Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C003708.847ON49549524370.0
NDAI0K003408.847ON6245526583e-78
ZYRO0G14322g8.847ON5504284201e-44
SAKL0D01298g8.847ON5514314052e-42
Kpol_1068.38.847ON5664903593e-36
KLTH0C03718g8.847ON5514323462e-34
TDEL0B005108.847ON5503983462e-34
Smik_13.4958.847ON5764483392e-33
Skud_13.4548.847ON5804153232e-31
Kwal_27.102248.847ON5464353117e-30
YMR282C (AEP2)8.847ON5803772923e-27
Suva_13.4718.847ON5813892923e-27
KAFR0B039708.847ON4744382876e-27
TPHA0I002908.847ON5694552897e-27
CAGL0M03069g8.847ON5484572329e-20
KLLA0D01408g8.847ON5184072194e-18
KNAG0J002308.847ON4743822141e-17
Ecym_46188.847ON5273911892e-14
TBLA0B033108.847ON6132321812e-13
ABL119C8.847ON5373901036e-04
CAGL0G00924g4.165ON119689830.18
KLTH0G17952g4.165ON107569770.91
TPHA0O010901.506ON1053126732.4
Kwal_23.29492.191ON161763732.8
KLLA0E04291g7.212ON26548695.2
TPHA0N009105.237ON509116705.7
Smik_11.2412.653ON176693706.9
TPHA0E013205.319ON135752698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00370
         (495 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   943   0.0  
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   258   3e-78
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   166   1e-44
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   160   2e-42
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   142   3e-36
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   137   2e-34
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   137   2e-34
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   135   2e-33
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   129   2e-31
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   124   7e-30
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   117   3e-27
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   117   3e-27
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   115   6e-27
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   115   7e-27
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    94   9e-20
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...    89   4e-18
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...    87   1e-17
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...    77   2e-14
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...    74   2e-13
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    44   6e-04
CAGL0G00924g Chr7 complement(80770..84360) [3591 bp, 1196 aa] {O...    37   0.18 
KLTH0G17952g Chr7 (1555700..1558927) [3228 bp, 1075 aa] {ON} som...    34   0.91 
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...    33   2.4  
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    33   2.8  
KLLA0E04291g Chr5 (388682..389479) [798 bp, 265 aa] {ON} some si...    31   5.2  
TPHA0N00910 Chr14 (197403..198932) [1530 bp, 509 aa] {ON} Anc_5....    32   5.7  
Smik_11.241 Chr11 complement(398581..403881) [5301 bp, 1766 aa] ...    32   6.9  
TPHA0E01320 Chr5 complement(263113..267186) [4074 bp, 1357 aa] {...    31   8.0  

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/495 (94%), Positives = 466/495 (94%)

Query: 1   MNHGXXXXXXXXXXXXXXXXXTSRALNSPASSIANATSKEPTISISMDKGTIASNSRVRF 60
           MNHG                 TSRALNSPASSIANATSKEPTISISMDKGTIASNSRVRF
Sbjct: 1   MNHGRIIITRRIPPLRRGLGTTSRALNSPASSIANATSKEPTISISMDKGTIASNSRVRF 60

Query: 61  SSTLLKKNEFNKYEHFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKDSDV 120
           SSTLLKKNEFNKYEHFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKDSDV
Sbjct: 61  SSTLLKKNEFNKYEHFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKDSDV 120

Query: 121 NVNVVFQLFEIYARMYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGI 180
           NVNVVFQLFEIYARMYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGI
Sbjct: 121 NVNVVFQLFEIYARMYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGI 180

Query: 181 ENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADL 240
           ENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADL
Sbjct: 181 ENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADL 240

Query: 241 VLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGLLYPDTNNIIAIIT 300
           VLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGLLYPDTNNIIAIIT
Sbjct: 241 VLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGLLYPDTNNIIAIIT 300

Query: 301 SYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFILGQCWSLM 360
           SYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFILGQCWSLM
Sbjct: 301 SYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFILGQCWSLM 360

Query: 361 EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKF 420
           EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKF
Sbjct: 361 EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKF 420

Query: 421 VFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFXXXXXXXXXXXXSNQYDDLQRK 480
           VFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYF            SNQYDDLQRK
Sbjct: 421 VFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFENKREKRKKNKRSNQYDDLQRK 480

Query: 481 YDEMDEEDMIIGKLW 495
           YDEMDEEDMIIGKLW
Sbjct: 481 YDEMDEEDMIIGKLW 495

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  258 bits (658), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 185/552 (33%), Positives = 280/552 (50%), Gaps = 86/552 (15%)

Query: 27  NSPASSIANATSKEPTISISMDKGTIASNSRVRFSSTLLKKNEFNKY-----EHFLRGGR 81
           N+      N   K+P I  S+      S +R      LL + +  K      +H L    
Sbjct: 76  NTKKRYTFNPKKKQPLIRTSLKPTIHNSKARKGLLHLLLAQKDNGKVLTTILDHCLYSPN 135

Query: 82  IKDLISMILNPMVSIHEHFTLEEYSLFLGKVL-------SMKDSDVNVN----------V 124
            +     ++     +    + EE S+F+ +VL       S K  ++  N          V
Sbjct: 136 EQATTRQLVKENNHLTTLLSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEV 195

Query: 125 VFQLFEIYARMYCGE-GSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENM 183
           +F LF I    YC     LN L +YDLN+ IKYF++  QLK+ Q+VLD+II ++GGIE +
Sbjct: 196 IFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQL 255

Query: 184 IAHRDLISLNNHLKLKNGSLVKDWK--FEGKNLRYLQSR----------QGRLNYKFLDG 231
           I  +DL +L+NHLKLKNG++ K+WK   + ++  +LQ R          +G  NYKFLDG
Sbjct: 256 IKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDG 315

Query: 232 WSLLKIADLVLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGL---- 287
           WSLLKI D+VL D   C N+L  SI+YSLG LRQ+E ++HFI Q+W  +  P + +    
Sbjct: 316 WSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQIW--DVHPDDAVEERN 373

Query: 288 -------LYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILEKY-----SGLKFDKFFWRR 335
                  L PDTN +IAI+TSYC  Y +MD++F +LD++++KY     S L  D  FW +
Sbjct: 374 HQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNKFWIK 432

Query: 336 LFQWCI-LTEPNAN--KGFILGQCWSLME-------KQEKVE-------FDGVLLELLRE 378
           + QW I + + N N   G  +  C  +ME       K+  +E       +  +L+ LL  
Sbjct: 433 MLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHN 492

Query: 379 KIVKVRDVPLALRVLKMIVIELK--KVNFINELDM-ELLLKYQKFVFSKLGEINKTVKAM 435
            + + ++V + L+ ++  V +LK   VN   E ++  +L   QK +F K+ E     K +
Sbjct: 493 IMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGL 552

Query: 436 ELLSCDDYTINKENKAFMRAYYFXXXXXXXXXXXXSN------------QYDDLQRKYDE 483
            L+    YT N   ++ +R YY              N            +++ LQ+KYDE
Sbjct: 553 ALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDE 612

Query: 484 MDEEDMIIGKLW 495
           ++EE MIIGKLW
Sbjct: 613 IEEEGMIIGKLW 624

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  166 bits (420), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/428 (29%), Positives = 219/428 (51%), Gaps = 36/428 (8%)

Query: 100 FTLEEYSLFLGKVLSMKDSDV----------NVNVVFQLFEIYARMYCGEGSLNALQIYD 149
            T  EYSLF+ K+LS ++ DV          +  ++++L+E Y      + +L  LQ+YD
Sbjct: 127 LTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLTPLQLYD 186

Query: 150 LNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKF 209
           LN  +K FI   QL +   VLDFI+++   + +++A+ D+  L   L+LK G+L K WK 
Sbjct: 187 LNLFLKTFIAEAQLSKAHNVLDFILLR-RPLNDLLANTDVEILIQFLRLKCGALSKFWKI 245

Query: 210 EGKNLR-----YLQSRQGRLN----YKFLDGWSLLKIADLVLND---PMKCQNVLTNSII 257
           +  + R      L  +    +    YKF +   LL+I + VL +     +    L  +II
Sbjct: 246 QPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAII 305

Query: 258 YSLGHLRQVELLDHFIDQMWMQETRPRNGLLYPDTNNIIAIITSYCYNYGNMDKSFDVLD 317
           YSLG+L Q +L++ ++++ W   ++       P+++ ++A++TSYC   GNM K  +VLD
Sbjct: 306 YSLGYLGQTDLIEKYVNRTW-SPSKDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGLEVLD 364

Query: 318 RILEKYSGLKFDKFFWRRLFQWCILT--EPNANKGFILGQCWSLM-----EKQEKVEFDG 370
           R +  Y  ++ D  FWRRL Q   L   +    K  +   CW++M     ++Q K+ +D 
Sbjct: 365 RFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDY 424

Query: 371 VLLELLREKIVKVRDVPLALRVL-KMIVIELKKVNF-INELDMELLLKYQKFVFSKLGEI 428
            +++ L    V+ ++   AL V+ K       +  F I   ++ LL KYQ+F+   +   
Sbjct: 425 GIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALK 484

Query: 429 NKTVKAMELLSCDDYTINKENKAFMRAYYFX-XXXXXXXXXXXSNQYDDLQRKYDEMDEE 487
               K  E   C +++ +  NK  +++Y+              S Q   LQ KYDEM+E+
Sbjct: 485 GNYHKGFEF--CQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEMEED 542

Query: 488 DMIIGKLW 495
           DM++G+LW
Sbjct: 543 DMLLGRLW 550

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  160 bits (405), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 125/431 (29%), Positives = 215/431 (49%), Gaps = 51/431 (11%)

Query: 104 EYSLFLGKVLS----------MKDSDVNVNVVFQLFEIYARMYCGEGSLNALQIYDLNKL 153
           EYS+F+ K+LS          +    V+  V+F+L+EIY     G  +L  +Q+YDLN+ 
Sbjct: 133 EYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQF 192

Query: 154 IKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFE--- 210
           IK F    QL + Q VL F++  YG I      RD  +L N+L+LK G++ ++W      
Sbjct: 193 IKRFTGDAQLAKAQQVLGFVLENYGSIP-----RDPQTLINYLELKCGAMPRNWSIPLSR 247

Query: 211 ---GKNLRYLQSRQGRL--NYKFLDGWSLLKIADLVLNDPM---KCQNVLTNSIIYSLGH 262
              GK L   QS    L  +YK L+  +LL + D ++ D     K    L  ++IYSLG+
Sbjct: 248 PELGKTLGS-QSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGY 306

Query: 263 LRQVELLDHFIDQMW---------MQETRPRNGLLYPDTNNIIAIITSYCYNYGNMDKSF 313
           + Q  LL+ +I   W          +   P+N  LYP +N +I+I++ Y    GN+ ++ 
Sbjct: 307 MGQFALLERYIKHTWGVSVSSNTSTEVEVPKN--LYPTSNLLISIVSCYAMK-GNLHQAL 363

Query: 314 DVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQCWSLMEKQEKVEFDGV 371
            ++D  L K+  ++ +  FWRRLFQW   +  +    KG +   CW +M++    +   +
Sbjct: 364 QIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSL 423

Query: 372 LLEL--LREK---IVKVRDVPLALRVLKMIVIEL-KKVNFINELDMELLLKYQKFVFSKL 425
            ++L  L E+   + +  +   ALR+    +  L  K N I+  +++++ K+QK +  K+
Sbjct: 424 PIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDP-EVDVIKKFQKLILKKM 482

Query: 426 GEINKTVKAMELLSCDDYTINKENKAFMRAYYFXXXXXXXXXXXXSNQ-YDDLQRKYDEM 484
                  K ++ +S  ++ +NK N+  MR Y+               Q  +  Q  +D  
Sbjct: 483 AGRGYYHKPLKYIS--EWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAE 540

Query: 485 DEEDMIIGKLW 495
           +E+DM++G+LW
Sbjct: 541 EEDDMLLGRLW 551

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  142 bits (359), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 128/490 (26%), Positives = 220/490 (44%), Gaps = 70/490 (14%)

Query: 65  LKKNEFNKYE-HFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKDSDVN-- 121
           LK NE +K+  H L   R  D    + N   S     T  E S+F+ ++      D+   
Sbjct: 88  LKNNEIDKFTLHLLASLRGDD--DFVKNLFKS--GDLTYNELSIFINRIYKSNGHDIKRV 143

Query: 122 ---------VNVVFQLFEIYARMYCGEGS---LNALQIYDLNKLIKYFIKRDQLKQGQIV 169
                      +++++FE+Y      E     LNAL + DLN  I  FIK  QL + Q V
Sbjct: 144 IQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNV 203

Query: 170 LDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNYKF- 228
           L +II   G IE +  H  ++   N L+L+ G L K W     +  Y  ++Q + N +  
Sbjct: 204 LQYIIDAEGSIEKITDHDTMV---NFLRLRCGGLPKFWLVPQAS--YAVTKQTKKNSRLS 258

Query: 229 ---------------LDGWSLLKIADLVLNDPM---KCQNVLTNSIIYSLGHLRQVELLD 270
                          +    L ++ +++LN  +   K   +L ++I+YSL H  Q +++D
Sbjct: 259 SNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQMMD 318

Query: 271 HFIDQMWMQET---------RPRNGLLYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILE 321
            FI + W   +         + +     P    +IAI++SY Y   N+D +  +LD+ + 
Sbjct: 319 GFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIR 378

Query: 322 KYSGLKFDKFFWRRLFQWC-ILTEPNANKGFILG-QCWSLME--------KQEKVEFDGV 371
            Y  +  D  FWRRL QWC  L +P  ++    G  CW++M+        K   + +D  
Sbjct: 379 MYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQ 438

Query: 372 LLELLREKIVKVRDVPLALRVLKMIVI-ELKKVNF-INELDMELLLKYQKFVFSKLGEIN 429
           + E       +  +  +A  ++  ++I  L + N  + + ++ LL KYQ    + L E  
Sbjct: 439 IYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERR 498

Query: 430 KTVKAMELLSCDDYTINKENKAFMRAYYFXXXXXXXXXXXXSNQYDDLQRK----YDEMD 485
           +  KA   +  ++++I++ N+  +R  +              ++    Q+K    YDEM+
Sbjct: 499 QFKKAAFFI--EEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDEME 556

Query: 486 EEDMIIGKLW 495
           EEDMIIG+LW
Sbjct: 557 EEDMIIGRLW 566

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  137 bits (346), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 207/432 (47%), Gaps = 45/432 (10%)

Query: 100 FTLEEYSLFLGKVLSMKD-----SDVNVNV-----VFQLFEIYARMYCGEGSLNALQIYD 149
            ++ E+S F+  +LS+ +     S    NV     VF L+++Y +     G L+ LQ++D
Sbjct: 129 LSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKT-VTPGPLSPLQLHD 187

Query: 150 LNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKF 209
            NK I++FI+  QL++ Q VLD I+       N     D  +  ++L+L+ G+L ++WK 
Sbjct: 188 FNKFIRFFIRSAQLRKAQTVLDCILKS----NNNQLPCDSATATHYLQLRCGALPRNWKV 243

Query: 210 EGKNL---RYLQSRQGRL-----NYKFLDGWSLLKIADLVLNDP-----MKCQNVLTNSI 256
             +NL     L +R+ R      +YK LD  S+L    L L+DP      +    L +++
Sbjct: 244 LDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSL-LSDPKSVWFHRKSAALESAV 302

Query: 257 IYSLGHLRQVELLDHFIDQMWMQETRPRN-----GLLYPDTNNIIAIITSYCYNYGNMDK 311
           +YSLG + Q++LL+  + + W    +  N         P +  ++A++TSY  N  N+  
Sbjct: 303 VYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASN-KNISS 361

Query: 312 SFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQCWSLME-----KQE 364
           +  ++D  + KY  L+ D  FWRRLFQW   + +E    +G +   CW +M      +  
Sbjct: 362 ALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARNR 421

Query: 365 KVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKFVFSK 424
           ++  D VLL      + +  +   A+ V++       +   ++  +  L  K+ K +   
Sbjct: 422 QLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILKN 481

Query: 425 LGEINKTVKAMELLSCDDYTINKENKAFMRAYYFXXXXX-XXXXXXXSNQYDDLQRKYDE 483
           +  +    K ++ +   +++ NK  +  +RAY+              +      Q+++D+
Sbjct: 482 MAHLGYYHKPLKFI--KEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDD 539

Query: 484 MDEEDMIIGKLW 495
            +E+ M++G+LW
Sbjct: 540 EEEDSMLLGRLW 551

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  137 bits (346), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/398 (25%), Positives = 191/398 (47%), Gaps = 25/398 (6%)

Query: 120 VNVNVVFQLFEIYARMYC--GEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKY 177
           V+  ++F L++IY        +  L  LQ++D+N+ IK FI   QLK+ Q  L F+I K 
Sbjct: 156 VHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDK- 214

Query: 178 GGIENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRL----NYKFLDGWS 233
            G+ N++   D+ ++   L+L+ G+L K W+ +  + + L           +Y  L    
Sbjct: 215 QGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQP 274

Query: 234 LLKIADLVLNDP---MKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGL--- 287
            L+I + +L D    ++   ++ ++I+YSL +L Q +L+D +I   W         +   
Sbjct: 275 FLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNE 334

Query: 288 LYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILT--EP 345
             P    +I I+++YC   G+  K   +LD+ ++KY   + +K FWRRL Q       + 
Sbjct: 335 AVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQ 394

Query: 346 NANKGFILGQCWSLM-----EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIV--I 398
              K  +   CW++M     +K   + +D   L LL +     R+   A  V++     +
Sbjct: 395 KDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSV 454

Query: 399 ELKKVNFINELDMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYF 458
             K+   I++ +M+LLL +QK     +    +  + ++L+   ++ ++K N+ ++  Y+ 
Sbjct: 455 YAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIK--EWNVDKINQHYLLDYFM 512

Query: 459 XXXXXX-XXXXXXSNQYDDLQRKYDEMDEEDMIIGKLW 495
                          +    Q +YD M+EEDM++G+LW
Sbjct: 513 RHRRKYDLTRDKARAKQQQQQAQYDNMEEEDMLLGRLW 550

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 123/448 (27%), Positives = 212/448 (47%), Gaps = 55/448 (12%)

Query: 100 FTLEEYSLFLGKVLSMK------DSDVNVNVV---FQLFEIYARMYCGE--------GSL 142
            +L E S  L K+ S++        D+ V      F++F +YA     +         +L
Sbjct: 132 LSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAKRNHINLRNTTL 191

Query: 143 NALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGS 202
           +A +I+D+N LI+ FI+  QL + Q +L FII +   I     + D+ ++ + LKL+ G+
Sbjct: 192 DACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLRCGA 251

Query: 203 LVKDWKF---EGKNLRYLQS--RQGRLN--------YKFLDGWSLLKIADLVLNDP--MK 247
           L   WK     G++ + L+   R G  N        YK +D  +LLKIADLVL++   + 
Sbjct: 252 LAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVLHEKRFLN 311

Query: 248 CQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQET---------RPRNGLLYPDTNNIIAI 298
            +++L+ ++I S GHL Q ++L+  I+ +W   T         +PR    YP +  +I+I
Sbjct: 312 SEDLLS-TLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRG--CYPSSKILISI 368

Query: 299 ITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQC 356
           + S+ YN  ++ +   +LD  ++ Y  +K D  FWRRLFQ      T     K   + +C
Sbjct: 369 LVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATSVIRC 428

Query: 357 WSLME-----KQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDM 411
           W LM+     K   +  D   L  L + + K  + PL + VLK     ++++   N   +
Sbjct: 429 WHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDKL 488

Query: 412 EL-LLKYQKFVFSKLGEINKTVKAMELLS--CDDYTINKENKAFMRAYYFXXXXXXXXXX 468
            + L+KYQK++  +L +  +     E ++    D TI K    F                
Sbjct: 489 NIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTNRLLLRSKKNKSKI 548

Query: 469 XXSNQYDDLQRK-YDEMDEEDMIIGKLW 495
               + + L+   +D+ +++ MIIG LW
Sbjct: 549 ENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  129 bits (323), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 120/415 (28%), Positives = 196/415 (47%), Gaps = 50/415 (12%)

Query: 126 FQLFEIYA--------RMYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKY 177
           F+LF +YA        ++     +L++ +I+DLN LIK FI+  QL + Q +L FI+ + 
Sbjct: 171 FKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRN 230

Query: 178 GGIENMIAHRDLISLNNHLKLKNGSLVKDWKF---EGKNLRYLQS--RQGRLN------- 225
             I     + D+ ++ + L+L+ G+L   WK     G+    L+   R G  N       
Sbjct: 231 PDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSS 290

Query: 226 -YKFLDGWSLLKIADLVLNDP--MKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWM---Q 279
            YK +D  +LLKIADLVL D   +  +++L+ ++I S GHL Q ++L+  I+ +W    Q
Sbjct: 291 TYKAMDHQTLLKIADLVLQDKRFLNSEDLLS-TLIQSFGHLGQTQILERCIEHIWQISSQ 349

Query: 280 E------TRPRNGLLYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFW 333
           E       +PR    YP +  +I+I+ S+  N  ++ +   +LD  ++ Y  +K D  FW
Sbjct: 350 EFPSHVAIKPRG--CYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFW 407

Query: 334 RRLFQWC--ILTEPNANKGFILGQCWSLME-----KQEKVEFDGVLLELLREKIVKVRDV 386
           RRL Q      T  N  +   + +CW LM+     K+     D   L  L E + K  + 
Sbjct: 408 RRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNF 467

Query: 387 PLALRVLKMIVIELKKVNFINELDME-LLLKYQKFVFSKLGEINKTVKAMELLSCDDYTI 445
            L + VLK     ++K+   N   +E +L+KYQK +  +L    K   A + +   D+  
Sbjct: 468 SLGIDVLKSFKSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIG--DFGF 525

Query: 446 N----KENKAFMRAYYFXXXXXXXXXXXXSNQYDDLQR-KYDEMDEEDMIIGKLW 495
           N    K+   F     F              + D L    YD+ +++ MIIG LW
Sbjct: 526 NRRAAKDLNIFCSNRIFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  124 bits (311), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 117/435 (26%), Positives = 199/435 (45%), Gaps = 51/435 (11%)

Query: 100 FTLEEYSLFLGKVLSMKD----------SDVNVNVVFQLFEIYARMYCGEGSLNALQIYD 149
            T  E+S  L  +L+ ++          S  +  ++F L++ Y  M    GSLN LQ++D
Sbjct: 124 LTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL-MTIPAGSLNPLQLHD 182

Query: 150 LNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWK- 208
           LN  ++YFI+  QL + QIVLD I+       N     D  +  ++L+L+ G+L ++WK 
Sbjct: 183 LNSFVQYFIETAQLGKAQIVLDRILAS----NNDQLPCDTTTGIHYLQLRCGALPRNWKV 238

Query: 209 FE---GKNLRYLQSRQGRL----NYKFLDGWSLLKIADLVLNDP-----MKCQNVLTNSI 256
           F+   G + R    R         YK LD  S+L+  + VLND       K    L  ++
Sbjct: 239 FDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDENSEWFHKKSPTLEAAV 297

Query: 257 IYSLGHLRQVELLDHFIDQMW-----MQETRPRNGLLYPDTNNIIAIITSYCYNYGNMDK 311
           IYSLG + Q+ LL   I   W               + P    +IAI TS+  ++  +  
Sbjct: 298 IYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFA-SHQEVTL 356

Query: 312 SFDVLDRILEKYSGLKFDKFFWRRLFQWCIL-----TEPNANKGFILGQCWSLMEK---- 362
              ++D  + KYS +  D  FWRRLFQW  L     T+P   +G +   CW +M +    
Sbjct: 357 GLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDP---RGDLSRGCWRVMTEWHEK 413

Query: 363 -QEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKFV 421
             +K++ D  LL      + +  +   AL V+     +L +   ++  +M ++ KY K V
Sbjct: 414 GSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLV 473

Query: 422 FSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFXXXXX-XXXXXXXSNQYDDLQRK 480
              + E+    K +  ++  +++ NK  +  +R Y+                +    Q  
Sbjct: 474 LKSMAELGYYHKPLTFIT--EWSPNKAVEDSLRVYFKKHRDGFTKRKERLREESRRKQNT 531

Query: 481 YDEMDEEDMIIGKLW 495
           YD+ +E++M++G+LW
Sbjct: 532 YDDEEEDNMLLGRLW 546

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 99/377 (26%), Positives = 181/377 (48%), Gaps = 56/377 (14%)

Query: 100 FTLEEYSLFLGKVLSMK------DSDVNVNVV---FQLFEIYA--------RMYCGEGSL 142
            +LE+ S  L K+ + +        D+N       F+LF +YA        ++      L
Sbjct: 136 LSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTKL 195

Query: 143 NALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGS 202
           +A +I+D N +IK FI+  QL + Q +L FI+ +   I     + D+ ++ + L+L+ G+
Sbjct: 196 DACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCGA 255

Query: 203 LVKDWKFEGKNLRYLQSRQGRL-----------------NYKFLDGWSLLKIADLVLNDP 245
           L   WK    +    + +QG L                  YK +D  +LLKIADL L + 
Sbjct: 256 LAPYWKIPDNS----EQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQEK 311

Query: 246 --MKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETR--PRNGLL-----YPDTNNII 296
             +  +++L+ ++I S GHL Q ++L+  I+ +W    +  P + ++     YP +  ++
Sbjct: 312 KLLNSEDLLS-TLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKILV 370

Query: 297 AIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILG 354
           +I+ S+ +N  ++ +   +LD  ++ Y  +K D  FWRRLFQ      T  N  K   + 
Sbjct: 371 SILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVV 430

Query: 355 QCWSLME-----KQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINEL 409
           +CW LM+     K+ +   D   L  L + + K  + PL + VL+     +++    N  
Sbjct: 431 RCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAG 490

Query: 410 DM-ELLLKYQKFVFSKL 425
            +  +++KYQK +  +L
Sbjct: 491 KVNNIIIKYQKCIIKEL 507

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 101/389 (25%), Positives = 189/389 (48%), Gaps = 48/389 (12%)

Query: 98  EHFTLEEYSLFLGKVLSMK------DSDVNVNVV---FQLFEIYA--------RMYCGEG 140
           E  +LE+ S  L  + S +        D+NV      F+LF +YA        ++     
Sbjct: 135 ETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAEKVDVKRNQINLRNT 194

Query: 141 SLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKN 200
           +L++ +I+D+N +IK FI+  QL + Q VL FI+ +   I     + D+ ++ + L+L+ 
Sbjct: 195 ALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRC 254

Query: 201 GSLVKDWKFEGKNLRYLQSRQGRL-----------NYKFLDGWSLLKIADLVLNDP--MK 247
           G+L   WK    + +    +  RL           +YK +D  +LLKIADLVL     + 
Sbjct: 255 GALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKERLLN 314

Query: 248 CQNVLTNSIIYSLGHLRQVELLDHFIDQMW---MQE------TRPRNGLLYPDTNNIIAI 298
            +++L+ ++I S GHL Q ++L+  I+ +W   +QE       +P+     P +  +I+I
Sbjct: 315 SEDLLS-TLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISI 373

Query: 299 ITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQC 356
           + S+  N  ++ +   +LD  ++ Y  +K D+ FWRRLFQ      T  +  +   + +C
Sbjct: 374 LVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIVRC 433

Query: 357 WSLMEKQEK-----VEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDM 411
           W LM++  +     +  D   L  L +   K  +  L + VL+     + + + +    +
Sbjct: 434 WHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAMKTEKI 493

Query: 412 E-LLLKYQKFVFSKLGEINKTVKAMELLS 439
             +++K+QK++  +L    KT  A E ++
Sbjct: 494 NGIVIKHQKYIIKQLVNRGKTSAAREFIN 522

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  115 bits (287), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 107/438 (24%), Positives = 197/438 (44%), Gaps = 45/438 (10%)

Query: 77  LRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKDS-----DVNVNVVFQLFEI 131
           LR    K+L + I   + S+H    L  ++  +   LS K +     +    ++FQLFE 
Sbjct: 63  LRIKTPKELDAEIQEIITSMHATIDLNRFARLINIALSEKYNIQRIKERRPEIIFQLFET 122

Query: 132 YARMYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLIS 191
           Y ++      L  LQ+ D+NK I YF++  QLK+ Q+V+ ++I+K   +   +   D+ +
Sbjct: 123 YVKLISSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRV---LEKYDVST 179

Query: 192 LNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLD--GWSLLKIADLVLNDPMKCQ 249
             N+LKL  G+  + W                 NYK  D    +L K+    L++ +   
Sbjct: 180 TRNYLKLNCGACHELW---------------YTNYKIFDFNNTTLDKLVKYSLDNKIGYW 224

Query: 250 NVLTNSIIYSLGHLRQVELLDHFIDQMW----MQETRPRNGLLYPDTNNIIAIITSYCYN 305
           +V    II+SLG+  ++  L+ +I + W        +       P++  + AII  + Y 
Sbjct: 225 DV---EIIHSLGYSGRIRSLEDYILKKWGISLCDRAQVNTTNEAPESEVLEAIINGFFYR 281

Query: 306 YGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCI--LTEPNANKGFILGQCWSLMEK- 362
              M ++  +L+  +  Y  L     FW+     CI    E    KG ++ + W  M++ 
Sbjct: 282 DKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRW 341

Query: 363 ----QEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELK-KVNFINELDMELLLKY 417
                 ++ F+   L+++R    K  ++ LA  + +            +N+ ++ ++ +Y
Sbjct: 342 YTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCATRMNDSELNVIKEY 401

Query: 418 QKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFXXXXXXXXXXXXSNQYDDL 477
           Q F+ S+L E      A+  +  +D+  + ENK  +  YY             +   ++L
Sbjct: 402 QNFILSRLIEKKGFSNALTFI--NDHCFSLENKRQLMNYYHGRKEHKLKKMTRN---ENL 456

Query: 478 QRKYDEMDEEDMIIGKLW 495
           ++ YD+M EED IIGKLW
Sbjct: 457 EKTYDDMVEEDFIIGKLW 474

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  115 bits (289), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 109/455 (23%), Positives = 215/455 (47%), Gaps = 63/455 (13%)

Query: 98  EHFTLEEYSLFLGKVLSMK----DSDV--------NVNVVFQLFEIYARMYCGEGSLNAL 145
           +  T  E+S+FL +++  K    DS V        +  +VF+LF++Y     G   L+ L
Sbjct: 121 KQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNA-IGSDKLSLL 179

Query: 146 QIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVK 205
            + D+N  I++FI    L + +IVL F++ K   I ++    D+ ++ ++L+L+ G+L +
Sbjct: 180 SLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY---DVDTVTHYLQLRCGALPR 236

Query: 206 DWKFE------------GKNLRYLQSRQGRLN--------YKFLDGWSLLKIADLVLNDP 245
            W F+            G  L   ++R GR N        YK LD   +LKIA+ ++ D 
Sbjct: 237 YWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDD 296

Query: 246 MKCQN---VLTNSIIYSLGHLRQVELLDHFIDQMWMQE-----------TRPRNGLLYPD 291
               N    L  +++YSL +  Q+  +  +I+  W  +           T+  N    P 
Sbjct: 297 KWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPL 356

Query: 292 TNNII-AIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNA--N 348
            + ++ AI++SY Y+  +++++ +++D+I+  Y  L+ ++ FWRRL QW +L   +    
Sbjct: 357 PSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDR 416

Query: 349 KGFILGQCWSLMEKQE-----KVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIEL--K 401
           KG ++  C+  ++K       ++ FD  LL+ L   +   ++  +A  V+   + +   K
Sbjct: 417 KGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYK 476

Query: 402 KVNFINELDMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFXXX 461
           + + I   + +LL  +QK     +        A   +  + ++++ +NK  +  YY    
Sbjct: 477 RSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFI--EKWSMDNQNKEELFKYYKDSI 534

Query: 462 XXXXXXXXXSNQYDDLQRKY-DEMDEEDMIIGKLW 495
                    ++    ++ K  D  DE+D ++G+LW
Sbjct: 535 AKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 94.0 bits (232), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 105/457 (22%), Positives = 208/457 (45%), Gaps = 51/457 (11%)

Query: 80  GRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKD--SDVNVNVVFQLFEIY---AR 134
           G ++D I ++ +  VSI      +E+S  +  VL+  +     ++  + +L +IY    R
Sbjct: 102 GSVEDAIQLLQDSNVSI------QEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTR 155

Query: 135 MYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYG--GIENMIAHRDLISL 192
            + G GS++AL   D+NK IK FI+  QLK+ Q  L F++  Y   G + +  + D  ++
Sbjct: 156 THNG-GSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTI 214

Query: 193 NNHLKLKNGSLVKDWKFE---GKNLRYL------QSRQGRLNYKFLDGWSLLKIADLVL- 242
            + L L++G+L   WK +   G N +          R  +  Y  LD   L +I   +L 
Sbjct: 215 AHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILR 274

Query: 243 -ND------PMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQE--TRPRNGLLYPDTN 293
            ND      P+     +  ++I  LG++ Q  L++  I+++W  +  + P    +   ++
Sbjct: 275 YNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSD 334

Query: 294 NIIAIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFI- 352
            + AI+++Y     ++     + D+   K   +     FW  L +W I+  PN  +  I 
Sbjct: 335 LLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIIL-PNKWRSTID 393

Query: 353 -LGQCWSLMEK-----------QEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIEL 400
              + W LM+               VEF  ++ ++L    +K++D+     + +  ++ L
Sbjct: 394 LSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTL 453

Query: 401 KKVNFINELDMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFXX 460
              N +   +++LL K+Q F   K+       K ++ +   +++ +  NK  +   +   
Sbjct: 454 YSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIK--EWSYDAANKQQLTNLFVVL 511

Query: 461 XXXXXXXXXXSNQYD--DLQRKYDEMDEEDMIIGKLW 495
                     + + +   +Q+KYDE ++EDM++G LW
Sbjct: 512 RNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 100/407 (24%), Positives = 186/407 (45%), Gaps = 61/407 (14%)

Query: 97  HEHFTLEEYSLFLGKVLSMKDSDVNV-------NVVFQLFEIYARMYCGEGSLNALQIYD 149
           +E  T E+YS+F+ +++ +   D+ +         ++ ++ ++      +G  NA+ +YD
Sbjct: 94  NEKLTPEDYSVFVNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDG--NAMVLYD 151

Query: 150 LNKLIKYFIKRDQLKQGQIVLDFII--MKYGGIENMIAHRDLISLNNHLKLKNGSLVKDW 207
           LN+ ++ FI  + L   + V   I+   K G I      +D+ ++  +L+L  G+L + W
Sbjct: 152 LNQFVRMFINLNDLPLARNVFQLILKNSKNGEIP-----KDVQTICMYLRLYCGALSELW 206

Query: 208 --------------KFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADLVLNDP--MKCQNV 251
                            G N   ++     + Y  +       +   ++ DP   K +N 
Sbjct: 207 TTQTSRNFYQDLIGSLSGSNASSIRI-PSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNT 265

Query: 252 LTNS-IIYSLGHLRQVELLDHFI-------DQMWMQETRPRNGLLYPDTNNIIAIITSYC 303
             +S II +LGH ++V  L  +I       + + + ET P    L PD+  + ++I++Y 
Sbjct: 266 EMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYG 325

Query: 304 YNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNA---NKGFILGQCWSLM 360
           +N  N+     V+   +EKY  +  DK FWR    W  L E N    +KG    + W+LM
Sbjct: 326 HN-NNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWS-LREWNKYKDSKGSQPKKAWNLM 383

Query: 361 -----EKQEKVEFDGVLLELLREKIVKVR-DVPLALR----VLKMIVIELKKVNFINELD 410
                   + V FD  ++ L R   +K R D   A+R    V K I I+ +K  FI  ++
Sbjct: 384 LNWYATIGKAVPFDQKIM-LYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFI--VE 440

Query: 411 MELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYY 457
             +L  YQ+F+   L   N+  K ++ +  +++ I+ EN  ++  Y+
Sbjct: 441 RLVLYAYQRFIIKNLVNQNENAKCVDFI--NEWRIDFENGRYLERYF 485

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 89/382 (23%), Positives = 168/382 (43%), Gaps = 50/382 (13%)

Query: 101 TLEEYSLFLGKVLSMK-----DSDVNVNVVFQLFEIY-ARMYCGEGSLNALQIYDLNKLI 154
           T  ++S+ L +VL+ +     DS  NV   F +F  Y   +      L  +Q++D N + 
Sbjct: 86  TAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNLMC 145

Query: 155 KYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNL 214
            YFI  +QLK+ Q+++DF++ +           D+  + N+ KL+ GS         K  
Sbjct: 146 DYFIACNQLKKAQLIMDFLLQQDVKF-------DVFMIKNYTKLRCGSSFGKQTLNNK-- 196

Query: 215 RYLQSRQGRLNYKFLDGWSLLKIADLVLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFID 274
                      YK  D  ++ ++   V  D  +      N I+ SLG+   + L++ +I 
Sbjct: 197 ----------AYKVFDQNTVFQLIGKVEAD--RKFAFWNNEIVSSLGYTNNITLMEIYIW 244

Query: 275 QMW---MQETRPRN---------GLLYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILEK 322
            +W   + +    N           +YP +  +  I++SY  +   M ++ D+++R  + 
Sbjct: 245 DLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKS 304

Query: 323 YSGLKFDKFFWRRLFQWCILTEPNANKGFILGQCWSLMEKQEK-----VEFDGVLLELLR 377
           Y  L  +  FW  L    I    + +    L  CW+LM+K        + F   LL  + 
Sbjct: 305 YPKLLLNVHFWSTLLNCAIKCGGSKDPSQFLA-CWNLMKKWHTQRSKLMPFQSALLVTIL 363

Query: 378 EKIVKVRDVPLALRVLKMIV--IELKKVNFINELDMELLLKYQKFVFSKLGEINKTVKAM 435
             + +  ++   + +L+  +  + LK+ N I E + ++L+KYQK +  KL +  K     
Sbjct: 364 RYMRQTSNLHGTVDILQYWLGPLYLKRGN-IPEFERDVLIKYQKQILRKLVDKRKYNWCT 422

Query: 436 ELLSCDDYTINKENKAFMRAYY 457
             +  D ++I+  NK  + A+Y
Sbjct: 423 AFI--DQWSIDASNKEDLEAFY 442

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/391 (21%), Positives = 173/391 (44%), Gaps = 44/391 (11%)

Query: 98  EHFTLEEYSLFLGKVLSMKDSDVN----------VNVVFQLFEIYARMYCGE--GSLNAL 145
           +  + EE+S+F  ++L    S  +          V +  +L++ Y  +   E       +
Sbjct: 95  QEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPM 154

Query: 146 QIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVK 205
           +++DLNK   +F+  ++LK  + VL  I+ + G  +    H+ L++   + +L  GSL  
Sbjct: 155 ELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVT---YFQLYLGSLAS 211

Query: 206 DWKFEG-KNLRYLQSRQGRLNYKFLDGWSLLK------IADLVLNDPMKC--QNVLTNSI 256
            W     ++  Y +  +G    K++   SL +      +  L+ ND  K    + L   I
Sbjct: 212 LWPTPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKI 271

Query: 257 IYSLGHLRQVELLDHFIDQMWMQETRPR----------NGLLYPDTNNIIAIITSYCYNY 306
           +YSL H  +++L + F+++ W     P+          +   YP +  +IAI+TS+ Y  
Sbjct: 272 LYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYR- 330

Query: 307 GNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC-ILTEPNANK-GFILGQCWSLM---- 360
            +++K+  ++D  L KY  +     FW +LF W  ++ +   +  G +   CW  M    
Sbjct: 331 NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWY 390

Query: 361 -EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQK 419
             + E V +   L     E + +  +   A+ +    +  +   +   + ++ ++ KYQK
Sbjct: 391 KSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQK 450

Query: 420 FVFSKLGEINKTVKAMELLSCDDYTINKENK 450
           FV  +L    K     + +  + +  N+EN+
Sbjct: 451 FVIRELSARGKRDACTQFI--EQWRFNEENE 479

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 110/232 (47%), Gaps = 35/232 (15%)

Query: 138 GEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLK 197
               LN +Q+YDLNK+I +FIK  QLK+    L +I+ +Y     +    D  ++ N LK
Sbjct: 217 SSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNA--EIFQIPDSKTIINFLK 274

Query: 198 LKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADLV---------------- 241
           L  G L  +W+ E  N R++++ QG+ ++K  +  S  ++                    
Sbjct: 275 LYCGGLPTNWRIEPINHRFIKN-QGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIK 333

Query: 242 --LNDPMKCQNVL---------TNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGLLYP 290
              ND MK    L          +++IYSL  L + +L + +    W+ ++     L   
Sbjct: 334 KNTND-MKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVEL--- 389

Query: 291 DTNNIIAIITSYCY-NYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCI 341
            ++ +IAI +SY Y N  N++K+  ++  I+++Y  L  +   W R+ +W I
Sbjct: 390 TSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNI 441

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 75/390 (19%), Positives = 166/390 (42%), Gaps = 53/390 (13%)

Query: 103 EEYSLFLGKVLS----------MKDSDVNVNVVFQLFEIYARMYCGE--GSLNALQIYDL 150
           E +S+F+ ++L           +   D  + ++ +L+  Y   +     G  +  +++D 
Sbjct: 131 EGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDA 190

Query: 151 NKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFE 210
           N   ++F+   +L+  + V   ++     +  +   RD  ++   L+L  G+    W+  
Sbjct: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAKLP--RDTETIITLLQLHLGAKHIFWRDP 248

Query: 211 GKNLRYLQSRQGRL----------NYKFLDGWSLLKIADLVLNDPM---KCQNVLTNSII 257
           G ++     R G+L           Y  L   +LL++  L+ +DP     C   L  +II
Sbjct: 249 GNSV----GRGGQLFTPAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDLDRNII 304

Query: 258 YSLGHLRQVELLDHFIDQMWMQETRPRNGL----LYPDTNNIIAIITSYCYNYGNMDKSF 313
            +L    +++L+ H     +     P +GL    L PD   + A++T++ + +  + +  
Sbjct: 305 LALAFHNRLDLV-HAQAARYYAPAAPGHGLPSTPLLPDGALVGAVVTAFAFKH-QLAQGL 362

Query: 314 DVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFIL-GQCWSLM-----EKQEKVE 367
            +  + L++++ L  +   W+ +F W     P  ++G  L  + WS M     E  +   
Sbjct: 363 AIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTP 422

Query: 368 FDGVLLELLREKIVKVRDVPLALRVLKMIV----IELKKVNFINELDMELLLKYQKFVFS 423
           +D  +      +IV+ RD   +LR ++ ++      L +   +   D  LLLK Q  +  
Sbjct: 423 YDYSIAR-ASYRIVR-RDS--SLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVG 478

Query: 424 KLGEINKTVKAMELLSCDDYTINKENKAFM 453
           +L    +   A + +  D + ++ E ++ +
Sbjct: 479 RLVRARRNSAAADFV--DQWALDSEARSHL 506

>CAGL0G00924g Chr7 complement(80770..84360) [3591 bp, 1196 aa] {ON}
           similar to uniprot|Q06132 Saccharomyces cerevisiae
           YLR336c SGD1
          Length = 1196

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 24/89 (26%)

Query: 255 SIIYSLGHLRQVE--------LLDHFIDQMWMQ-----------ETRPRNGLLYPDTNNI 295
           +I+YSL  LR +E        +++HF+  +  Q           E  P+  ++   ++NI
Sbjct: 690 AIVYSLWRLRGIEVGASFLQQIVEHFLKHLEKQLDENESMTEISEDSPQ--IIGKQSSNI 747

Query: 296 IAIITSYCYNYGNMDKS--FDVLDRILEK 322
           I++I SYCYN+G M  S  FD++ +++ K
Sbjct: 748 ISLI-SYCYNFGLMSSSLVFDMIKQLITK 775

>KLTH0G17952g Chr7 (1555700..1558927) [3228 bp, 1075 aa] {ON} some
           similarities with uniprot|Q06132 Saccharomyces
           cerevisiae YLR336C SGD1 Suppressor of Glycerol Defect
           may be involved in high osmolarity signaling pathway
          Length = 1075

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 18/69 (26%)

Query: 255 SIIYSLGHLRQVELLDHFIDQMWMQ-------------ETRPRNG---LLYPDTNNIIAI 298
           +++YSL  LR  E+   FI Q W++             E    +G   +   + NN+IA+
Sbjct: 571 AVVYSLWRLRGTEVGASFI-QTWVERLLESYHSEQQRLENEKEHGGPLIASKECNNLIAL 629

Query: 299 ITSYCYNYG 307
           + SYCYN+G
Sbjct: 630 L-SYCYNFG 637

>TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa]
           {ON} Anc_1.506 YKL197C
          Length = 1053

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 19/126 (15%)

Query: 237 IADLVLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGLLYPDTNNII 296
           + D+   +P+  + +LT++   S   L  +    HFI ++W         L  PD +  I
Sbjct: 549 VNDIARINPLTLRVILTSN---SKNSLNNILFEKHFICKVW--------SLKVPDNSKRI 597

Query: 297 AIITSYCYNYGNMDKSFDVLDRIL------EKYSGLKFDKFFWRRLFQWCILTEPNANKG 350
           A+I  YC +  + D  F+  + +L      + YS L       R  +Q  I    +ANK 
Sbjct: 598 ALIKKYCEDLVDNDIEFENDNELLNLAVKADGYSTLDLKILMDRIYYQLQISNNSSANK- 656

Query: 351 FILGQC 356
            I G+C
Sbjct: 657 -INGKC 661

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
            Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 221  QGRLNYKFLDGWSLLKIADLVLNDPMKCQ----NVLTNSIIYSLGHLRQ-VEL--LDHFI 273
            Q +LN +  +G S L+  DL     ++C     NVLT S++Y LG + + VEL  L HF+
Sbjct: 1439 QSKLNGEADNGLSYLRTGDLGFIKTVRCTDSRDNVLTLSVLYVLGSINETVELLGLTHFV 1498

Query: 274  DQM 276
              +
Sbjct: 1499 HDL 1501

>KLLA0E04291g Chr5 (388682..389479) [798 bp, 265 aa] {ON} some
           similarities with uniprot|P40031 Saccharomyces
           cerevisiae YER046W SPO73 Meiosis-specific protein of
           unknown function required for spore wall formation
           during sporulation dispensible for both nuclear
           divisions during meiosis
          Length = 265

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 363 QEKVEF-DGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINEL 409
           +E+ +F DGV   L ++ +VK+   P+  RVL     E  K  F NEL
Sbjct: 212 RERFQFIDGVFHNLSKDDLVKLSTEPILSRVLGTFQFETSKEKFRNEL 259

>TPHA0N00910 Chr14 (197403..198932) [1530 bp, 509 aa] {ON} Anc_5.237
           YJL036W
          Length = 509

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 18/116 (15%)

Query: 332 FWRRLFQWCILTEPNANKGFILGQCWSLMEKQEKVEFDGVLLELLREKIVKVRDVPLALR 391
           F RR+ +  +L++ N  + F++   W + +K+    F  V+    +E++ +V        
Sbjct: 147 FLRRISKHPMLSQSNMLEFFLISSDWEVYKKKLNGTFSNVIHNNNKEEMTEV-------- 198

Query: 392 VLKMIVIELKKVNFINELDMELLLKYQKFVFSKLGEINKT----VKAMELLSCDDY 443
               I+   K V+  NE+ +E+    +KF  S + +I+KT    VK  EL+  DDY
Sbjct: 199 ----IMNAFKSVHSQNEMFVEIKKNTEKFE-SNISKIDKTFSKIVKKNELI-IDDY 248

>Smik_11.241 Chr11 complement(398581..403881) [5301 bp, 1766 aa] {ON}
            YKL014C (REAL)
          Length = 1766

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 7/93 (7%)

Query: 34   ANATSKEPTISISMDKGTIASNSRVRFSSTLLKKNEFNKYEHFLRG------GRIKDLIS 87
             +ATS  P   IS+ + T   NS +           F K+EHF         G+IK+L  
Sbjct: 997  VDATSA-PEDKISLSETTTLINSIISNDLNYPVLEAFYKWEHFSFASFIPNIGKIKNLPL 1055

Query: 88   MILNPMVSIHEHFTLEEYSLFLGKVLSMKDSDV 120
            + +    ++ +H   + +S F+ K++S  D D+
Sbjct: 1056 LSIVTTTALSKHMQDKNFSAFVHKIISQYDDDI 1088

>TPHA0E01320 Chr5 complement(263113..267186) [4074 bp, 1357 aa] {ON}
           Anc_5.319 YDR301W
          Length = 1357

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 400 LKKVNFINELDMELLLKYQ------KFVFSKLGEINKTVKAMELLSCDDYTI 445
           LKK+  I   D+ELL  Y+        V  K   + KTVK +   + D+Y+I
Sbjct: 485 LKKIETIQPFDIELLSSYKNIGQLSSIVVGKTSSVEKTVKGLPNPNSDEYSI 536

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,818,702
Number of extensions: 2317874
Number of successful extensions: 7185
Number of sequences better than 10.0: 41
Number of HSP's gapped: 7337
Number of HSP's successfully gapped: 42
Length of query: 495
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 381
Effective length of database: 40,409,475
Effective search space: 15396009975
Effective search space used: 15396009975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)