Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C003808.846ON27627613920.0
NDAI0K003308.846ON3133046101e-77
KNAG0J002408.846ON2862855741e-72
YMR281W (GPI12)8.846ON3042985588e-70
Kpol_1068.48.846ON2912435472e-68
Suva_13.4708.846ON3032975334e-66
Skud_13.4538.846ON3002955317e-66
Smik_13.4948.846ON3042925241e-64
KLTH0C03740g8.846ON2542485052e-62
TDEL0B005208.846ON2682525025e-62
KAFR0B039608.846ON2782774984e-61
ZYRO0G14300g8.846ON2802544922e-60
Kwal_27.102278.846ON2542244842e-59
Ecym_46178.846ON2492214754e-58
TPHA0I002808.846ON3012664786e-58
CAGL0M03047g8.846ON3042964641e-55
SAKL0D01320g8.846ON2602274512e-54
ABL120W8.846ON2492624442e-53
KLLA0D01430g8.846ON2632254391e-52
TBLA0B033008.846ON3192634171e-48
KNAG0D044504.268ON686169711.8
Suva_10.2228.324ON94396711.8
YLR129W (DIP2)8.324ON94393684.1
Ecym_42558.324ON93760685.1
Kpol_1061.63.259ON451142675.3
NDAI0B037202.253ON147480675.9
NCAS0C032608.324ON98369666.9
SAKL0F01342g3.546ON62750666.9
SAKL0H15532g8.324ON94182668.0
Skud_12.1988.324ON94393668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00380
         (276 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   540   0.0  
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   239   1e-77
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   225   1e-72
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   219   8e-70
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   215   2e-68
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   209   4e-66
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   209   7e-66
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   206   1e-64
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   199   2e-62
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   197   5e-62
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   196   4e-61
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   194   2e-60
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   191   2e-59
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   187   4e-58
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   188   6e-58
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   183   1e-55
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   178   2e-54
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   175   2e-53
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   173   1e-52
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   165   1e-48
KNAG0D04450 Chr4 (805173..807233) [2061 bp, 686 aa] {ON} Anc_4.2...    32   1.8  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    32   1.8  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    31   4.1  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    31   5.1  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    30   5.3  
NDAI0B03720 Chr2 (930486..934910) [4425 bp, 1474 aa] {ON} Anc_2....    30   5.9  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    30   6.9  
SAKL0F01342g Chr6 (112464..114347) [1884 bp, 627 aa] {ON} simila...    30   6.9  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    30   8.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    30   8.3  

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/276 (96%), Positives = 265/276 (96%)

Query: 1   MFLSNFSFSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIA 60
           MFLSNFSFSKLIFKVTK           SSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIA
Sbjct: 1   MFLSNFSFSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIA 60

Query: 61  HPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQ 120
           HPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQ
Sbjct: 61  HPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQ 120

Query: 121 TNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNT 180
           TNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNT
Sbjct: 121 TNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNT 180

Query: 181 NNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYIL 240
           NNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYIL
Sbjct: 181 NNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYIL 240

Query: 241 AYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
           AYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT
Sbjct: 241 AYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  239 bits (610), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 182/304 (59%), Gaps = 35/304 (11%)

Query: 8   FSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNY--SQLN---------TKIFHEGTTLN 56
           FSK  +K  K           S+ +I  +N  ++  S LN           I    T L+
Sbjct: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64

Query: 57  LVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALI- 115
           LVIAHPDDE+MFFAPTLLQL+  +P SIP N+ICFS+GDA+GLG  R+ EL  SI+ L+ 
Sbjct: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLS 124

Query: 116 -QNQRQTNVTVLHFQDGNDQIWDIDQMTQYL---------PQNDHQAFLTFDSHGVSGHK 165
             N R+ N+++L F DG DQ+WD  Q+   L         P   +   LTFD++G+S H 
Sbjct: 125 SSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184

Query: 166 NHIACHNAVWNL------KNTNNNVTILTLDS------IHHSLLAKYTFFIIDLVKLYWN 213
           NHIAC+ AV +L      K+   N+  L L S      I  +LL+KYTFF+IDLVK+YWN
Sbjct: 185 NHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWN 244

Query: 214 LWKDQQQPQWESHD-KITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHL 272
           L          S   +++F N YSQYIL+Y++MLN HKSQ+VWFRYGWW FSRFVFSN L
Sbjct: 245 LATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304

Query: 273 KITT 276
            + +
Sbjct: 305 LVVS 308

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  225 bits (574), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 173/285 (60%), Gaps = 17/285 (5%)

Query: 6   FSFSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDE 65
           F+FS+ I+KVTK           +S    +  + NY+ L T   H+  ++NLVIAHPDDE
Sbjct: 4   FNFSRFIYKVTKLSLLLGILYIYAST--SKIGSFNYTNLETLGEHDINSVNLVIAHPDDE 61

Query: 66  VMFFAPTLLQL-DNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVT 124
           VMFFAP+L+ L + +   S   N+ICFSNG A GLG  R+ EL  SI A++   R T++ 
Sbjct: 62  VMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSI-AMLLPTRNTSIV 120

Query: 125 VLHFQDGNDQIWDIDQMTQYL----PQNDHQAFLTFDSHGVSGHKNHIACHNAV---WNL 177
           VL F+DG  + WD+ +M   L    P+  H   LTFD  GVSGH NHIAC+ A    +N 
Sbjct: 121 VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE 180

Query: 178 KNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQ----PQWESH--DKITF 231
             +   +T+L+L S   +++ KY+ +I +L+KL ++ W   +     P+  S+   KIT 
Sbjct: 181 FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI 240

Query: 232 FNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
           F+ Y QY+L+ + MLNAHK+QVVWFRYGWW FSR VF N L + +
Sbjct: 241 FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  219 bits (558), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 174/298 (58%), Gaps = 26/298 (8%)

Query: 4   SNFSFSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPD 63
           +  +FSKL++K+TK            + +I   N  +   +    + +   +NLVIAHPD
Sbjct: 7   TKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGD-YEINLVIAHPD 65

Query: 64  DEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNV 123
           DEVMFF+P + QL++  P ++P N+IC S G+A+GLGE R  EL  S   L+ N+R  +V
Sbjct: 66  DEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSV 125

Query: 124 TVLHFQDGNDQIWDIDQMTQYLPQ-------NDHQAFLTFDSHGVSGHKNHIACHNAVWN 176
            V+ FQDG D+IWDID +T  L Q       N +Q  +TFDS+GVS H NH +C+ AV  
Sbjct: 126 QVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKK 185

Query: 177 L------KNTNNN-----VTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKD-----QQQ 220
           L        T  N     VT L L S  ++++ KY  FI +++K+ ++L        Q  
Sbjct: 186 LVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQAL 245

Query: 221 PQ--WESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
           P       DK++  N ++QY+LA++TMLNAH+SQVVWFRYGWW FSRFVF N   + T
Sbjct: 246 PPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYT 303

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  215 bits (547), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 151/243 (62%), Gaps = 17/243 (6%)

Query: 49  FHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNG---DAQGLGEKRQH 105
           F   +++NLVIAHPDDEVMFF+PTL+QLDN +P  + INVICFS G   D    GE R  
Sbjct: 42  FSGSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRAR 101

Query: 106 ELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYL-----PQNDHQA---FLTFD 157
           EL+ S+  LI++ R   V  L ++DG DQIWD+D M   L     P  D++     +TFD
Sbjct: 102 ELKKSVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFD 161

Query: 158 SHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKD 217
            HGVS H NHIACHNAV  L           L+S   +++ KY+FF  ++VK ++N    
Sbjct: 162 EHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQ 221

Query: 218 QQQPQWESHDKI------TFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNH 271
           + + Q   +  +        FN +S+YI+AY+TMLNAH+SQVVWFRYGWW FSR  ++N 
Sbjct: 222 RIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANE 281

Query: 272 LKI 274
           LK+
Sbjct: 282 LKL 284

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  209 bits (533), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/297 (41%), Positives = 163/297 (54%), Gaps = 31/297 (10%)

Query: 8   FSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHE--GTTLNLVIAHPDDE 65
           FSKL+FK+TK            + +I   NT     L     H    + +NLVIAHPDDE
Sbjct: 9   FSKLLFKITKLAIVLTVLYIYFTPKILSRNT---DSLQHVFPHRDRNSQINLVIAHPDDE 65

Query: 66  VMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTV 125
           VMFF+P + QL    P ++P N++C S GDA+GLGE R  EL  S   L++N+R  +V V
Sbjct: 66  VMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQV 125

Query: 126 LHFQDGNDQIWDIDQMTQYLPQ-------NDHQAFLTFDSHGVSGHKNHIACHNAVWNL- 177
           + F+DG D++WDID +T  L Q          Q  +TFDS+GVS H NH +CH AV    
Sbjct: 126 MDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFI 185

Query: 178 ----------KNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNL---WKDQQQP--- 221
                     K  N ++T L L S  +++  KY  FI +++K+ +     +    QP   
Sbjct: 186 DDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAA 245

Query: 222 --QWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
                  + +   N +SQYILA++ MLNAHKSQVVWFRYGWW  SRFVF N   I T
Sbjct: 246 PSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFT 302

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  209 bits (531), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 167/295 (56%), Gaps = 30/295 (10%)

Query: 8   FSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIF---HEGTTLNLVIAHPDD 64
           FSKL++K+TK            + +I   N     +L   +F   +  + +NLVIAHPDD
Sbjct: 9   FSKLVYKITKLAIVLTILYIFFTPKIISRN----DELLQHVFPHKNRDSQINLVIAHPDD 64

Query: 65  EVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVT 124
           EVMFF+P + QL +  P+++P N+IC S G+A GLGE R  EL  S   L+QN+R  +V 
Sbjct: 65  EVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQ 124

Query: 125 VLHFQDGNDQIWDIDQMTQYLPQND-------HQAFLTFDSHGVSGHKNHIACHNAVWNL 177
           V+ F+DG D++WDI+ +   + Q         +Q  +TFDS+GVS H NH +CH AV  L
Sbjct: 125 VMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRL 184

Query: 178 --------KNTNNN---VTILTLDSIHHSLLAKYTFFIIDLVKLYWNLW-----KDQQQP 221
                     TN     +T L L S  ++++ KY  FI +++K+ +++        Q   
Sbjct: 185 IDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPT 244

Query: 222 QWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
                 K+   N ++QY+LAY+ MLNAHKSQVVWFRYGWW  SRFVF N   + T
Sbjct: 245 TTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYT 299

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  206 bits (524), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 167/292 (57%), Gaps = 26/292 (8%)

Query: 8   FSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVM 67
           FSKL++K+TK            + +I   N  +   +    + +   +NL+IAHPDDEVM
Sbjct: 11  FSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSD-YQINLIIAHPDDEVM 69

Query: 68  FFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLH 127
           FF+P + QL +  P ++P N+IC S G+A+GLG+ R  EL  S   L+ N+R  +V V+ 
Sbjct: 70  FFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMD 129

Query: 128 FQDGNDQIWDIDQMTQYLPQND-------HQAFLTFDSHGVSGHKNHIACHNAVWNL--K 178
           FQDG +++WDID +T  L Q         +Q  +TFDS+GVSGH NH +CH AV  L   
Sbjct: 130 FQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIAD 189

Query: 179 NTNNNV---------TILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKD-----QQQPQWE 224
            T +NV         T L L S  ++++ KY  FI +++++ + L        Q  P   
Sbjct: 190 YTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDV 249

Query: 225 SHDK--ITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKI 274
             +K  +   N ++QYILA++ MLNAHKSQVVWFRYGWW  SRFVF N   +
Sbjct: 250 VAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  199 bits (505), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 106/248 (42%), Positives = 152/248 (61%), Gaps = 19/248 (7%)

Query: 29  SSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINV 88
           SS RI+  N   ++ L + +    T++NLVIAHPDDEVMFFAPTLLQLD+     IP++V
Sbjct: 21  SSARIKASNEQAFTTLFSVL--NPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSV 78

Query: 89  ICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ- 147
              ++G A GLG+ R+ EL+ S+H L + +R+  VTVL+F+DG    WD+ + ++ L + 
Sbjct: 79  FSLTDGGADGLGKLREEELRDSVHLLFR-RRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137

Query: 148 --NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFII 205
              D   FLTFD HGVS H NHI+C+  V NL+  +      +L S   S+  KYT F+ 
Sbjct: 138 VVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTS-KRSIFQKYTAFVP 196

Query: 206 DLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSR 265
            L+     + +  +Q          F + + QY+LA S M+NAH SQ+VWFRYGWW FS 
Sbjct: 197 SLI----TVLRGSRQA--------VFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSC 244

Query: 266 FVFSNHLK 273
           +VF+N ++
Sbjct: 245 YVFANEVR 252

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  197 bits (502), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 153/252 (60%), Gaps = 19/252 (7%)

Query: 32  RIEQFNTLNYSQLNTKIFHEGT--TLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVI 89
           RI   N + + Q    I   GT  +L L+IAHPDDEVMFF+P+LLQLD L+P S+  N +
Sbjct: 27  RINGRNEVQWQQHAAAI---GTPESLTLLIAHPDDEVMFFSPSLLQLDRLLPQSVRFNFV 83

Query: 90  CFSNGDAQGLGEKRQHELQSSIHALIQN-QRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ- 147
           C S GDA  LGE R+ ELQ S++ L  N QR+T +    + DG D+ W+I+ +   +   
Sbjct: 84  CLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFDEKWEIESVVSIVESK 143

Query: 148 ----NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFF 203
               +     LTFD+HGVS H NH+ACHNAV  L    +    L L+S   +L  KY+ F
Sbjct: 144 VFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGHKA--LYLNSHSRNLPLKYSGF 201

Query: 204 IIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAF 263
           I +L+++  +     ++        +TF N++ QYILA++ M NAH+SQ+VWFRYGWW+ 
Sbjct: 202 IWELIRMLSDSVMKLER------TGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSL 255

Query: 264 SRFVFSNHLKIT 275
           SRFVF N L+I 
Sbjct: 256 SRFVFVNDLEIV 267

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  196 bits (498), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 159/277 (57%), Gaps = 13/277 (4%)

Query: 9   SKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGT---TLNLVIAHPDDE 65
           SKLIFK+TK            S +I+  N    +     +  + +   +L LV+AHPDDE
Sbjct: 5   SKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDE 64

Query: 66  VMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTV 125
           VMFF+PTLLQLD+ +P +   N+I +S+GDA+GLG  R +EL  SI  LI  +R   + +
Sbjct: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP-RRNKEIFI 123

Query: 126 LHFQDGNDQIWD----IDQMTQYLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNL--KN 179
            +  DG +++WD    + Q+   L  +     LTFD  GVS H NH ACH  V +    +
Sbjct: 124 FNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSH 183

Query: 180 TNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYI 239
             NN  +L LDS   +LL KYT F   LV L  N W   +     + D +  FN YS YI
Sbjct: 184 AKNNFALL-LDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKT--LPNLDHLALFNPYSDYI 240

Query: 240 LAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
            AY+TML AHKSQ+VWFRYGWW FSRFV+ N LK+ T
Sbjct: 241 TAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYT 277

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  194 bits (492), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 150/254 (59%), Gaps = 34/254 (13%)

Query: 45  NTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQ 104
           N K   E  +L+LV+AHPDDEVMFFAPT+L+LD+ +P ++  NV+C S G A  LG+ R 
Sbjct: 36  NLKFLDEIDSLSLVVAHPDDEVMFFAPTILELDSRLPPNVEFNVVCLSKGGADELGDTRV 95

Query: 105 HELQSSIHALIQN-QRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQA-----FLTFDS 158
            EL+ S++ L+ N +RQ  +    + DG+++ WD + +   +  +  Q       LTFD 
Sbjct: 96  QELKESVNLLLANSKRQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDD 155

Query: 159 HGVSGHKNHIACHNAVWNLKNTNNNV-TILTLDSIHHSLLAKYTFFIIDLVKLYWNLWK- 216
            GVS H NHIACH AV NL    +NV   L LDS   +++ KY+ F       +W +WK 
Sbjct: 156 KGVSKHVNHIACHEAVSNLVQDESNVKAALYLDSYGDNIVLKYSAF-------FWEIWKL 208

Query: 217 ---------------DQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWW 261
                          ++ +P  E    IT  + YS YIL++++ML++HKSQ+VWFRYGWW
Sbjct: 209 TRDWFLHRVLPTSSYNENKPATE----ITLMSDYSSYILSFASMLHSHKSQMVWFRYGWW 264

Query: 262 AFSRFVFSNHLKIT 275
            FSRFVF N LK+ 
Sbjct: 265 TFSRFVFVNDLKVV 278

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  191 bits (484), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 141/224 (62%), Gaps = 17/224 (7%)

Query: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112
           T++NLVIAHPDDEVMFFAPTLLQ+D  +P SI +NVI  ++G A GLG+ R  ELQ  + 
Sbjct: 43  TSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVR 102

Query: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ---NDHQAFLTFDSHGVSGHKNHIA 169
            L++ +R+ +V VL F DG D  WD+++  + L +   ++   FLTFD +G+SGH NHI+
Sbjct: 103 LLLR-KRKASVEVLDFLDGMDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHIS 161

Query: 170 CHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKI 229
           C+ AV  ++   +  +   L S  + L  KY+ FI  L               + S    
Sbjct: 162 CYKAVQKVRKHYSKSSCFKLVSKRY-LFEKYSGFIPALFH------------SFISSSPS 208

Query: 230 TFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLK 273
           T  N++ QY+LA S+M+NAH SQ+VWFRYGWW FS +V++N L+
Sbjct: 209 TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQ 252

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  187 bits (475), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 137/221 (61%), Gaps = 21/221 (9%)

Query: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112
           T++ L+IAHPDDEVMFFAPTLLQLD  M  S+P  V+C ++GDA GLGE R+ EL  ++ 
Sbjct: 45  TSVTLIIAHPDDEVMFFAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALR 104

Query: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ---NDHQAFLTFDSHGVSGHKNHIA 169
            L+  +R   + +  F+DG D+ W ++ + + L Q   +     LTFD  GVSGH+NHIA
Sbjct: 105 LLVL-ERDVEIQMGGFKDGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIA 163

Query: 170 CHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKI 229
           C +A   L +       L LDS  H+L+ KY+FF +DL +L +        P        
Sbjct: 164 CAHAAAKLGHHT-----LHLDS-GHNLIRKYSFFFVDLFRLLFG------YPM-----PT 206

Query: 230 TFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSN 270
            F + +SQY+ +  TML AHKSQ+VWFR+GWW  SR+V++N
Sbjct: 207 VFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYAN 247

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  188 bits (478), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 157/266 (59%), Gaps = 36/266 (13%)

Query: 39  LNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNG---D 95
           LN SQ + K      ++NL+IAHPDDEVMFF PTLLQLD+++P  +P NVIC S G   D
Sbjct: 39  LNISQQSLK------SVNLIIAHPDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVD 92

Query: 96  AQGLGEKRQHELQSSIHALIQNQR-----QTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH 150
            + +G+ R +E+  S+  L+ ++R     +  +    ++DG D+ WDI ++   +     
Sbjct: 93  GRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTIS 152

Query: 151 QA---------FLTFDSHGVSGHKNHIACHNAVWNLKNTNNN---VTILTLDSIHHSLLA 198
                       LTFD+ GVS H NHIAC++A+  LK  ++N     ++TL+S   +++ 
Sbjct: 153 MESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIIL 212

Query: 199 KYTFFIIDLVKLYWNLWKDQ-------QQP---QWESHDKITFFNAYSQYILAYSTMLNA 248
           KY+ F+  + KL  N+  D+       Q P     + HD+I F N +  YI+A S+MLN+
Sbjct: 213 KYSSFLPVVFKLLINIINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNS 272

Query: 249 HKSQVVWFRYGWWAFSRFVFSNHLKI 274
           H SQ+VWFRYGWW+FSRFVF N L I
Sbjct: 273 HTSQMVWFRYGWWSFSRFVFVNDLHI 298

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  183 bits (464), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 168/296 (56%), Gaps = 27/296 (9%)

Query: 3   LSNFSFSKLIFKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHP 62
           + NF FSKL+FK+TK            + ++E  N  N ++L     + G  LNLVIAHP
Sbjct: 13  IRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGV-LNLVIAHP 71

Query: 63  DDEVMFFAPTLLQL-DNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQT 121
           DDE+MFF+PT+LQL D++  L    NV+C SNGDA GLGE R  EL+ +I  L  N+   
Sbjct: 72  DDEIMFFSPTILQLIDHVQEL----NVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLR 127

Query: 122 NVT--VLHFQDGNDQIWD--IDQMTQYLPQND-----HQAFLTFDSHGVSGHKNHIACHN 172
           NV+  +L + DG +++W      + +Y+  ++         LTFD  G+SGH+NHIAC+ 
Sbjct: 128 NVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNE 187

Query: 173 AVWNLKNT--NNNVTILTLDSIHH-SLLAKYTFFIIDLVKLYWNLWKDQQQ------PQW 223
            V +   T  +N+   L L S+    +++KY+  +  L+++ +N  +   +      P  
Sbjct: 188 GVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNR 247

Query: 224 ES---HDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276
           +S      + F + + QY L+++ M  AHKSQ+VWFRY WW+FSR+VF N L   T
Sbjct: 248 DSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  178 bits (451), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 133/227 (58%), Gaps = 21/227 (9%)

Query: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112
           T++NL++AHPDDE MFF+PTLLQL    P S+P+ VIC +NGDA GLG  R+ EL+ S+ 
Sbjct: 46  TSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQ 105

Query: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQA---FLTFDSHGVSGHKNHIA 169
            L+   R T+V V  F+DG    WD  Q+   + ++   A    LTFD HGVSGH NH++
Sbjct: 106 LLLP-ARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDASPLLLTFDEHGVSGHVNHVS 164

Query: 170 CHNAVWNL----KNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWES 225
           C+ AV  L    +      T L L+S  +    KY  F +DL ++       +Q P    
Sbjct: 165 CNTAVSALVEQREQREQRFTALYLNSKRY-FPPKYGSFAVDLARII----TGRQPP---- 215

Query: 226 HDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHL 272
                F + + QY+L+ + M NAH SQ+VWFR+GWW  SRFVF N L
Sbjct: 216 ----VFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  175 bits (444), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 144/262 (54%), Gaps = 22/262 (8%)

Query: 13  FKVTKXXXXXXXXXXXSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPT 72
           F V K           S  R+E+ NT  + +L      + T+L LVIAHPDDEVMFFAPT
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGD-SQHTSLTLVIAHPDDEVMFFAPT 64

Query: 73  LLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGN 132
           LLQLD  +P  +P  V+C ++G A+GLG+ R+ ELQ ++  L+  +    + V  F DG 
Sbjct: 65  LLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVL-EHDVTLEVADFTDGM 123

Query: 133 DQIWDIDQMTQYLPQ---NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTL 189
            + WD+ ++   L +   +     LTFD  GVSGH+NHI C  A   L +       L L
Sbjct: 124 KEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKT-----LFL 178

Query: 190 DSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYILAYSTMLNAH 249
            S   +LL KY+FF++D+ ++ +            +     F +  +QY+ A   M+ AH
Sbjct: 179 RS-ERNLLRKYSFFVLDVFRVVFG-----------TPPPTVFVSTLAQYLHALVAMVVAH 226

Query: 250 KSQVVWFRYGWWAFSRFVFSNH 271
           +SQ+VWFR+GWW  SR+V++N 
Sbjct: 227 RSQMVWFRWGWWMASRYVYANE 248

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  173 bits (439), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 98/225 (43%), Positives = 131/225 (58%), Gaps = 19/225 (8%)

Query: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112
           T++ LV+AHPDDEVMFF+PTL Q + L+P+SIPINV+C + GDA GLG  R+ EL  S+ 
Sbjct: 49  TSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLR 108

Query: 113 ALIQNQRQTNVTVLHFQDGNDQIWD----IDQMTQYLPQNDHQAFLTFDSHGVSGHKNHI 168
            +    RQ    VL F+DG D +WD      Q+   +P ++    LTFD  GVSGH NHI
Sbjct: 109 IMFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSN-PLVLTFDQFGVSGHINHI 166

Query: 169 ACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWN-LWKDQQQPQWESHD 227
           +C   V  L  ++     L L S    +  KY+ FI  + +L  + ++ D  +P+     
Sbjct: 167 SCGRLVEKLPYSHK----LHLRS-DQPIYVKYSAFIAGIFQLGISTVYPDYGKPR----- 216

Query: 228 KITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHL 272
              F +   QY+LA S M  AH SQ+VWFR GWW FSRF F N L
Sbjct: 217 --CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  165 bits (417), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 147/263 (55%), Gaps = 41/263 (15%)

Query: 54  TLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNG-DAQG--LGEKRQHELQSS 110
           +L+L+IAHPDDE+MFF+PTLLQL+N +   I  NV+C S G D+ G     +R HEL  S
Sbjct: 56  SLSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDS 115

Query: 111 IHALI------QNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH------QAFLTFDS 158
           ++ L       ++ R   +  L + DG  +IW++D +   L QN +         LTFD 
Sbjct: 116 LNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDK 175

Query: 159 HGVSGHKNHIACHNAVWNL---KNTNNNVTILTLDSIHHSLLAKYTFFIIDL-------- 207
            GVS HKNH+AC+ AV  L    N ++N+  + L+S   +   KY+FF+  L        
Sbjct: 176 SGVSNHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKF 235

Query: 208 ---VKLYWNLWKDQ----QQPQWESHDKI--------TFFNAYSQYILAYSTMLNAHKSQ 252
              + L+++         Q  Q  SH  +        TFFN +++Y+L+YSTMLNAH+SQ
Sbjct: 236 FRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQ 295

Query: 253 VVWFRYGWWAFSRFVFSNHLKIT 275
           +VWFRY WW FSRF F N L I 
Sbjct: 296 MVWFRYLWWIFSRFAFINDLTIV 318

>KNAG0D04450 Chr4 (805173..807233) [2061 bp, 686 aa] {ON} Anc_4.268
           YDL074C
          Length = 686

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 18/169 (10%)

Query: 36  FNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPT------LLQLDNLMPLSIPINVI 89
            N LN  + N  I HE     L +     +  +FA        L++  NL       N +
Sbjct: 442 LNELNSKKYNDLINHESVISKLTVEKTKADQKYFAAMRSKDSILIENKNLSKTLGKTNEL 501

Query: 90  CFSNGDAQGLGEK------RQHEL-QSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMT 142
                DA+ L ++      RQ +L Q++   LI + +  ++ ++     N QI  ++++T
Sbjct: 502 IVQLKDAEKLLQQKIDVLHRQLKLSQANEKRLIDSNKSESLKIIEL---NSQINKLEKLT 558

Query: 143 QYLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDS 191
           QY    D    L  +++ +   K      N    LK + N+ TI  L+ 
Sbjct: 559 QYYK--DENVNLLGETNRLQSAKERFEISNKTLELKASQNDQTITKLEE 605

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 11/96 (11%)

Query: 88  VICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ 147
           V   S+G   G  + +  +     +  ++  + TN+  + + DG  ++WD+   T  L  
Sbjct: 60  VTTLSDGLPPGASDAKGSKPAECTY--LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNF 117

Query: 148 NDHQAFLT---FDSHG---VSGHKNHIACHNAVWNL 177
           N H+A +T   FDS G   +SG K+    +  VW+L
Sbjct: 118 NGHKAAITLMQFDSTGTRLISGSKDS---NIIVWDL 150

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 91  FSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH 150
            S+G   G  + R  +     +  ++  + T++  + + DG  ++WD+   T  L  N H
Sbjct: 63  LSDGLPPGASDARGAKPAECTY--LEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 151 QAFLT---FDSHG---VSGHKNHIACHNAVWNL 177
           +A +T   FD  G   +SG K+    +  VW+L
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDS---NIIVWDL 150

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQA---FLTFDSHG---VSGHKN 166
           A ++   +TN+    + DG  +IWD+   T  +  N H A   FL FD  G   +SG ++
Sbjct: 80  AYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRD 139

>Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON}
           complement(19407..20762) [1356 nt, 452 aa]
          Length = 451

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 30/142 (21%)

Query: 50  HEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQS 109
           ++GT + LV+A  D     + P L+ L+N+             N     LG     E++S
Sbjct: 225 YQGTNM-LVVATDD-----YHPRLIDLNNM-------------NLGLTSLGNANNSEMKS 265

Query: 110 SIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQAFLTFDSHGVSGHKNHIA 169
            I     N ++TN+     ++G  ++WD       L +++ Q     D+  +SG+ +   
Sbjct: 266 PILCCKFNPQRTNIVATGDENGQVKLWD-------LRKSNRQLLELKDT--ISGNAHLRG 316

Query: 170 CHNAVWNLKNTNNNVTILTLDS 191
           C++  W+   T   +  + LD 
Sbjct: 317 CNDIEWD--ETGREIVTVGLDG 336

>NDAI0B03720 Chr2 (930486..934910) [4425 bp, 1474 aa] {ON} Anc_2.253
            YIL115C
          Length = 1474

 Score = 30.4 bits (67), Expect = 5.9,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 173  AVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFF 232
            +V ++ + +NN  I++++S +H + A+ +    ++  L    + DQ  PQ     K +  
Sbjct: 1217 SVSSIPHMSNNPVIISMESTYHLVTAELSVLFDNIENLN-KFFIDQSTPQLNKRTKKSIA 1275

Query: 233  NAYSQYILAYSTMLNAHKSQ 252
            N Y+  I   +T+ +  K +
Sbjct: 1276 NIYTWRIFEANTLYDILKEE 1295

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 115 IQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQAFLT---FDSHG---VSGHKNHI 168
           +Q+ ++TN+  + + DG  ++WD+   T     N H + +T   FD+ G   +SG ++  
Sbjct: 112 LQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRD-- 169

Query: 169 ACHNAVWNL 177
             +  VW+L
Sbjct: 170 -SNIIVWDL 177

>SAKL0F01342g Chr6 (112464..114347) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q753T2 Ashbya gossypii AFR244C AFR244Cp and
           some similarites with YGL228W uniprot|P53075
           Saccharomyces cerevisiae YGL228W SHE10 Putative
           glycosylphosphatidylinositol (GPI)-anchored protein of
           unknown function overexpression causes growth arrest
          Length = 627

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 111 IHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQAFLTFDSHG 160
           + +L+QN   +N T LHFQ  N  I DI+  T  + +N  Q F  FD HG
Sbjct: 315 MSSLLQNI--SNTTQLHFQKINKAILDIN-CTMEIGENGEQLF--FDRHG 359

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 91  FSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH 150
            ++G   G  + +  +L  S +  +Q   +TN+  + + DG  +IWD+   T  +  N H
Sbjct: 59  LTDGLPPGAVDAKSTKLAESTY--LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116

Query: 151 QAFLT---FDSHG---VSGHKN 166
           ++ +T   FD  G   +SG K+
Sbjct: 117 KSAITVLRFDPTGTRLISGSKD 138

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 91  FSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH 150
            S+G   G  + R  +     +  ++    T++  + + DG  ++WD+   T  L  N H
Sbjct: 63  LSDGLPPGASDARGSKPAECTY--LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 151 QAFLT---FDSHG---VSGHKNHIACHNAVWNL 177
           +A +T   FDS G   +SG ++    +  VW+L
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDS---NIIVWDL 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.134    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,860,964
Number of extensions: 1373156
Number of successful extensions: 4717
Number of sequences better than 10.0: 43
Number of HSP's gapped: 4761
Number of HSP's successfully gapped: 43
Length of query: 276
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 168
Effective length of database: 41,097,471
Effective search space: 6904375128
Effective search space used: 6904375128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 65 (29.6 bits)