGAVL----TARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 97/476 (20%), Positives = 190/476 (39%), Gaps = 46/476 (9%)

Query: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGT 78
           ++L E     Q  +Y Q ++        C F +LLN A    ++S ++ ++++++    T
Sbjct: 11  NALEEIRNKCQKSRY-QLNVNVGLIFLGCTF-DLLNVA---SMISLIDDLAKTYNISYTT 65

Query: 79  QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIV 138
            +W + S+ +    FI   GR+GDI G             + +LLC       +   F V
Sbjct: 66  ASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMPNFPA---FAV 122

Query: 139 CRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATES 198
            RA QG+  + ++P    L+  +     ++K   I   G ++  G  +G + GG  AT +
Sbjct: 123 FRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFAT-T 179

Query: 199 SRQWPWIFY-AYALAAFVNLIMAIYSV--------PENVPTNVHNFAMDWMGAIIGVVGL 249
              +  IFY  +A+   +++I   ++         P+    +    ++D++G++I V G 
Sbjct: 180 KIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGS 239

Query: 250 ILFNFVWNQGPVNGWAKPYXXXXXXXXXXXXXXXXXYELK-------FPISPLLPREVTK 302
           IL      +G    W +P                  +          F    +   +  +
Sbjct: 240 ILIVVGLTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFE 298

Query: 303 NGQILTILGILFL----------GWGSFGIWTFYYYAFQLNL---RNYSPLWAGATHFMF 349
             Q+L  + +LF+             +  +++  Y   Q +    RN SPL AG      
Sbjct: 299 KVQLLIPIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAERN-SPLLAGVKLVPL 357

Query: 350 IIWGSIAAFIVGFTINRVGPAV---LLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQII 406
           II   I   +  F   ++ P V   + FF AL  ++  + L +      +W++    Q +
Sbjct: 358 IICMVIGNALCAFESTKLRPRVGVAIGFFLALAGSIILIQLHLVK-EDLFWKIFFSAQAL 416

Query: 407 LSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINK 462
           + FG+ + +P +  I     P + +G+A  +  T       +   +  +V   IN+
Sbjct: 417 VGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINE 472

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 112/253 (44%), Gaps = 27/253 (10%)

Query: 29  QNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPL 88
           QN +Y Q  +      F C F +LLN AG   V+S +  + E++       +W + S+ +
Sbjct: 20  QNSRY-QLGINITLIFFGCTF-DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAI 74

Query: 89  VSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFA-DYTHSDTFFIVCRAFQGLGI 147
               FI   GR+GDI G             +++LLC    D+      F V RA QG+  
Sbjct: 75  TFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT----FAVFRALQGISA 130

Query: 148 SFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
           + I+P    L+  + +   ++K   I   G ++  G  +G + GG  A  +   +  IFY
Sbjct: 131 AGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIG--IGLIVGGAFAL-TKVGYAGIFY 187

Query: 208 -AYALAAFVNLIMAIYSVP-----------ENVPTNVHNFA-MDWMGAIIGVVGLILFNF 254
            ++A    V++  + Y+             E++P +    A +D++G++I V G +L   
Sbjct: 188 LSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHDHPKVASLDFVGSLIFVSGSVLIVA 247

Query: 255 VWNQGPVNGWAKP 267
              +G    W +P
Sbjct: 248 GLTEGG-ESWRRP 259

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 109/259 (42%), Gaps = 26/259 (10%)

Query: 23  ENSTPWQNEQYF-QSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81
           E S  +     F Q  LK   FI   + A  L+ A    ++  +  I   F+       W
Sbjct: 4   EKSVTFPKGSLFHQDTLKHLKFI-CILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGW 62

Query: 82  LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRA 141
            + S+ +    FI   GR+GDI G    M    +   I++LLC       + T F   RA
Sbjct: 63  ALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAVVPNFIAFTVF---RA 119

Query: 142 FQGLGISFILPNIMGLVGNIYKVGTLRK--NIVISLIGITAPTGACMGALWGGLIATESS 199
           FQG+  + I+P    LV  +++   L++  +I+ S+I   A  G  +G  +G     E++
Sbjct: 120 FQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFG-----ETA 174

Query: 200 RQWPWIFY---AYALAAFVNLIMAIYSVPENVPTNVHN--------FAMDWMGAIIGVVG 248
             +   FY   A +LA    +I  +   PE +  N H+        + +D +G ++ + G
Sbjct: 175 LGYKSFFYFLFAASLAT-AAVICVLIGYPE-LLLNRHSYKEKFQRVYKLDVIGCLLFISG 232

Query: 249 LILFNFVWNQGPVNGWAKP 267
            IL      QG    W  P
Sbjct: 233 SILLVVGLTQGG-ESWNDP 250

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 65/147 (44%), Gaps = 18/147 (12%)

Query: 66  NVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCG 125
           + I + F+ D     WLMA + L +  F+L+ GRI  + GLK +++   +     +L+ G
Sbjct: 32  DTIGQEFN-DYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAG 90

Query: 126 FADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGT-----LRKNIVISLIGITA 180
            A+   S    I  R   G G S       G+   +Y VGT       +  VI+++GI  
Sbjct: 91  AAN---SMGMLIGARVISGFGGS-------GIESLVYGVGTSIVEEKHRARVITVLGIAY 140

Query: 181 PTGACMGALWGGLIATESSRQWPWIFY 207
                 G   GG +A   S  W W FY
Sbjct: 141 MLAEGAGPFVGGGLAEHVS--WRWCFY 165

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 86/217 (39%), Gaps = 17/217 (7%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLEN---STPWQNEQYFQSHLKEYF----FIFTCMFANLL 53
           +E    I S    +    D+ + N     P  N +Y ++ + E       ++TC F+  L
Sbjct: 27  IEPSMEIASHGINEESGTDAEVSNHVEKKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLAL 86

Query: 54  NQAGQTQVLSTMNVISESFHSDVGTQT---WLMASFPLVSGSFILISGRIGDIYGLKKTM 110
                   +  ++ I E      G  +   W+ A + L +    L+ GRI  I G K  M
Sbjct: 87  AIFLAALDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCM 146

Query: 111 IGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKN 170
           +   I   I +L+ G A+   S    I  R   G+G S I      +  N+  V   R+ 
Sbjct: 147 LAAIIIFEIGSLISGVAN---SMNMLIGGRVIAGVGGSGIQSLAFVIGSNL--VDERRRG 201

Query: 171 IVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
           ++I+ +       + +G   GG   T ++  W W FY
Sbjct: 202 LIIACMSSAFAVASVIGPFLGGAFTTHAT--WRWCFY 236

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 8/124 (6%)

Query: 29  QNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPL 88
           QN +Y Q  +        C F +LLN AG   V+S +  + E++  +  T +W + S+ +
Sbjct: 24  QNSKY-QLIINMALIFLGCTF-DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAI 78

Query: 89  VSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGIS 148
                I   GR+GDI G          F  ++ LLC       +   F V RA QG+  +
Sbjct: 79  TFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA---FAVLRALQGIAAA 135

Query: 149 FILP 152
            ++P
Sbjct: 136 GLVP 139

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 96/463 (20%), Positives = 181/463 (39%), Gaps = 60/463 (12%)

Query: 25  STPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMA 84
           S+P   ++     L  Y  IF       L  A  T V + M  I+  F+ ++   +W+  
Sbjct: 70  SSPVPPDKLLVITLSMYLGIF-------LAAADGTLVSTIMAHIASEFN-ELPRISWIAT 121

Query: 85  SFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQG 144
           ++ L S +F  + G++ DI+G K  ++   I  ++  L+CG               +F G
Sbjct: 122 AYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP------------SFWG 169

Query: 145 LGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGAC-----MGALWGGLIA---T 196
           L  +  +  I G  G +  + ++  + ++ L       G C     +G   GG++    +
Sbjct: 170 LVGARFISGIGG--GGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFS 227

Query: 197 ESSRQWPWIFY-AYALAAFVNLIMAIY------SVPENVPTNVHN--FAMDWMGAIIGVV 247
           +    W   F     L+A  +L++A++      S   N P ++ N   ++DW+GA   VV
Sbjct: 228 DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVV 287

Query: 248 GLILFNFVWNQGPVN-GWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQI 306
            L LF    + G     +                      EL     P+LP    +N   
Sbjct: 288 FLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRN--- 344

Query: 307 LTILGILFLGW-GSFGIWTFYYY--AFQLNLRNYSPLWAGAT---HFMFIIWGSIAAFIV 360
            ++LG  F  W     + T  YY   +   + N +P   G     +F     GS+ A   
Sbjct: 345 RSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGA--- 401

Query: 361 GFTINRVGPAVLLFFSALGFT----MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFP 416
           G+ + R G     ++  +GF     +G L +++       WR  + + +I  FG  +   
Sbjct: 402 GYYMKRTGK---YYWLTVGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLIT 457

Query: 417 ASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQ 459
            + + +   +P  +     S+     +  ++L + +G  + RQ
Sbjct: 458 VALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQ 500

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 11/144 (7%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           + G + DIYG +  ++ G +  I+ ++    A   +S    I  R  Q  GIS I+    
Sbjct: 157 VCGGLADIYGRRPVILFGMLVYIVASIALACA---NSYGVIIFLRCLQSCGISPIIAISS 213

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPW--IFYAYALAA 213
           G VG+ + +   R   V ++ G+       +G  +G LI    +  W W  IF+  A+ A
Sbjct: 214 GCVGD-FTMKAERGTFVGAVSGLVL-----LGQAFGSLIGAALAAAWDWRAIFWFLAIGA 267

Query: 214 FVNLIMAIYSVPENVPTNVHNFAM 237
              L + I  +PE   T V N ++
Sbjct: 268 GCCLFVGILVLPETKRTIVGNMSI 291

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 92/212 (43%), Gaps = 14/212 (6%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLN---QAG 57
           +E++   + SS ++  S  S++E     Q ++  +      F ++ C+ + +L+    A 
Sbjct: 11  VEDEAAYLQSSDEQGSSSHSVIEKPQQQQPQEQLEQTRPTGFTLYACVISLILSIFLAAL 70

Query: 58  QTQVLSTM--NVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYI 115
              ++ST+  NV  E    D     W+ A + L S    LI GRI  + G K +M+   I
Sbjct: 71  DIMIVSTIIENVARE--FGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAII 128

Query: 116 FMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISL 175
              + +L+   A+   S    I  R   GLG S I      ++  +  V   ++ ++I+ 
Sbjct: 129 IFEVGSLVAALAN---SMDMLIGGRVIAGLGGSGIQTLCFVIISTL--VEESKRGLLIAC 183

Query: 176 IGITAPTGACMGALWGGLIATESSRQWPWIFY 207
           +G      + +G   GG   T  +  W W F+
Sbjct: 184 MGSAFGIASVVGPFLGGAFTTHVT--WRWCFW 213

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 11/135 (8%)

Query: 112 GGYIFMIIWTLLCGF-------ADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKV 164
           GG  F+ I++L+          A   H    +I+ R FQ +G S ++P  +G V ++   
Sbjct: 174 GGRKFLYIFSLMIALIANVLLAAVPKHLAALYIL-RVFQAIGTSAVIPLGVGTVSDLISP 232

Query: 165 GTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSV 224
               K +   ++G     G  +G ++GGLI   +  QW W+F   ++   V LI+ +  +
Sbjct: 233 MNRAKGVSYFMLGPN--MGPILGPIFGGLILM-NGNQWRWLFGFTSITTGVGLILIVTFL 289

Query: 225 PENVPTNVHNFAMDW 239
           PE +   V N    W
Sbjct: 290 PETLRCIVGNGDPRW 304

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 75/166 (45%), Gaps = 19/166 (11%)

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           V++  + I   FH D G   WL+  + L +  F+L+ GR+ +I G K+ ++   I   I 
Sbjct: 28  VVTLYDTIGIKFH-DFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIG 86

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGT--LRKN---IVISL 175
           +L+   ++   S    I  R   G G S       G+    + VGT  +R+N   I+I+ 
Sbjct: 87  SLISALSN---SMATLISGRVVAGFGGS-------GIESLAFVVGTSIVRENHRGIMITA 136

Query: 176 IGITAPTGACMGALWGGLIATESSRQWPWIFYA-YALAAFVNLIMA 220
           + I+      +G   GG  A      W W FY    + AF  +I+A
Sbjct: 137 LAISYVIAEGVGPFIGG--AFNEHLSWRWCFYINLPIGAFAFIILA 180

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 86/202 (42%), Gaps = 7/202 (3%)

Query: 36  SHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFIL 95
           ++ +++F +F        +  G       +  + + F+ D       +  + L  G    
Sbjct: 85  TYRQKWFMVFLMTITGFWSSLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPA 144

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           ISG + D+YG +  ++GG +  ++ ++  G A    S    +  R  Q +GIS  +    
Sbjct: 145 ISGGLADVYGRRPVILGGMLIFVVASI--GIAK-APSYGVIVFLRCIQSIGISPTIAISS 201

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFV 215
           G+V + + V   R   V +  G+    G  +G L G +I   ++  W  +F+   +    
Sbjct: 202 GVVSD-FTVKRERGTFVGATSGLVL-IGQGIGPLLGAVIT--AALHWRAVFWFLTIGCGS 257

Query: 216 NLIMAIYSVPENVPTNVHNFAM 237
            +I+  + +PE   T V N ++
Sbjct: 258 CMIIGFFLLPETKRTIVGNLSI 279

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 90/222 (40%), Gaps = 21/222 (9%)

Query: 42  FFIFTCMFANL-LNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRI 100
             I T +F N+ L+    T   S   +I   F  DV   +W+  ++ +   SF  + G  
Sbjct: 46  LLIETALFTNVFLSGLDSTITASIYQLIGNEFE-DVKVSSWITTAYLVTCTSFQPLYGSF 104

Query: 101 GDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGN 160
            D  G ++ +        +  L CG     +S    I+ RA  G+G   +    +  + N
Sbjct: 105 SDTLGRRRCLFFANTIFALGCLGCGLTSTIYS---LIIMRAVTGIGGGGL--ITLSTIVN 159

Query: 161 IYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMA 220
              +   ++ +  S   I   TGA +GA  GG IA  SS  W W F      +    +MA
Sbjct: 160 SDIIPAKKRGMYQSFQNILVGTGAVVGASCGGEIA--SSMGWRWCFLLQVPISIGGAVMA 217

Query: 221 IYSVPEN-----------VPTNVHNF-AMDWMGAIIGVVGLI 250
              V +            +P+NV     +D++GA + + GL+
Sbjct: 218 YLFVQDQDVVDKNPRSGALPSNVSKIKKIDFLGAFLLISGLV 259

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           T V + MN ++E F S+   + W+  SF L + +F  + G++ D+ G K  ++  Y F++
Sbjct: 53  TIVANIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLV 111

Query: 119 IWTLLCGFADYTHSDTFFIVCRA 141
           I  LL   A    + T F V RA
Sbjct: 112 IGCLLTCLA---RNVTEFAVARA 131

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 68/149 (45%), Gaps = 12/149 (8%)

Query: 61  VLSTMNVISESF--HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           V++ +N I++ F  +S +G   WL+  + L +  F L+ GR   I+G K T++   I   
Sbjct: 40  VVTILNTIADKFNAYSKIG---WLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFE 96

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGI 178
           I +L+   ++   S    I  R   G G S I   +  +  ++    T  +  +++L+ +
Sbjct: 97  IGSLVIAVSN---SMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSL 151

Query: 179 TAPTGACMGALWGGLIATESSRQWPWIFY 207
           +    + +G   GG  A      W W FY
Sbjct: 152 SYAVASALGPYIGG--ALTEYVTWRWCFY 178

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 99/238 (41%), Gaps = 15/238 (6%)

Query: 8   VSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTC--MFANLLNQAGQTQVLST- 64
           +S ++ + LSC S LE+           + +    F +    M   +L   G    L + 
Sbjct: 50  LSHTRTRELSCSSDLESQQSHDINSENSNKVPHSLFTYNQKWMMVGVLTMCGFWSSLGSP 109

Query: 65  -----MNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMII 119
                +  + + F  D       +  + +  G      G + D++G +  ++ G   M+I
Sbjct: 110 IYYPALKQLEKQFDVDENMVNVTVVVYLIFQGLSPTFCGGLADLFGRRPVILTG---MLI 166

Query: 120 WTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGIT 179
           +T+       ++S    +  R  Q  GIS  +    G VG+ + V + R   V ++ G+ 
Sbjct: 167 YTVASIGLACSNSYGVIVFLRCLQSAGISPTISISSGAVGD-FTVKSERGTFVGAVSGLV 225

Query: 180 APTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAM 237
              G   G+L G  +A  +S  W  IF+   +   V++++A + +PE   T V N ++
Sbjct: 226 L-LGQAFGSLIGAALA--ASFNWRAIFWFLTIGCGVSMMVAFFVLPETKRTIVGNLSI 280

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           T V +T+N I+  F       TW+  ++ L + +   + G+I DI G +K ++ G +   
Sbjct: 78  TIVSTTVNDIASQFQ-QASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFA 136

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLG 146
           +  LLC FA+         + RA  G+G
Sbjct: 137 LGVLLCNFANTIPQ---LAIARAICGIG 161

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 64  TMNVISESFHSDVGTQ--TWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
           T+NV   S   DV T+  TW +    ++     ++ G IGD YG K + I    FM++  
Sbjct: 95  TLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVLE 154

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPN 153
           ++ GF    H+  +F++ RAF G+ +  I  N
Sbjct: 155 IITGFIK--HNFKYFLIARAFFGVVLGGIFGN 184

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 8/128 (6%)

Query: 100 IGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVG 159
           I ++YG + T I      IIW  L     ++H+    +  R   G   S  L    G + 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQCL---TTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 160 NIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIM 219
           +I+   T+   I +SL  ++   G  +G +  G +  E+ R   W+F    +A+ V L++
Sbjct: 191 DIFDKATI--TIPMSLYTLSCFYGPVLGPIVSGALYRENYR---WVFATLLIASGVCLVL 245

Query: 220 AIYSVPEN 227
            I+++PE 
Sbjct: 246 IIFTIPET 253

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 90/226 (39%), Gaps = 35/226 (15%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQS-------HLKEYFFIFTCMFA--- 50
           + +KE      QK+  + D    +++   +E             L +   ++  + A   
Sbjct: 10  LHSKEAKQQHEQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVELSKGSILYVSLVAVAL 69

Query: 51  NLLNQAGQTQVLSTMNVISESFHSDVGTQT---WLMASFPLVSGSFILISGRIGDIYGLK 107
           +L   A    ++ST   I E     +G+ +   WL   + L +   +LI GRI    G K
Sbjct: 70  SLFLAALDVMIVST---IIEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIGFK 126

Query: 108 KTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLG------ISFILPNIMGLVGNI 161
            TM+   +   I +L+   A    S    I  R   G+G      +SF++ + +      
Sbjct: 127 ATMLFAIVIFEIGSLISALAS---SMNMLIGGRVIAGIGGCGIQSLSFVIGSTL------ 177

Query: 162 YKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
             V   ++ ++I+++  +    + +G   GG+    SS  W W FY
Sbjct: 178 --VEESKRGMLIAILSSSFAIASVVGPFLGGVFT--SSVTWRWCFY 219

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 22/141 (15%)

Query: 73  HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHS 132
           +S++G   WL   + L +    LI GRI    G K+TM+   +   I +L+   A+   S
Sbjct: 101 YSEIG---WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALAN---S 154

Query: 133 DTFFIVCRAFQGLG------ISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACM 186
            +  I  R   G+G      +SF++ + +        V   ++ I+I+++  +    + +
Sbjct: 155 MSMLIGGRVIAGVGGCGIQSLSFVIGSTL--------VEESQRGILIAVLSCSFAIASVV 206

Query: 187 GALWGGLIATESSRQWPWIFY 207
           G   GG+    SS  W W FY
Sbjct: 207 GPFLGGVFT--SSVTWRWCFY 225

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 11/177 (6%)

Query: 64  TMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLL 123
            +  + + FH +       +  + L  G     SG + D YG +  ++GG +  ++ ++ 
Sbjct: 136 ALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASI- 194

Query: 124 CGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTG 183
            G A    S    +  R  Q +GIS  +    G+V + Y +   R   V +  G     G
Sbjct: 195 -GLAR-APSYGVIVFLRIVQSIGISPTIAISSGVVSD-YTLKRERGTFVGATSGFVL-IG 250

Query: 184 ACMGALWGGLIATESSRQWPW--IFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMD 238
             +G L G +IA     +W W  IF+   +    ++++A + +PE   T V N +++
Sbjct: 251 QGIGPLLGAVIAA----RWDWRAIFWFLVIGCGTSMLIAFFLLPETKRTIVGNLSIE 303

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 88/214 (41%), Gaps = 12/214 (5%)

Query: 24  NSTPWQNEQYFQ-SHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWL 82
           N + ++ E Y + SH ++   +  C F    +    +     + VI + F+         
Sbjct: 47  NESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIYYPVLTVIEKKFNITEELANVT 106

Query: 83  MASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAF 142
           +  + +  G    I G + D +G +  ++     ++ +   C     +H+    +  R  
Sbjct: 107 IVVYFVFQGLAPSIMGGLADTFGRRPVVLWA---VLTYCCACIGLASSHNYAQILALRCL 163

Query: 143 QGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQW 202
           Q  GIS ++    G++G++     + +   + L+      G   GAL G  +    S +W
Sbjct: 164 QAAGISPVIAINSGIMGDV--TTKVERGGYVGLVSGFQVVGTAFGALIGAGL----SSRW 217

Query: 203 PW--IFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
            W  IF+  A+ + + L+++   +PE   T V N
Sbjct: 218 GWRAIFWFLAIGSGICLVVSALLLPETKRTLVGN 251

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 335 RNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGP---AVLLFFSALGFTMGSLMLSVTP 391
            N SPL AG      II   I  F+ G    R+ P     L FF AL    GS++L+   
Sbjct: 337 ENDSPLMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVTLGFFLALS---GSIILTQLR 393

Query: 392 I--HQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNT 440
              +  +W++    ++++ FG+ + +P +  +     P + +G+A  +  T
Sbjct: 394 AVKYDVFWKIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQT 444

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 3/88 (3%)

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           + ++S ++ +S  +     T +W + S+ +    FI   GR+GDI G  +          
Sbjct: 46  SSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFA 105

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLG 146
           I +LLCG      +   F V RA QG+ 
Sbjct: 106 ILSLLCGLMPNFEA---FAVMRALQGIA 130

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           T + +TMN I+  F  +    TW+  ++ L + +   + G+  D+ G KK ++   +  I
Sbjct: 66  TIISTTMNEIASIFQ-EASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFI 124

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLG 146
           +  ++CG A         IV RA  G+G
Sbjct: 125 VGLVMCGAARTIEE---LIVARAICGVG 149

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 93/233 (39%), Gaps = 18/233 (7%)

Query: 4   KEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLS 63
           KEPI  +   +T   +  + N+ P+     F +  K    +  C +  L +         
Sbjct: 51  KEPIYRTRSNQT---EPDIANAPPYSR---FDAKYK-MALVLQCAYTGLFSTMAGAIYYP 103

Query: 64  TMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLL 123
            ++VI + FH         +  + +  G    + G + D  G +  ++  +   + +   
Sbjct: 104 VLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPVVL--FAVTVYFGAC 161

Query: 124 CGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTG 183
            G A    +    +V R  Q  GIS ++    G++G++      R   V  + G      
Sbjct: 162 IGLA-CAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAE-RGGYVGYISGFQV--- 216

Query: 184 ACMGALWGGLIATESSRQWPW--IFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
             +G+ +G LI    S +W W  IF+  A+ + V L+ +I  +PE   T V N
Sbjct: 217 --LGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPETKRTIVGN 267

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 7/142 (4%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           ISG + D++G +  ++ G +  ++ ++  G A    S    +  R  Q +GIS  +    
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASI--GLA-CAPSYGVIVFLRIIQSIGISPTIAISS 201

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFV 215
           G+VG+ + +   R   V +  G+    G C G+L G ++A  ++  W  IF+   +    
Sbjct: 202 GVVGD-FTLKHERGTFVGATSGLVL-LGQCFGSLIGAVLA--AAWNWRAIFWFLTIGCGT 257

Query: 216 NLIMAIYSVPENVPTNVHNFAM 237
           + I+A   +PE   T V N ++
Sbjct: 258 SFIIAFLLLPETKRTLVGNLSI 279

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 98/241 (40%), Gaps = 15/241 (6%)

Query: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60
           +  +E   SSS  +     S + +  P        SH +++F +     A   +  G   
Sbjct: 46  VTTREMRESSSDSRDRVESSGVNSKLPQGAPFTLLSHGQKWFMVALLTSAGFWSSLGSPI 105

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
               +  + + F+         +  + +  G    ISG + D+YG +  ++ G   M+I+
Sbjct: 106 YYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMG---MLIY 162

Query: 121 TLLCGFADYTHSDTFFIVC--RAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGI 178
             +C       S ++ ++   R  Q  GIS I+    G+VG+ + +   R   V ++ G 
Sbjct: 163 --VCASIGLACSQSYGVIVFLRCLQSAGISPIIAINSGVVGD-FTLKHERGTFVGAVSGF 219

Query: 179 TAPTGACMGALWGGLI--ATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFA 236
           T      MG  +G LI  A  ++  W  IF+   +     +I+    +PE   T V N +
Sbjct: 220 T-----LMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMIINFLILPETKRTLVGNLS 274

Query: 237 M 237
           +
Sbjct: 275 I 275

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 90/245 (36%), Gaps = 57/245 (23%)

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           V++    I E F  D     WL+  + L +  F L+ GR+  I GLK ++    +   I 
Sbjct: 27  VITLYETIGEKFK-DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIG 85

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGT-----LRKNIVISL 175
           +L+   ++   S    I  R   G G S       G+   ++ VGT       + +VI++
Sbjct: 86  SLIVAVSN---SMGMIIGGRVVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITV 135

Query: 176 IGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIY-------SVPENV 228
           +G+       +G + GG  A   +  W W FY       V L M  +       SV E +
Sbjct: 136 LGLAFAVAFAVGPVIGG--AFTENVSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETL 193

Query: 229 PTNVHN-----------------------FAMDWMGAIIGVVGLILF---------NFVW 256
             N                          F +D++G  +   G +LF          + W
Sbjct: 194 TYNCRQLQTYRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAW 253

Query: 257 NQGPV 261
           N G +
Sbjct: 254 NSGTI 258

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 7/142 (4%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           +SG + DIYG +  ++ G +  ++ ++  G A   +S    I  R  Q  GIS ++    
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASI--GIA-ACNSYGVIIFLRCLQSTGISPLIAISS 209

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFV 215
           G VG+ + V   R   V ++ G+    G   G+L G  +A  ++  W  IF+  A+    
Sbjct: 210 GAVGD-FTVKAERGTFVGAVSGLVL-MGQAFGSLIGAALA--AAYNWRAIFWFLAIGCGA 265

Query: 216 NLIMAIYSVPENVPTNVHNFAM 237
            + +A   +PE   T V N ++
Sbjct: 266 CMAIAGIVLPETKRTLVGNLSV 287

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           T + +TMN ++  F  +    TW+  ++ L + S   + G+  D+ G KK ++   +  I
Sbjct: 69  TIISTTMNEVASIFQ-EASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFI 127

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLG 146
           I  +LCG A          + RA  G+G
Sbjct: 128 IGLVLCGMARTVKE---LAIARAICGIG 152

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 36  SHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFIL 95
           S  + +  I +    + L     T V + ++ I+  F+ ++   +W+  ++ L S +F  
Sbjct: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFAD 128
           + G+I DI+G +  +I   +F I+  L+CG + 
Sbjct: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 91/428 (21%), Positives = 167/428 (39%), Gaps = 53/428 (12%)

Query: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           T V + ++ I+  F+ ++   +W+  ++ L S +F  + G++ DI+G +  ++   +   
Sbjct: 158 TIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFC 216

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLG-------ISFILPNIMGLVGNIYKVGTLRKNI 171
           +  L+CG +    +    ++ R   G+G        S    +I+ L     +   L + I
Sbjct: 217 LGALICGMSK---NLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPL-----RSRALYQGI 268

Query: 172 VISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVN--LIMAIYSVPENVP 229
                G+    G   G L GGL A + +  W   F        ++   I    ++P+  P
Sbjct: 269 CNVFFGL----GTACGGLVGGLFA-DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK--P 321

Query: 230 TNVHNFA-------------MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYXXXXXXXX 276
            + H  A             +DW G +  VV L  F  V +   + G   P+        
Sbjct: 322 VDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVI 378

Query: 277 XXXXXXXXXYELKFPISPLLPREVTKNGQILTILG---ILFLGWGSFGIWTFYYYAFQLN 333
                    +EL     P+LP    +N  +L          +G  + G +   YYA  LN
Sbjct: 379 LLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLN 438

Query: 334 LRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPA--VLLFFSALGFTMGSLMLS-VT 390
           +            F    +GS+ A   G+ + R G     LL F  +G  +G + +S VT
Sbjct: 439 MGPTDIGKRIVPSFFSTAFGSLGA---GYYMKRTGKYYWFLLAFCLVG-VLGQVQISYVT 494

Query: 391 PIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCL 450
           P   T WR    + +I  FG  +    + + L   +P ++Q    S+     +  ++L +
Sbjct: 495 PSIST-WRQYC-LYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGV 552

Query: 451 GMGTTVER 458
            +G  + R
Sbjct: 553 SIGGAIFR 560

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 63/147 (42%), Gaps = 12/147 (8%)

Query: 63  STMNVISESF--HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           + ++V++E F  +S  G   WL+  + L +    LI GR   I G + ++I   +     
Sbjct: 59  TIIDVVAEQFGNYSKTG---WLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAG 115

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +L+   A    S    I  R   G+G S +    +  V     VG   + +VIS++    
Sbjct: 116 SLIAALAS---SMNMLIFGRVVAGVGGSGL--QTLCFVIGCTMVGERSRPLVISILSCAF 170

Query: 181 PTGACMGALWGGLIATESSRQWPWIFY 207
              A +G + GG   T  +  W W FY
Sbjct: 171 AVAAIVGPIIGGAFTTHVT--WRWCFY 195

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 12/147 (8%)

Query: 63  STMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTL 122
           +++ VI+E F  D     W+++ + L      L+ GR   I G K +++   +     +L
Sbjct: 140 ASIEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSL 198

Query: 123 LCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKN--IVISLIGITA 180
           +   ++   S    I  R   G+G S     I  L   I    T  ++  I+IS++  + 
Sbjct: 199 ISAISN---SMNMLIGGRVVAGIGGS----GIQSLCFVIASTLTPDRSRVIIISVLSCSY 251

Query: 181 PTGACMGALWGGLIATESSRQWPWIFY 207
              A +G   GG + T  +  W W FY
Sbjct: 252 AVAAVVGPFLGGALTTHVT--WRWCFY 276

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 117/301 (38%), Gaps = 23/301 (7%)

Query: 81  WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCR 140
           W+  ++ + S SF  + G   D  G +  +        I  L CGF+   +  +F    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFM---R 62

Query: 141 AFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSR 200
           A  G+G   ++   +  + N   + T ++ I  +   +    GA  GA +GG IA  S+ 
Sbjct: 63  ALTGIGGGGLI--TLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIA--STI 118

Query: 201 QWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHN-----------FAMDWMGAIIGVVGL 249
            W W F      + ++ I+  Y VP     N  N             +D MG+I+ + GL
Sbjct: 119 GWRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGL 178

Query: 250 ILFNFVWNQGPVN---GWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQI 306
            L     + G       W  P                  +E K     ++P E+  +   
Sbjct: 179 TLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYS 238

Query: 307 LTILGI-LFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTIN 365
             +L I + +G+ S+         FQ+ L + S   AG    +  ++  + + I GF+++
Sbjct: 239 FVVLSISILVGFASYAYLFTLPLFFQIVLGD-STAKAGLRLTIPSLFTPVGSLITGFSMS 297

Query: 366 R 366
           +
Sbjct: 298 K 298

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 84/202 (41%), Gaps = 19/202 (9%)

Query: 39  KEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFH---SDVGTQTWLMASFPLVSGSFIL 95
           ++ F +  C F  LL+    +     ++V+   FH     +     +   F  VS + + 
Sbjct: 98  EKAFLVVQCAFTGLLSSLAGSIYYPVLSVLEVKFHITEEQINISVVVYYVFQAVSPTLM- 156

Query: 96  ISGRIGDIYGLKKTMIGG-YIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNI 154
             G + D  G +  +I   +++      L    +Y+      I  R  Q  GIS ++   
Sbjct: 157 --GGLADSLGRRPVIITSVFLYFCACIGLACCNNYSQ----LIGLRCLQATGISPVIAVN 210

Query: 155 MGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPW--IFYAYALA 212
            GL+G++       +   + L+  T   G   GAL G  + +    +W W  IF+   + 
Sbjct: 211 SGLMGDV--TTKAERGGYMGLVSGTQVLGTAFGALIGAALFS----RWGWRSIFWFLVIG 264

Query: 213 AFVNLIMAIYSVPENVPTNVHN 234
           + V L+++++ +PE   T V N
Sbjct: 265 SGVCLVLSLFILPETKRTVVGN 286

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 122/310 (39%), Gaps = 23/310 (7%)

Query: 81  WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCR 140
           W+  ++ + S SF  + G   D  G +  +        I  L CGF+   +  +F    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFM---R 62

Query: 141 AFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSR 200
           A  G+G   ++   +  + N   + + ++ I  +   +    GA  GA +GG IA  SS 
Sbjct: 63  ALTGIGGGGLI--TLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIA--SSI 118

Query: 201 QWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFA-----------MDWMGAIIGVVGL 249
            W W F      + ++ I+  Y VP     N  N +           +D MG+I+ + GL
Sbjct: 119 GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGL 178

Query: 250 ILFNFVWNQGPVN---GWAKPYXXXXXXXXXXXXXXXXXYELKFPISPLLPREVTKNGQI 306
            L     + G       W  P                  +E K     ++P E+  +   
Sbjct: 179 TLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYS 238

Query: 307 LTILGI-LFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTIN 365
           + +L I + +G+ S+         FQ+ L + S   AG    +  ++  + + I GF+++
Sbjct: 239 VVVLSISILVGFASYAYLFTLPLFFQIVLGD-STAKAGLRLTIPSLFTPVGSLITGFSMS 297

Query: 366 RVGPAVLLFF 375
           +     LL +
Sbjct: 298 KYNCLRLLLY 307

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 6/129 (4%)

Query: 34  FQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSF 93
           F  H K  F +  C  +   +   QT     +++I + F+  V      +  + L  G F
Sbjct: 78  FSKHDK-LFLVVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIF 136

Query: 94  ILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFAD-YTHSDTFFIVCRAFQGLGISFILP 152
            +I G + D  G +   +  +  M+ +    G A   T  +  F+ C   QG GIS I+ 
Sbjct: 137 PVIMGGLADRLGRRP--VAMFCIMVYFCACIGIACCRTFGEMIFLRC--LQGGGISPIIA 192

Query: 153 NIMGLVGNI 161
              GL+G+I
Sbjct: 193 INNGLMGDI 201

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 82/217 (37%), Gaps = 19/217 (8%)

Query: 22  LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81
           L+N+ P+     F S  K    +  C F    +          ++ I E FH    +   
Sbjct: 66  LDNAVPYSR---FGSSEKT-ILVLQCAFTGFFSTIAGAIYYPVLSEIEEIFHISEESVNI 121

Query: 82  LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTF--FIVC 139
            +  + +  G    I G + D  G +  ++       I    C         T+   +V 
Sbjct: 122 TVVVYFIFQGISPSIMGGLADTMGRRPIVLCS-----IAVYFCACIGLACCQTYPQIVVL 176

Query: 140 RAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESS 199
           R  Q  GIS ++    G++G+I      R   V  + G        MG+ +G LI    S
Sbjct: 177 RCLQAAGISPVIAINSGIMGDITTRAE-RGGFVGYVSGFQV-----MGSAFGALIGAGIS 230

Query: 200 RQWPW--IFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
             W W  IF+  A+ + + LI++   +PE   T V N
Sbjct: 231 STWSWRAIFWFLAIGSGICLIISFIILPETKRTIVGN 267

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 44/235 (18%), Positives = 92/235 (39%), Gaps = 22/235 (9%)

Query: 8   VSSSQKKTLSCDSLLENSTPWQNEQYFQ-SHLKEYFFIFTCMFANLLNQAGQTQVLSTMN 66
           +S +  +  +  S ++N + +    Y + SH ++   +  C F    +    +     + 
Sbjct: 35  ISDNDAERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTGFFSTVAGSIYYPVLT 94

Query: 67  VISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGF 126
           +I   F+         +  + +  G    I G + D +G +         +++W +L  F
Sbjct: 95  IIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRP--------IVLWAILAYF 146

Query: 127 ADY-----THSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
                    H+    +  R  Q  GIS ++    G++G++     + +   + L+     
Sbjct: 147 CACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDV--TTKVERGGYVGLVAGFQV 204

Query: 182 TGACMGALWGGLIATESSRQWPW--IFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
            G   GAL G  +    S +W W  IF+  A+ + + L+ +   +PE   T V N
Sbjct: 205 VGTAFGALIGAGL----SSKWGWRAIFWFLAIGSGICLVFSTLLMPETKRTLVGN 255

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 67/144 (46%), Gaps = 11/144 (7%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           ISG + D+YG +  ++ G +  ++ ++  G A  ++S    +  R  Q  GIS ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLA-CSNSYGVIVFLRCVQSAGISPLIAISS 208

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIAT--ESSRQWPWIFYAYALAA 213
           G+VG+ +   + R + V ++ G      A MG  +G LI     ++  W  IF+   +  
Sbjct: 209 GVVGD-FTTKSERGSFVGAVSGF-----ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 214 FVNLIMAIYSVPENVPTNVHNFAM 237
               ++  + +PE   T   N ++
Sbjct: 263 GTCFVINFFLLPETKRTITGNLSI 286

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 56/139 (40%), Gaps = 17/139 (12%)

Query: 74  SDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSD 133
           +D     WLM  + L +   +L+ GRI  + GLK +++   +     +LL   A    S 
Sbjct: 39  NDYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALAT---SM 95

Query: 134 TFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTL-----RKNIVISLIGITAPTGACMGA 188
              I  R   G G S       G+   ++ VGT       +  V++++GI        G 
Sbjct: 96  GMLIGGRVIAGFGGS-------GIETLVFAVGTRMVDEKHRARVVTILGIAYMLAEGAGP 148

Query: 189 LWGGLIATESSRQWPWIFY 207
             GG  A   S  W W F+
Sbjct: 149 FIGGAFAEHVS--WRWCFF 165

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 15/111 (13%)

Query: 38  LKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILIS 97
           L  Y  IF     N +       V S  N +S+         +W+  S+ L S +F  + 
Sbjct: 115 LSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKV--------SWIATSYLLSSATFQPLY 166

Query: 98  GRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTF--FIVCRAFQGLG 146
           G++ DI+G K  ++   +  +I  L+CG      S +F   ++ R   G+G
Sbjct: 167 GKVSDIFGRKCLLVFTNVAFLIGCLMCGL-----SKSFWWLVIARFVAGVG 212

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 11/141 (7%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           I G + D  G +  ++     ++++   C     +H+    IV R  Q  GIS ++    
Sbjct: 133 IMGGLADSMGRRPVVLSS---VLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINS 189

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPW--IFYAYALAA 213
           G++G+I      R   V  + G        +G+ +G LI    S  W W  IF+  A+ +
Sbjct: 190 GIMGDITTRAE-RGGYVGYVSGFQV-----IGSAFGALIGAGLSATWSWRSIFWFLAIGS 243

Query: 214 FVNLIMAIYSVPENVPTNVHN 234
            V L+ +I  +PE   T V N
Sbjct: 244 GVCLVASIIILPETKRTVVGN 264

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 4/155 (2%)

Query: 286 YELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGAT 345
           +E+KF   PL P++  KN  I++ L ++     ++ + + Y Y   L   + S   A   
Sbjct: 324 WEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRI 383

Query: 346 HFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALG--FTMGSLMLSVTPIHQTYWRMNVGM 403
           + +F     I  F+ GF + +V       F  +G  F    LM+  T    ++  + V  
Sbjct: 384 NKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHVGIIVA- 442

Query: 404 QIILSFGMD-LSFPASSIILSDHLPMQYQGMAGSL 437
           + IL FG   L FPA + I +     +   +  SL
Sbjct: 443 RCILGFGNGFLKFPARASIQASAYSHEMMAVMTSL 477

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 67/154 (43%), Gaps = 22/154 (14%)

Query: 61  VLSTMNVISESF--HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           V++    I E F  ++DVG   WL+  + L S  F L+ GR+  + GLK  ++   +   
Sbjct: 63  VVTLYETIGEKFNDYNDVG---WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFE 119

Query: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGT-----LRKNIVI 173
           I +L+   A  ++S    I  R   G G S       G+   +Y VGT       + +VI
Sbjct: 120 IGSLI---AAVSNSMGMLIAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVI 169

Query: 174 SLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
            ++          G + GG +   +S  W W F+
Sbjct: 170 MVLTFAFVGSNAGGPILGGALNEHAS--WRWCFF 201

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 70/163 (42%), Gaps = 15/163 (9%)

Query: 47  CMFANLLNQAGQTQVLSTMNVISESF--HSDVGTQTWLMASFPLVSGSFILISGRIGDIY 104
           C+F   L+      V + +  +S+ F  +S VG   WL   + L +   +LI GRI  + 
Sbjct: 52  CLFLAALDV---MTVSTIIEEVSQKFGDYSKVG---WLFTGYSLPNALLVLIWGRIATLV 105

Query: 105 GLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKV 164
           G K + +   +   + +L+   A+   S    I  R   G+G S +   +  +   +  V
Sbjct: 106 GFKTSTLAAIVIFEVGSLVSALAN---SMDMLIGGRVIAGIGGSGVQSLVFVISSTL--V 160

Query: 165 GTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
               + ++I+++  +    + +G   GG   T  +  W W FY
Sbjct: 161 EERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVT--WRWCFY 201

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%)

Query: 44  IFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDI 103
           I   M+  +   A    ++ST+     S  +++   +W+  ++ L S +F  I G+I DI
Sbjct: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182

Query: 104 YGLKKTMIGGYIFMIIWTLLCGFA 127
           +G K  +I   I   + +L+CG +
Sbjct: 183 FGRKVVLIFCNITFFVGSLICGLS 206

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 80/203 (39%), Gaps = 12/203 (5%)

Query: 9   SSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCM----FANLLNQAGQTQVLST 64
           +SS++     +S          +   Q  + + F ++ C+     A  L+      V + 
Sbjct: 7   NSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVSTI 66

Query: 65  MNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLC 124
           +  +S  F+ +     WL+  + L +    L+ GR   I G K +M+   I   + +L+ 
Sbjct: 67  IETVSRDFN-EYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVS 125

Query: 125 GFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGA 184
             A+   S    I  R   G+G S +      ++  +  V    + + IS++  +    +
Sbjct: 126 ALAN---SMNMLIGGRVISGVGGSGLQTLCFLIISTL--VNERSRGMAISVLSCSFAVAS 180

Query: 185 CMGALWGGLIATESSRQWPWIFY 207
            +G   GG   T  +  W W FY
Sbjct: 181 IVGPFLGGAFTTHVT--WRWCFY 201

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 11  SQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCM--FANLLNQAGQTQVLSTMNVI 68
           S +  +   S+ E + P   E  +    K   F+  C+  +   L        +  + ++
Sbjct: 102 STETEIEKQSVPEQAVPITEEIPYTKFTKAQQFVIFCIIVYIGFLGPMCGNIYIPALPIL 161

Query: 69  SESFHSDV----GTQTWLMASF---PLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
            E F        GT +  M  F   PLV G F    GR   +Y     +I  +IF +   
Sbjct: 162 QEEFQVTTTTINGTVSIFMGLFAFMPLVWGMFADFGGR-KFLY-----IISLFIFTVANI 215

Query: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181
           LL   A    +     + R  Q +G S  +    G V +I       K++ + ++G    
Sbjct: 216 LL---ASLPANIIALYLVRVLQVVGASAAISLGTGTVADISPPKHRGKSVALFMLGPN-- 270

Query: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDW 239
            G  +  +  GLI   +S QW W+F   A+   V L++ I  +PE +   V N    W
Sbjct: 271 MGPIIAPIIAGLILM-NSNQWRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKW 327

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 69/147 (46%), Gaps = 15/147 (10%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVC--RAFQGLGISFILPN 153
           ISG + D+YG +  ++ G   M+I+  +C       S+++ ++   R  Q  GIS I+  
Sbjct: 141 ISGGLADVYGRRPVILIG---MLIY--VCASIGLACSNSYGVIVFLRCLQSAGISPIIAI 195

Query: 154 IMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLI--ATESSRQWPWIFYAYAL 211
             G+VG+ + V   R   V ++ G T      MG  +G LI  A  ++  W  IF+   +
Sbjct: 196 NSGVVGD-FTVKQERGTFVGAVSGFT-----LMGQAFGSLIGAALTAAFDWRAIFWFLTI 249

Query: 212 AAFVNLIMAIYSVPENVPTNVHNFAMD 238
                +++    +PE   + V N ++ 
Sbjct: 250 GCGTCMLVNFLLLPETKRSIVGNMSIK 276

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 110/287 (38%), Gaps = 42/287 (14%)

Query: 2   ENKEPIVSSSQKKTLSCDSL-----LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQA 56
              EP+    + K    D+      L+N     NE+  QS +     ++ C+FA +L Q 
Sbjct: 28  RESEPVSKKYEDKKAGEDAEDVPVDLKNVFTSDNEKT-QSSIMAGMRLYVCLFALVLAQL 86

Query: 57  GQTQVLSTMNVISESFHSDVG---TQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGG 113
                +  +N + +    ++G      WL+  + L +    LI GR   + G + +M+  
Sbjct: 87  IVALDVFIVNTVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLIS 146

Query: 114 YIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVI 173
                + +++   A   ++    +V R   G+G S +    + ++     V    + IVI
Sbjct: 147 IFIFEVGSIVSATATSMNN---LVVGRVVAGIGGSGL--QTVSMIIGCSLVEERNRTIVI 201

Query: 174 SLIGITAPTGACMGALWGGLIATESSRQWP-WI------------FYAY------ALAAF 214
           ++I       + +G   GG   T ++ +W  WI            F+ Y        A  
Sbjct: 202 AVIMSAFAVSSLIGPFIGGAFTTHATWRWCFWISLPVGGSAAFLFFFTYNPERLSITARL 261

Query: 215 VNLIMAIYSVP-------ENVPTNVHN--FAMDWMGAIIGVVGLILF 252
           V  +  + ++P       E   T V N  F  D +G  +   G+ LF
Sbjct: 262 VRCLKLVKAIPLKQFQYVETYKTIVRNLVFRFDLIGFTLNCTGICLF 308

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 102/236 (43%), Gaps = 21/236 (8%)

Query: 5   EPIVSSSQKKTLSCDSLLENSTPWQNEQYFQS--HLKEYFFIFTCMFANLLNQAGQTQVL 62
           EPI ++S  KT S     +++ P  +E  +      ++ F +  C F  L +    +   
Sbjct: 65  EPIDTTSLYKTKSG----QHNEPTLDEPPYSRFGRKEKIFLVIQCAFTGLFSSIAGSIYY 120

Query: 63  STMNVISESFH-SDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121
             ++V+ + F+ ++      ++  F   + S  L+ G + D  G +  ++     ++++ 
Sbjct: 121 PVLSVMEKEFYITEEQVNVSVVVYFIFQALSPTLMGG-LADSLGRRPVVLSS---IVLYF 176

Query: 122 LLC-GFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
             C G A  T+     I  R  Q  GIS ++    G++G++       +   + L+  T 
Sbjct: 177 CACIGLARCTNYSQL-IGLRCLQAAGISPVIAVNSGIMGDV--TTKAERGGYMGLVSGTQ 233

Query: 181 PTGACMGALWGGLIATESSRQWPW--IFYAYALAAFVNLIMAIYSVPENVPTNVHN 234
             G   GAL G  +    S +W W  IF+   + + + LI++I  +PE   T   N
Sbjct: 234 VLGTAFGALIGAGL----SSRWSWRSIFWFLVIGSGICLIVSIIVLPETKRTVAGN 285

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 63  STMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTL 122
           + ++ +  SF  D     W++  + L +  F L+ GR+  + G + ++I   I     +L
Sbjct: 66  TIIDTVCTSF-GDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSL 124

Query: 123 LCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPT 182
           +   A    S    I  R   G+G S +    + LV     V    + +V+SL+  T   
Sbjct: 125 ISALAK---SMNMLISGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCTFAV 179

Query: 183 GACMGALWGGLIATESSRQWPWIFY 207
            + +G   GG   T  +  W W FY
Sbjct: 180 ASIVGPFLGGAFTTHVT--WRWCFY 202

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 83/209 (39%), Gaps = 16/209 (7%)

Query: 29  QNEQYFQ-------SHLKEYFFIFTCMFANL-LNQAGQTQVLSTMNVISESFHSDVGTQT 80
           + EQ F        S   +   I T +F N+ L+    T   ST  +I   F  DV   +
Sbjct: 23  REEQMFSLTERPSWSERHKVLLIETALFTNVFLSGLDSTISASTYQLIGNEF-GDVKLSS 81

Query: 81  WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCR 140
           W+  ++ +   SF  + G   D  G +  +        +    CG     +S    I+ R
Sbjct: 82  WITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYS---LILMR 138

Query: 141 AFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSR 200
           A  G+G   ++     +  +I  +   ++ I  +   +   TGA +GA  GGLIAT  + 
Sbjct: 139 ALTGIGGGGLITLSTIINSDI--IPAKKRGIYQAFQNVLLGTGAVVGASCGGLIAT--TM 194

Query: 201 QWPWIFYAYALAAFVNLIMAIYSVPENVP 229
            W W F      +    ++A + V +  P
Sbjct: 195 GWRWCFLLQVPISVGGTLVAFFFVHDQRP 223

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 72/159 (45%), Gaps = 25/159 (15%)

Query: 58  QTQVLSTM-NVISESF--HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 114
            T ++ST+   +++ F  +S++G   WL   + L +    LI GRI    G K+TM+   
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIG---WLFTGYSLPNALLALIWGRIATPIGFKRTMLFAI 148

Query: 115 IFMIIWTLLCGFADYTHSDTFFIVCRAFQGLG------ISFILPNIMGLVGNIYKVGTLR 168
           +   + +L+   A+   S    I  R   G+G      +SF++ + +        V    
Sbjct: 149 VIFEVGSLISALAN---SMNVLIGGRVIAGVGGCGIQSLSFVIGSNL--------VEESN 197

Query: 169 KNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207
           + ++I+++  +    + +G   GG+  +  +  W W FY
Sbjct: 198 RGVLIAILSCSFAIASVVGPFLGGVFTSRVT--WRWCFY 234

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 67/144 (46%), Gaps = 11/144 (7%)

Query: 96  ISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIM 155
           ISG + D+YG +  ++ G +  +I ++  G A  + S    +  R  Q  GIS I+    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASI--GLA-CSKSYGAVVFLRCLQSAGISPIIAINS 193

Query: 156 GLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLI--ATESSRQWPWIFYAYALAA 213
           G+ G+ + V + R   V ++ G T      MG  +G LI  A  ++  W  IF+   +  
Sbjct: 194 GVAGD-FTVKSERGTFVGAVSGFTL-----MGQAFGSLIGAALTAAYDWRAIFWFLVIGC 247

Query: 214 FVNLIMAIYSVPENVPTNVHNFAM 237
              +I+  + + E   T V N ++
Sbjct: 248 GTCMIILCFLLIETKRTIVGNLSI 271

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 61/147 (41%), Gaps = 8/147 (5%)

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           V++  + I   FH D G   WL+  + L +  F+L+ GR+ +I G  + ++   +   I 
Sbjct: 28  VVTLYDTIGIKFH-DFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIG 86

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +L+   ++   +     V   F G GI       +  V     V    + I+I+ + ++ 
Sbjct: 87  SLISALSNTMGTLIGGRVIAGFGGSGI-----ESLAFVVGTSIVQENYRGIMITALAVSY 141

Query: 181 PTGACMGALWGGLIATESSRQWPWIFY 207
                +G   GG  A      W W FY
Sbjct: 142 VIAEGVGPFIGG--AFNEHLSWRWCFY 166

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 95  LISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFI 150
           L+ GR+G+ +G ++T+  G +  +I  L  GFAD        I+ R   GLG+  +
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFADKM---MHLIIGRTISGLGVGLL 215

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 8/143 (5%)

Query: 65  MNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLC 124
           ++ + +SF  D     W++  + L +  F L+ GRI    G + +++   +     +L+ 
Sbjct: 67  IDTVCKSF-GDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLIS 125

Query: 125 GFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGA 184
             A    S    I  R   G+G S +    + LV     V    + +V+SL+  T    +
Sbjct: 126 ALA---RSMNMLIAGRVVSGVGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAIAS 180

Query: 185 CMGALWGGLIATESSRQWPWIFY 207
            +G   GG   T  +  W W FY
Sbjct: 181 IIGPFIGGAFTTHVT--WRWCFY 201

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 10/171 (5%)

Query: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120
           V++  + I   FH D G   WL+  + L +  F+L+ GR+ +I G  + ++   I   + 
Sbjct: 28  VVTLYDTIGIKFH-DFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVG 86

Query: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180
           +L+   ++   +    I  R   G G S I    +  V     V    +  +I+ +  + 
Sbjct: 87  SLISALSNSMGT---LISGRLIAGFGGSGI--ESLAFVVGTSIVQENHRGTMITALATSY 141

Query: 181 PTGACMGALWGGLIATESSRQWPWIFYA-YALAAFVNLIMAIYSVP-ENVP 229
                +G   GG  A      W W FY    + AF  +I+A  +   E++P
Sbjct: 142 VIAEGVGPFIGG--AFNEHLSWRWCFYINLPIGAFALIILAFCNTSGESLP 190

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 7/111 (6%)

Query: 39  KEYFFIFTCMFANLLNQAGQTQVLSTMNV--ISESFHSDVGTQTWLMASFPLVSGSFILI 96
           K + F+ +  FA LL +A    ++S +NV  I+E  + +    TW M    +      ++
Sbjct: 42  KTWLFVASAFFA-LLVEATDFFIVS-LNVVKIAEDLNVNDEKVTWGMTIALMTRTIGAVL 99

Query: 97  SGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGI 147
            G IGD +G K + +     + I  LL GFA    +  +FI CRA+ G+ +
Sbjct: 100 YGYIGDQFGQKASFMINIGMISILQLLTGFAT---TFPYFIACRAYFGVEL 147

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 51/127 (40%), Gaps = 7/127 (5%)

Query: 81  WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCR 140
           WL+  + L +    L+ GR G + G K +M+   +   + +L+   A    S T  I  R
Sbjct: 114 WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAAT---SMTMLIGGR 170

Query: 141 AFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSR 200
              G+G S I    +  V     V    +   IS++       +  G   GG  AT  + 
Sbjct: 171 VISGIGGSGI--QTLCFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAFATHVT- 227

Query: 201 QWPWIFY 207
            W W FY
Sbjct: 228 -WRWCFY 233

>KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 72/194 (37%), Gaps = 5/194 (2%)

Query: 39  KEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISG 98
           K+ F +   M    L   G +        I + FH    T T  ++ + L  G   +I  
Sbjct: 102 KKIFLVIQIMLLTCLTYMGSSIYTPGQEEIQKDFHVGHVTATLNLSMYVLGYGLGPIIFS 161

Query: 99  RIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLV 158
            + ++    +  I  Y F +      G A   +     +V R F G+  S  L      +
Sbjct: 162 PLSEVAKFGRQQIYIYTFFLFMVFQVGCATVKNIGGL-VVLRFFSGILCSPSLATGGATM 220

Query: 159 GNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLI 218
           G+I  V    + ++I L  I A     +  L G   A   ++ W WIF+        +LI
Sbjct: 221 GDI--VEAKWRPVLIGLWAIGAVAAPVLAPLLGA--AMVVAKNWRWIFWLMLWMCGASLI 276

Query: 219 MAIYSVPENVPTNV 232
           + +   PE    N+
Sbjct: 277 LFVICFPETSANNI 290

>YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON}
           MCH5Plasma membrane riboflavin transporter; facilitates
           the uptake of vitamin B2; required for FAD-dependent
           processes; sequence similarity to mammalian
           monocarboxylate permeases, however mutants are not
           deficient in monocarboxylate transport
          Length = 521

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 42/105 (40%), Gaps = 8/105 (7%)

Query: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFA-----NLLNQAGQTQVLSTMNVISESFH 73
           DS  E  +  + E + +   K +   F C         LLN  G  +     N +S    
Sbjct: 85  DSDKEEDSNEEIESFPEGGFKAWVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLSSESV 144

Query: 74  SDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           S +G   WL + F  V  +  +ISG   D  G +  MI G +F +
Sbjct: 145 STIG---WLFSLFLFVCSASCIISGTYFDRNGFRTIMIVGTVFHV 186

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 9/119 (7%)

Query: 5   EPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFA-----NLLNQAGQT 59
            P  S +  +T   DS  E  +  + E + +  LK +   F C         LLN  G  
Sbjct: 73  RPHWSETTSRTHESDSE-EGDSNGEAENFPEGGLKAWVVTFGCFLGLIACFGLLNSTGVI 131

Query: 60  QVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118
           +     N ++    S +G   WL + F  V  +  +ISG   D  G +  MI G +F +
Sbjct: 132 ESHLQDNQLANESVSTIG---WLFSLFLFVCFASCIISGTYFDRNGFRTIMIVGTVFHV 187

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 29  QNEQYFQSHLKE---YFFIFTCMFAN-LLNQAGQTQVLSTMNVISESFHSDVGTQTWLMA 84
           ++E+  +  L++   + ++ T ++ N  L+    T V +T+N ++  F       TW+  
Sbjct: 86  EDEEDLEIDLRDPKTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRFQ-QASMVTWVAT 144

Query: 85  SFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQG 144
           ++ L + +   + G+I DI G +K ++ G I   +   LC F   + S     + R   G
Sbjct: 145 AYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVGLCIF---SKSIPQLAIARGICG 201

Query: 145 LG 146
           +G
Sbjct: 202 IG 203

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 80  TWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFA 127
           +W+  ++ L S +F  + G+I DI+G K  +I   +   +  L+CG +
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 102 DIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDT----FFIVCRAFQGLG---ISFILP 152
           DI G K   + G+I + I   + GFA +  SD      +++C+ FQ  G    +FI+P
Sbjct: 413 DIIGRKPIQLAGFIILTILFCVIGFAYHKISDHGLLGLYVICQFFQNFGPNTTTFIVP 470

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 75/180 (41%), Gaps = 11/180 (6%)

Query: 29  QNEQYFQSHLKEYFFIFTCMFANL-LNQAGQTQVLSTMNVISESF-HSDVGTQTWLMASF 86
            +E    S +   + I   ++ N+ L+    T   ST   I   F H D+   +W+ AS+
Sbjct: 54  DDETTPLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDL--SSWITASY 111

Query: 87  PLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLG 146
            + S SF  + G   D+ G +K +    +   I  L CG +      +F    RAF G+ 
Sbjct: 112 LITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFM---RAFTGI- 167

Query: 147 ISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIF 206
                   +  + N   + T ++ I  +   +    GA  GA +GG+I   SS  W W F
Sbjct: 168 -GGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVIT--SSIGWRWCF 224

>TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.155
           YBR241C
          Length = 481

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 4/101 (3%)

Query: 343 GATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVG 402
           G    MF I G + ++  G   +R G   + FF+++   +GS+ML  +    +Y    VG
Sbjct: 87  GVITAMFSIGGVLGSYYAGRLADRYGRRKVTFFTSMIGIIGSMMLFGS---NSYTGFIVG 143

Query: 403 MQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIIN 443
            +I++      S   + +I+++  P +++G  GS+    IN
Sbjct: 144 -RIVVGIASGASIVVTPLIINEIAPPEWRGALGSMNQVFIN 183

>ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 529

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 46/230 (20%), Positives = 90/230 (39%), Gaps = 11/230 (4%)

Query: 2   ENKEPIVSSSQKKTLSCDS-LLENSTPWQNEQYFQ-SHLKEYFFIFTCMFANLLNQAGQT 59
           ++KE  + +   K+   D  L+E + P   E     S +K +  +F  M    +   G +
Sbjct: 44  DSKECALVNGLAKSEDVDPFLVEFNGPTDPEHPHNWSTIKRFVVVFNVMVLTCVTYMGTS 103

Query: 60  QVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDI--YGLKKTMIGGYIFM 117
                 ++I + FH      T  ++ + L  G   L+ G + +   +G ++  I      
Sbjct: 104 FYTPGQDLIEKEFHVGHVVGTLNLSLYILGFGLGPLVFGPLSEFVAFGRQRLFIVTLFLF 163

Query: 118 IIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIG 177
            +  + C            ++ R   G+  S  L N    VG++  V      +V+ L  
Sbjct: 164 AMLQIGCALVKNIAG---LVILRFLSGIFCSPSLANGAAAVGDV--VRPRHIPVVLGLWA 218

Query: 178 ITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPEN 227
           I A  G   G L G  +    ++ W ++F+     +   L++ ++S PE 
Sbjct: 219 IGALAGPSTGPLLGASMVV--AKNWRYMFWLLMWISSATLLLMVFSYPET 266

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 3/87 (3%)

Query: 155 MGLVGNIYKVGTLRKNIVISLIGITA---PTGACMGALWGGLIATESSRQWPWIFYAYAL 211
           M L G+ +K G + +     ++G  A    TGA   A++G L  +     W W F     
Sbjct: 197 MYLFGSFFKSGEVARRSGFMIVGQYAGLMSTGAMQSAIFGALNTSHGLSGWRWYFIIVGA 256

Query: 212 AAFVNLIMAIYSVPENVPTNVHNFAMD 238
            + V  ++  YS+P ++      F  D
Sbjct: 257 ISIVVALLGFYSLPGDIHNCYSIFLTD 283

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 67/164 (40%), Gaps = 16/164 (9%)

Query: 68  ISESFH--SDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCG 125
           I E FH   +V     ++  F L  G   L    I ++YG + T I      I+W  L  
Sbjct: 102 IIEKFHVSREVSVLGIMLYVFGLAFGPLFL--SPISELYGRRATFIFSLTLSIVWQCL-- 157

Query: 126 FADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVI--SLIGITAPTG 183
              ++ + T  +  R   G   S  L    G + +I+    L+  I +  SL    A  G
Sbjct: 158 -TTWSRTLTGVMFGRFLSGFFGSSFLSVAGGAISDIF----LKSQITVPMSLYTTAAMMG 212

Query: 184 ACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPEN 227
             +G +  G + T   R   W F  + +A+ V L+  + ++PE 
Sbjct: 213 PSLGPIISGALYTVDFR---WTFVTFIIASGVCLVAIVVTIPET 253

>AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 500

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 15/144 (10%)

Query: 14  KTLSCDSLLENSTPWQNEQYFQS--------HLKEYFFIFTCMFANLLNQAGQTQVLSTM 65
           KT   +   E    W+  +Y  +         LK + FI +   A  L        L ++
Sbjct: 9   KTRVTELFPEKRPSWEEFKYTMNPANVLSNVKLKTWLFIASAFLA--LTVEATDFFLVSL 66

Query: 66  NV--ISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLL 123
           NV  I+E  H      TW +    +      ++ G +GD +G + + +     + +  L+
Sbjct: 67  NVVKIAEDLHVREDKVTWGITVALMTRTIGAIVYGYVGDRFGQRTSFLINIGMISVLQLV 126

Query: 124 CGFADYTHSDTFFIVCRAFQGLGI 147
            GFA    S  +F+ CRA+ G+ +
Sbjct: 127 TGFAT---SFPYFLACRAYFGVEL 147

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 12/130 (9%)

Query: 100 IGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVG 159
           + ++YG +KT I    F I+W  L  ++       F    R   G   S  L    GL  
Sbjct: 137 LSELYGRRKTFIISLFFSIVWQCLVIWSKTIEGVMF---GRFLSGFFGSAFLSVAGGLFT 193

Query: 160 NIYKVGTLRKNIVISL-IGITAPT-GACMGALWGGLIATESSRQWPWIFYAYALAAFVNL 217
           +I++    +KNI I + I  T+P  G  +G +  G +       + W F    LA+ ++ 
Sbjct: 194 DIFE----KKNIGIPITIYTTSPMLGPALGPIISGAL---HGTNYKWTFITMLLASGLSF 246

Query: 218 IMAIYSVPEN 227
           I  I  VPE 
Sbjct: 247 ICVILLVPET 256

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 76/185 (41%), Gaps = 13/185 (7%)

Query: 44  IFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDI 103
           IF C  +   N +     LS   +IS+ FH            F +  G    +     + 
Sbjct: 86  IFVCQLSMNFNGSVYPHALS---LISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEE 142

Query: 104 YGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNI-MGLVGNIY 162
           YG +  M     F  IW +L G A    +    I+   F G GIS    ++ +G+V +++
Sbjct: 143 YGRRNIMQLSLFFTNIWQILGGKAPNFGT----IIVARFLG-GISQAGGSVTLGVVADMW 197

Query: 163 KVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIY 222
           +         ++ + + +  GA +G ++GGL+  E    W W F+   +   V  ++  +
Sbjct: 198 Q--PQDHGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIFGGVTQLLHFF 253

Query: 223 SVPEN 227
            VPE 
Sbjct: 254 LVPET 258

>Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON}
           (29969..31474) [1506 nt, 502 aa]
          Length = 501

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 12/135 (8%)

Query: 95  LISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNI 154
           LI   + ++YG + T I      IIW  L  ++       F    R   G   S  L   
Sbjct: 114 LILSPLSELYGRRLTFIFSLALSIIWQCLTTWSKTIEGVMF---GRFLSGFFGSSFLSVA 170

Query: 155 MGLVGNIYKVGTLRKNIVISL-IGITAPT-GACMGALWGGLIATESSRQWPWIFYAYALA 212
            G + +I++    +K+I I + I  T+P  G  +G + GG +  +S   + W F    +A
Sbjct: 171 GGSISDIFE----KKDIGIPMAIFTTSPMLGPSIGPIIGGALHKDS---YKWTFIVLLIA 223

Query: 213 AFVNLIMAIYSVPEN 227
           + V L++   +VPE 
Sbjct: 224 SGVCLVLITLTVPET 238

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 51  NLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTM 110
           + L+    T V   MN ++E F++    Q W+  S+ L + +F  + GR+ DI G K T 
Sbjct: 76  SFLSALDATIVAVIMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRKYTQ 134

Query: 111 I 111
           +
Sbjct: 135 L 135

>TPHA0O00800 Chr15 complement(151545..153428) [1884 bp, 627 aa] {ON}
           Anc_1.451 YCR023C
          Length = 627

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 62/133 (46%), Gaps = 16/133 (12%)

Query: 98  GRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGL--GISFILPNIM 155
            ++   YG K T++ G     I  L+ GFA Y +     ++ R   GL  G   I+  ++
Sbjct: 80  SKVSQQYGRKPTLLLGLFGTGISLLVLGFAKYYYQT---LLARGMMGLLNGNVSIIRTVI 136

Query: 156 GLVGNIYKVGTLRK--NIVISLIGITAPTGACMGALWGG-LIATESSRQWPWIFYAYALA 212
           G      ++ T R+   +  S++ +   TGA +G + GG L+  E +  +P  ++  ++ 
Sbjct: 137 G------ELATERRYQGVAFSMLPLLFETGAVIGPMVGGYLVFREENNTYPPNWFPASVK 190

Query: 213 AFVNLIMAIYSVP 225
             V +    YS+P
Sbjct: 191 RLVKIYP--YSLP 201

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 23/128 (17%)

Query: 137 IVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA---PTGACMGALWGGL 193
           +V R  Q  GIS ++    G++G++    T R+      +G+TA     G+  GAL GG 
Sbjct: 113 LVLRCLQSAGISPVIAVNSGIMGDV----TTREQRG-GYVGLTAGFQVIGSAFGALIGGG 167

Query: 194 IATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFN 253
           I   S+  W  +F+  A+A+  +L++    +PE   + V N             G I  N
Sbjct: 168 IV--STWSWRAVFWFLAIASGFSLVVTFIMLPETKRSIVGN-------------GSIQPN 212

Query: 254 FVWNQGPV 261
            +W+  PV
Sbjct: 213 TIWHIAPV 220

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 12/147 (8%)

Query: 63  STMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTL 122
           +++ VISE F+ D     W+++ + L      L+ GR   I+G K +++   +     +L
Sbjct: 63  ASIEVISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSL 121

Query: 123 LCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKN--IVISLIGITA 180
           +   +  ++S    I  R   G+G S     I  L   I    T  ++  + IS++    
Sbjct: 122 I---SAVSNSMNVLIGGRVVAGIGGS----GIQSLCFVIASTLTTERSRGVAISVLSCAY 174

Query: 181 PTGACMGALWGGLIATESSRQWPWIFY 207
              A  G   GG   T  +  W W FY
Sbjct: 175 AVAAVAGPFMGGAFTTHVT--WRWCFY 199

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 76/385 (19%), Positives = 144/385 (37%), Gaps = 32/385 (8%)

Query: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQN----EQYFQSHLKEYFFIFTCMFANL-LNQA 56
           +NK+ I  S +   ++  SL+E++   ++    E    S +   + I   +F+N+ L+  
Sbjct: 12  KNKDGIYGSIE---VTETSLVEDNADIEDVDKDEDMALSRIPNLWIIEATLFSNVFLSGF 68

Query: 57  GQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIF 116
             T   ST   I   F+  +    W+  ++ + S SF  + G   D  G +  +      
Sbjct: 69  DGTVTASTYQTIGNEFN-QMSISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAA 127

Query: 117 MIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLI 176
             I  L C       S   + +       GI       +  + N   + + ++ I  +  
Sbjct: 128 FTIGCLACSL-----STNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQ 182

Query: 177 GITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHN-- 234
            +    GA  GA +GG IA  S+  W W F      + ++ ++  Y VP     N  N  
Sbjct: 183 NLLLGFGAICGASFGGTIA--STIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNHENSN 240

Query: 235 ---------FAMDWMGAIIGVVGLILFNFVWNQGPVN---GWAKPYXXXXXXXXXXXXXX 282
                      +D  G+I+ + GL L     + G       W  P               
Sbjct: 241 IFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLL 300

Query: 283 XXXYELKFPISPLLPREVTKNGQILTILGI-LFLGWGSFGIWTFYYYAFQLNLRNYSPLW 341
              +E K     ++P E+  +     +L I + +G+ S+         FQ+ L + S   
Sbjct: 301 FISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLFTLPLFFQIVLGD-STAK 359

Query: 342 AGATHFMFIIWGSIAAFIVGFTINR 366
           AG    +  ++  + + I GF++++
Sbjct: 360 AGLRLAIPSLFTPVGSLITGFSMSK 384

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 78/194 (40%), Gaps = 7/194 (3%)

Query: 38  LKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILIS 97
           L++  +I   +F      A  T +++T+     S        +W+  S+ L   +F  + 
Sbjct: 28  LRDVNWIVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLY 87

Query: 98  GRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGL 157
           G++ D++G K  +I   +      +LCG A +T S     + R   G+G   +  N +  
Sbjct: 88  GKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLST 144

Query: 158 VGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFV-- 215
           +     +   ++ +   +  I    G   G+L G  +  +    W W F      + +  
Sbjct: 145 ITTSDIIPLRQRGVYQGMGNIVFALGCASGSLIGAFL--QQRIGWRWAFLCQVPLSLLSC 202

Query: 216 NLIMAIYSVPENVP 229
           +LIM   ++P   P
Sbjct: 203 SLIMKFLNLPAGSP 216

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 102 DIYGLKKTMIGGYIFMIIWTLLCGFADYTHSD----TFFIVCRAFQGLG---ISFILP 152
           DI G K   + G+I + I   + GFA +   D      +++C+ FQ  G    +FI+P
Sbjct: 413 DIIGRKPIQLAGFIILTILFCVIGFAYHKIGDHGLLALYVICQFFQNFGPNTTTFIVP 470

>Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii ACL172C
          Length = 648

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 29/59 (49%)

Query: 346 HFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQ 404
           + + ++  ++A F+    +N++GP   L    +  ++G L L +      YWR N  +Q
Sbjct: 583 NLVRMLLAAVAVFVTEPMLNKIGPGWALTILEIIISVGGLSLIILKSRSDYWRANYDLQ 641

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,653,575
Number of extensions: 1964150
Number of successful extensions: 6286
Number of sequences better than 10.0: 224
Number of HSP's gapped: 6370
Number of HSP's successfully gapped: 233
Length of query: 517
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 403
Effective length of database: 40,409,475
Effective search space: 16285018425
Effective search space used: 16285018425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)