Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C003508.848ON48648625020.0
NDAI0K003508.848ON50450314470.0
YMR283C (RIT1)8.848ON51349713910.0
TDEL0A079708.848ON48949213790.0
Skud_13.4558.848ON49449713780.0
Suva_13.4728.848ON51049413770.0
Smik_13.4968.848ON49450113740.0
KAFR0B039808.848ON48348513670.0
Kpol_1068.28.848ON49148413520.0
KNAG0J002208.848ON49949813450.0
SAKL0D01276g8.848ON50249113061e-177
ZYRO0G14344g8.848ON47248912831e-174
KLTH0C03696g8.848ON47448212791e-173
TPHA0I003008.848ON49349112501e-168
Kwal_27.102198.848ON50049012411e-167
Ecym_46238.848ON48048612361e-166
KLLA0D01386g8.848ON48949811571e-154
AFR451C8.848ON4084199321e-121
TPHA0J004706.38ON48951732.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00350
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   968   0.0  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   561   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   540   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   535   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   535   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   535   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   533   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   531   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   525   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   522   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   507   e-177
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   498   e-174
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   497   e-173
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   486   e-168
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   482   e-167
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   480   e-166
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   450   e-154
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   363   e-121
TPHA0J00470 Chr10 (106019..107488) [1470 bp, 489 aa] {ON} Anc_6....    33   2.0  

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/486 (97%), Positives = 473/486 (97%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
           VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240
           IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240

Query: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300
           SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL
Sbjct: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300

Query: 301 VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360
           VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV
Sbjct: 301 VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360

Query: 361 ELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILICCNTG 420
           ELDPVDNENLPISTHIF             RNKIEEIIGLVESQMNNALNKPILICCNTG
Sbjct: 361 ELDPVDNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILICCNTG 420

Query: 421 TDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNS 480
           TDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNS
Sbjct: 421 TDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNS 480

Query: 481 VNNYLM 486
           VNNYLM
Sbjct: 481 VNNYLM 486

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/503 (57%), Positives = 359/503 (71%), Gaps = 25/503 (4%)

Query: 5   LLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPE 64
             +SL QINKDI+KE KS+RNRLQSILLDN+FLNDE++  FP++PIIPNERCGLWYV P 
Sbjct: 6   FFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPS 65

Query: 65  DFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIP 124
            + QTSYFKSTDGHTNQWDFSTRRLNFHL  T+  S GI I+DSTRRGKKIPDALSKTIP
Sbjct: 66  QYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIP 125

Query: 125 IWCAVLNYIMLLSQRGSDDI-DITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVD 183
           IWCAVLNYIML   +G +DI  + D LF PP T+ K+EYD I ++IP LV KL KL+I++
Sbjct: 126 IWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIIN 185

Query: 184 GNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGD-SWNVPQHANIIPIILCTISY 242
            NEL     GKLLRP W+YPGSS+L SSRDVFTGE T   +W  P+  NIIPI+LCTISY
Sbjct: 186 ANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVLCTISY 243

Query: 243 RAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQ 302
           +AQDG DKR+GFTYVQGAADDHELWS GLTP LFWSHIN+  N  H+++++ ++V  +++
Sbjct: 244 QAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIE 303

Query: 303 E--QDDAGEQSDIN-DAF--DYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILS 357
              +D A +  ++  DA   + +D +TP++ LGKI +N+ I K +  +    F+L +ILS
Sbjct: 304 MKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILS 363

Query: 358 ENVELDPVD-NENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILIC 416
           E V L+  D +E    S  I+             R +I +I  ++   + N   KPILIC
Sbjct: 364 ETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG--KPILIC 421

Query: 417 CNTGTDMSIGILLALLCRNY------SERWVLGEVEA-------KRLDKIMIRKQLTRLI 463
           CNTGTD+SIGI+L +LC+NY       + W+  E E        KRLDK +IRK LT LI
Sbjct: 422 CNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLI 481

Query: 464 SHLEGRTINTSRATLNSVNNYLM 486
           SHLEGR +N SRATLNSVN+YLM
Sbjct: 482 SHLEGRNVNPSRATLNSVNDYLM 504

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/497 (54%), Positives = 348/497 (70%), Gaps = 14/497 (2%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD  +  SL QINKDIRKENKS+RNRLQSILLDNKFL D V+P FP +P+IPNERCGLWY
Sbjct: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P  FKQTSYFKSTDGH NQWDFSTRRLNFHL  T+R + GIIIVDSTRRGKKIPDALS
Sbjct: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KT+PIWCAVLN +ML  Q    ++ I  VL+ PPET+ K+EYDMI R+IP+LV KL KL+
Sbjct: 140 KTVPIWCAVLNTLML--QETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLN 197

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITG-DSWNVPQHANIIPIILCT 239
           I+D  +L  L  GKLLRP WV+PGSSLL  S D FTGE+   ++W  P+  NIIPIILCT
Sbjct: 198 IIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCT 257

Query: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299
           +SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FW+HI +  + +++++Q++ ++  
Sbjct: 258 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMD 317

Query: 300 L----VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSII 355
           L    ++ Q    ++  +++ F  ID +T ++ LGK+   + I K L++KL   +   II
Sbjct: 318 LAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377

Query: 356 LSENVEL--DPVDNENLPIS--THIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALN- 410
            S +V +  D  D E         I+             R+    I G ++S   N    
Sbjct: 378 FSNSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEK 437

Query: 411 -KPILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGR 469
            KP+LICCNTGTDMSIG++L++LC  Y+E W+L   E   + K+++RK LT+LISHL+GR
Sbjct: 438 IKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTS-ELPDISKLIVRKHLTKLISHLKGR 496

Query: 470 TINTSRATLNSVNNYLM 486
            +N SRATLNSVN++LM
Sbjct: 497 NVNPSRATLNSVNSFLM 513

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/492 (54%), Positives = 351/492 (71%), Gaps = 14/492 (2%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD   ++SL  INKDI+KE KS+RNRLQSILLD  FL  EVLPCFP++P++PNERCGLWY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P+DF QTSYFKSTDGHTNQWDFS+RRLNFH+ PT+  S GIIIVDSTRRGKK+PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KTIPIWCAVLN++ML SQ GS      + L+ PPET+S++E+  I  RIP+LV KL  L+
Sbjct: 126 KTIPIWCAVLNHLMLESQGGSVK---QETLYVPPETVSESEFYSIKSRIPELVEKLKSLE 182

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240
           +++G EL   L GKLLRPFW+YPGSS+LQS+ D+FTGE+T D W +P   +IIPIILCT+
Sbjct: 183 VINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIILCTV 241

Query: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300
           SY+AQDG DKR GFTYVQGAADDHELWS GL   +FWS+I+   N   +EE++ +FV  L
Sbjct: 242 SYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL 301

Query: 301 VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360
                D  ++   +DAF  ID VTP+L LG + DN+     L  ++    +L I+LS++V
Sbjct: 302 SLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSV 361

Query: 361 ----ELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQM--NNALNKPIL 414
               ++  ++N +  IS H               + ++ +I+ L+E  +   +   KP+L
Sbjct: 362 NFPQKVAEMENASEFISIH--KLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVL 419

Query: 415 ICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTS 474
           ICCN+GTDMSIG+LL +LCRNY+  W L    +  + KI+++K L +LISHL+GR +N  
Sbjct: 420 ICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTS--VSKIVVKKHLAKLISHLKGRNVNPP 477

Query: 475 RATLNSVNNYLM 486
           RATLNSVN+YLM
Sbjct: 478 RATLNSVNSYLM 489

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/497 (53%), Positives = 348/497 (70%), Gaps = 14/497 (2%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD  +L SL QINKD+R+ENKS+RNRLQSILLDNKFL + V+  FP FPI+PNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P  FK+TSYFKSTDGH NQWDFSTRRLNFHL  T+R   GIII+DSTRRGKKIPD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KT+PIWCAVLN IML  Q+  +D+DI  VL+ PPET+ K+EYDMI R+IP+LV KL KL+
Sbjct: 121 KTVPIWCAVLNTIML--QKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLN 178

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEIT-GDSWNVPQHANIIPIILCT 239
           +VD  +L  L  GK+LRP WV+PGSSLL  S D FTGE+   ++W  P+  NIIPIILCT
Sbjct: 179 VVDSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCT 238

Query: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299
           +SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FWSH+++  + + +++Q++ ++  
Sbjct: 239 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITD 298

Query: 300 LV----QEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSII 355
           LV    + Q    ++  +++ F  ID +T ++ LGK+   + I   L+++L  R+   I+
Sbjct: 299 LVAKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIV 358

Query: 356 LSENVELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNAL------ 409
            S++V +    +     S + F                +  I   +  ++ +A       
Sbjct: 359 FSDSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGG 418

Query: 410 NKPILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGR 469
            KPILICCNTGTDMSIG++L++LC  Y+E W L   E   ++KI+IR+ LT+LISHL GR
Sbjct: 419 TKPILICCNTGTDMSIGVILSILCTKYTEDWKLTP-ELPEVNKIIIRRHLTKLISHLRGR 477

Query: 470 TINTSRATLNSVNNYLM 486
            +N SRATLNSVN++LM
Sbjct: 478 NVNPSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/494 (54%), Positives = 344/494 (69%), Gaps = 14/494 (2%)

Query: 4   LLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPP 63
           LL  SL QINKD+RKENKS+RNRLQSILLDN+FL D VLP FP FPI+PNERCGLWY  P
Sbjct: 20  LLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEP 79

Query: 64  EDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTI 123
             F+QTSYFKSTDGH NQWDFSTRRLNFHL   ++ + GIIIVDSTRRGKKIPDALSKT+
Sbjct: 80  SSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTV 139

Query: 124 PIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVD 183
           PIWCAVLN IML  Q   +++DI  VL+ PPET+ K+EYDMI R+IP+LV KL KL+ +D
Sbjct: 140 PIWCAVLNTIML--QETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAID 197

Query: 184 GNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDS-WNVPQHANIIPIILCTISY 242
              L  L +GK+LRP WV+PGSSLL  S D FTGEI     W  P+  NIIPIILCT+SY
Sbjct: 198 SKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSY 257

Query: 243 RAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLV- 301
           +AQDG DKR+GFTYVQGAADDHELWS GL   +FWSHI++  + N++++Q+  ++  L+ 
Sbjct: 258 QAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIG 317

Query: 302 ---QEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSE 358
              + Q    ++ +++D F+ ID +T ++ LGK+   + I + L ++L   +   II S 
Sbjct: 318 KKLEYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSN 377

Query: 359 NVEL----DPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALN--KP 412
           +V +    D V+         ++             R+    I   V+    N     KP
Sbjct: 378 SVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKGMKP 437

Query: 413 ILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTIN 472
           IL+CCNTGTDMSIG++L++LC  Y+E W+L   E   ++KI+IRK LT+LISHL GR +N
Sbjct: 438 ILVCCNTGTDMSIGVILSILCAKYNEEWILTS-ELPVVNKIIIRKHLTKLISHLHGRNVN 496

Query: 473 TSRATLNSVNNYLM 486
            SRATLNSVN++LM
Sbjct: 497 PSRATLNSVNSFLM 510

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/501 (52%), Positives = 348/501 (69%), Gaps = 22/501 (4%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD  +  SL +IN+D+RKENKS+RNRLQSILLDNKFL D V+P FP FP++PNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P  +KQTSYFKSTDGH NQWDFSTRRLNFHL  T+R + GIIIVDSTRRGKKIPDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KT+PIWCAVLN IML  Q   ++ DI   L+ PPET+ K+EYDMI R+IP+LV KL KL+
Sbjct: 121 KTVPIWCAVLNTIML--QETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLN 178

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEI-TGDSWNVPQHANIIPIILCT 239
           I+D  +L  L  GK+LRP WV+PGSSLL  S D FTGEI   ++W  P+  NIIPIILCT
Sbjct: 179 IIDSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCT 238

Query: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299
           +SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FW+H+ F  + N++++Q++ ++  
Sbjct: 239 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITD 298

Query: 300 LVQE--------QDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFA 351
           LV +        QD  G    +++ F  +D +T ++ LGK+   + I + L+E+L   + 
Sbjct: 299 LVAKKLKSQMYIQDKGG----LDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYG 354

Query: 352 LSIILSENVELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALN- 410
             +ILS++V +           ++ F                +  I+  +  ++  A   
Sbjct: 355 KVLILSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFAN 414

Query: 411 -----KPILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISH 465
                +P+L+CCNTGTDMSIG++L++LC  Y+E W+L + E   ++KI+IRK LT+LISH
Sbjct: 415 RAEEMRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQ-ELPEVNKIIIRKHLTKLISH 473

Query: 466 LEGRTINTSRATLNSVNNYLM 486
           L GR +N SRATLNSVN++LM
Sbjct: 474 LHGRNVNPSRATLNSVNSFLM 494

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/485 (54%), Positives = 340/485 (70%), Gaps = 6/485 (1%)

Query: 6   LESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPED 65
           ++SL  I KDI+ E +S++NRLQSI+LDN FL +EV+PCFP++PIIPNERCGLWY  P+ 
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 66  FKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPI 125
           F+QTSYFKSTDGH NQWDFSTRRLNFHL P L  S GIIIVDSTRRGKKIPDALSKTIPI
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 126 WCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGN 185
           WCAVLN  ++L    ++ ID   VLF PP T+S +EY  I  +I +LV KL  L+++   
Sbjct: 121 WCAVLN-CLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPK 179

Query: 186 ELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQ 245
           EL+ +  GKL+RPFWVYPGSSLL +  D FTGE TG+ W+VP++ NIIPIILCT+SY+AQ
Sbjct: 180 ELYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQ 239

Query: 246 DGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL-VQEQ 304
           DG DKR GF YVQGAADDHELWS GL P  FW +I++  ++  T+  + +FV+TL ++E 
Sbjct: 240 DGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEEN 299

Query: 305 DDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDP 364
            +    S I D F+ ++ VTP++ LGKI DN VI   L  +LS +F+L IILSE +E+  
Sbjct: 300 HEKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITK 359

Query: 365 VDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALN---KPILICCNTGT 421
           ++     I   +F             R ++ EI   +     +A N   KPILICCN+G 
Sbjct: 360 LEEATTKI-IKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGN 418

Query: 422 DMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSV 481
           DMS+ ++L +L + YSE W L   +   + K +IRK L +LIS L+GR +N SRATLNS+
Sbjct: 419 DMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSI 478

Query: 482 NNYLM 486
           N+YLM
Sbjct: 479 NSYLM 483

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/484 (53%), Positives = 340/484 (70%), Gaps = 9/484 (1%)

Query: 8   SLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPEDFK 67
           S+ QI+KDI+KE KS++NR+QSILLD +FL D V+P FP+FP+IPNERCGLWY  P+ F+
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 68  QTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIWC 127
           QTSYFKSTDGH NQWDFSTRRLNFHL PTL  +GGI+IVDSTRRGKKIPDALSKT+PIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 128 AVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNEL 187
           AVLN +ML S    +D D + VLF PP T+  +EY  I +++P L+ +L KL I+DG++L
Sbjct: 130 AVLNSLMLESVDQLND-DYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDL 188

Query: 188 FILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQDG 247
           +    GKLLRP W++PGSSLLQS+ D+FTGE T D W  P+   IIPIILCT+SYRAQDG
Sbjct: 189 YKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQDG 248

Query: 248 HDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQDDA 307
            DKRHGFTYVQGAADDHELWS GL P +FW +I  F +++ +E+ +   VE L+  +   
Sbjct: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQKE 308

Query: 308 GEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDPVDN 367
             +++  +AF+ +D +T  + LGKI D ++IG  L  +L  +F++ I+ SE+ +L    N
Sbjct: 309 VSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVSKN 368

Query: 368 ENLPISTHIF--XXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNK---PILICCNTGTD 422
           E   I+  I                R  + E+   +E   +    K   PILICCN+GTD
Sbjct: 369 EE-KITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGTD 427

Query: 423 MSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSVN 482
           MSI ++L LLC++Y   W     +   ++KI+IRK LT+LISHL+GR +N SRATLNSVN
Sbjct: 428 MSIALVLMLLCKHYDLDW--NTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVN 485

Query: 483 NYLM 486
            YLM
Sbjct: 486 EYLM 489

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/498 (53%), Positives = 348/498 (69%), Gaps = 22/498 (4%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD  LL SL QI+K+++++++S+RNR+QSILLDN+FL   V   FPDFP+IPNERCGLWY
Sbjct: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P  F QTSYFKSTDGH NQWDFSTRRLNFHL PTL+ +GG++IVDSTRRGKKIPDALS
Sbjct: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KT+P+WCAVLN +ML S       ++ DVLF PPET+ ++E D +A+++PDLV KL  L+
Sbjct: 132 KTVPLWCAVLNSLMLESV--GKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILN 189

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240
           + DG +   +L GKLLRPFWV+PGSSLLQS  D+FTGE   + W V +  NI+PIILCT+
Sbjct: 190 VFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTV 249

Query: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300
           SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FWS+I+ F+N++  + ++ + V+ +
Sbjct: 250 SYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKM 309

Query: 301 VQEQDDAGEQSDINDAFDY----IDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIIL 356
           V +Q++  ++S    + D     ID VT  L LG+I DNV +       L   ++  I+L
Sbjct: 310 VTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVL 369

Query: 357 SENVELD---PVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNAL---- 409
           SE V LD     DNE +     IF             R  + +I       +NNA+    
Sbjct: 370 SETVHLDKDASQDNEMV----KIFRLTSGSKKSSKNLRAMLPDI----SKTINNAIILQP 421

Query: 410 NKPILICCNTGTDMSIGILLALLCRNYSERW-VLGEVEAKRLDKIMIRKQLTRLISHLEG 468
            KP+LICCNTG DMSIG+LLA+LC+NY E W +L E     + KI+IR+ LT+LI+HL G
Sbjct: 422 IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNG 481

Query: 469 RTINTSRATLNSVNNYLM 486
           R +N SRATLNS+N++LM
Sbjct: 482 RNVNPSRATLNSINSFLM 499

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  507 bits (1306), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 260/491 (52%), Positives = 343/491 (69%), Gaps = 19/491 (3%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD   L+SL  I K+I+KE KS+RNRLQSI+ D++FL   V+P FPD+P++PNERCGLWY
Sbjct: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             PE F Q SYFKSTDGH NQWDFSTRRLNFHL P++   GGI+I+DSTRRGKKIPDALS
Sbjct: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KTIPIWCAV+N ++L +   S+     +VLF PP T+ ++EYD I  RIP LV KL  L 
Sbjct: 146 KTIPIWCAVINTLILEASNRSE-----EVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLG 200

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEIT-GDSWNVPQHANIIPIILCT 239
           IV G+EL     GK+LRP WVYPGSSL  SS D+FTG+ T    W  P+  + +P+ILCT
Sbjct: 201 IVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCT 260

Query: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299
            SY+ QDG DKR+GFTYVQGAADDHELW+EGLTP +FW + NF  +   +E+++ ++V  
Sbjct: 261 ASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNK 320

Query: 300 LVQEQDDAGEQS---DINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIIL 356
             +E  +  +++   D+N  F  +D +T +L LG + D + + + L  +L  R+AL+++L
Sbjct: 321 QKREATERTKEASGNDLNQCFS-VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVL 379

Query: 357 SENVELDPV-DNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILI 415
           SE+V++  + +N N    T IF             R+K+ EI  L+++ +N+ L  PILI
Sbjct: 380 SESVKIASIQENPN----TKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL--PILI 433

Query: 416 CCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSR 475
           CCNTG DMS+G+LLA LC+NY E W +G   +   +K +IRK LTRLISHL+GR +N SR
Sbjct: 434 CCNTGKDMSVGVLLATLCQNYDEDWCIGSPNS--FNKTIIRKHLTRLISHLKGRNVNPSR 491

Query: 476 ATLNSVNNYLM 486
           ATLNSVN YLM
Sbjct: 492 ATLNSVNAYLM 502

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  498 bits (1283), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 250/489 (51%), Positives = 340/489 (69%), Gaps = 20/489 (4%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MDP L  SL QIN+DI+KE  S+RNR+QSIL DN F+   V+P FP++P+IPNERCGLWY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P+DF QTSYFKSTDGHTNQWDFSTRRLN HL P L+   GIIIVDSTRRGK +PDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KTIPIWCAVLN +M          D ++VLFTPP+ +S++E+D I  RIP LV +L KLD
Sbjct: 121 KTIPIWCAVLNSLM--------QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLD 172

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240
           I+D  +L    QGK+LRPFWVYPGS +L+SS D FTGEI    W    +  IIPIILCT 
Sbjct: 173 ILDAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTA 232

Query: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300
           SYRAQDG DKRHGFTYVQGAADDHELWS GL P L W++ ++F +++  ++++   V+TL
Sbjct: 233 SYRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTL 292

Query: 301 VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360
           ++  +    ++ + D  + +D +T +L LGK+KD+  I   +  +L  +F+L IILS++V
Sbjct: 293 IELAETTDHRNHLADIVE-MDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSV 351

Query: 361 ELD-PVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNAL--NKPILICC 417
            L  P D          +             R  + EI  +V + +N  +   KPI++CC
Sbjct: 352 TLSKPFD------FIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCC 405

Query: 418 NTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRAT 477
           N+GTD+S+G++L +LC+ YS+ W+LG+ ++  ++K +IR+ L ++I+ ++ R +N SRAT
Sbjct: 406 NSGTDISVGVILMILCKYYSQDWLLGKPDS--VNKFVIRRHLVQIINKIKRRNVNPSRAT 463

Query: 478 LNSVNNYLM 486
           LNS+N++LM
Sbjct: 464 LNSINSFLM 472

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  497 bits (1279), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 340/482 (70%), Gaps = 16/482 (3%)

Query: 7   ESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPEDF 66
           +++  +N++I+KE +S+RNRLQSI+ D+KFL+++V   FPD+PIIPNERCG+WY  P+D+
Sbjct: 7   QTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDY 66

Query: 67  KQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIW 126
            QTSYFKSTDGHTNQWDFS RRLNFHL P L +SGGI++VDSTRRGK++PDALSKT+PIW
Sbjct: 67  LQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIW 126

Query: 127 CAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNE 186
           CAVLN  +LL  +G +     +VLF PP+T+S+ E++ I  RIPDLV K  K++I+ G +
Sbjct: 127 CAVLNS-LLLEYQGLEG----EVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGAD 181

Query: 187 LFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQD 246
           +  L +GK+LRP WV+PG+SLL S RD FTGE+    W+  +  N IP++LCT+SY+ QD
Sbjct: 182 IDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQD 241

Query: 247 GHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQDD 306
           G DKRHGFTYVQGAADDHELW++GLT  LFW HI+   N+N +++++  FVE  +  Q+ 
Sbjct: 242 GVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEP 301

Query: 307 AGEQSDIN-DAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDPV 365
              ++ ++ D   Y D +T +L LGKI  NV +G+ L ++L  +++L IILS  V L   
Sbjct: 302 NSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSED 361

Query: 366 DNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILICCNTGTDMSI 425
           +      +  IF             R ++ +I  L E+ + N+L  P+L+CCNTG DMS+
Sbjct: 362 E-----AAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSL--PMLVCCNTGKDMSV 414

Query: 426 GILLALLCRNYS-ERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSVNNY 484
            + LA+LCRNY+   W L   ++  + KI I+K L+++I+ LEGR +N  RA+LNSVN Y
Sbjct: 415 CVSLAILCRNYNVGSWDLNVQQS--IHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAY 472

Query: 485 LM 486
           LM
Sbjct: 473 LM 474

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  486 bits (1250), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/491 (50%), Positives = 332/491 (67%), Gaps = 15/491 (3%)

Query: 8   SLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPEDFK 67
           S+ QI KDIRKENKS++NR+ SILLD+KFL+++V+P FP +P++PNERCGLWY    +F 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 68  QTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIWC 127
            TSYFKSTDGH NQWDFSTRRLNFHL P +    GIII+DSTRRGKKIPDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 128 AVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNEL 187
           AVLN ++L      +D    +VLF PP T+SK+EY+ I  +IP+LV KL KLD++DG +L
Sbjct: 125 AVLNTMILQHCENEEDKS-REVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKL 183

Query: 188 FILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGD-SWNVP-QHANIIPIILCTISYRAQ 245
           +   +G LLRP W++PGSS+LQS  D FTGEI  + SW  P +   IIPI+LCT+SY+ Q
Sbjct: 184 YEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQ 243

Query: 246 DGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQD 305
           DG D R GFTYVQGAADDHELWS GL+P LFW +I    N+  +EE +  +VE ++  + 
Sbjct: 244 DGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLSES 303

Query: 306 DAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVEL--D 363
                 +++  F  ID +T +L LG I D + I + L E  +  ++L IILS +++L  D
Sbjct: 304 MKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363

Query: 364 PVDNENLPIST------HIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNN--ALNKPILI 415
             + ++    T       +F             R+ + EI  L+  ++++  +  KPIL+
Sbjct: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILV 423

Query: 416 CCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSR 475
           CCN G+DMSI ++L  L + Y++ W     E   ++KI IRK LT++ISHL GR +N SR
Sbjct: 424 CCNNGSDMSIAVILVTLSKFYTQEWRRTS-EHTEINKITIRKHLTKVISHLGGRNVNPSR 482

Query: 476 ATLNSVNNYLM 486
           ATLNSVN++LM
Sbjct: 483 ATLNSVNDFLM 493

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  482 bits (1241), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 235/490 (47%), Positives = 340/490 (69%), Gaps = 20/490 (4%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD    ++L  +NK+I+KENK++RNRLQSIL D++FL ++VL  FP++P+IPNERCGLWY
Sbjct: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             PE + QTSYFKSTDGH+NQWDFS RRLN HL PT+   GGI+IVDSTRRGK++PDALS
Sbjct: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KT+PIWCAVLN IML  ++  +     +VLF PP T+S +E++ I  RIP LV +  +L 
Sbjct: 147 KTVPIWCAVLNSIMLEGRQSEE-----EVLFCPPNTVSGSEFERIKSRIPSLVARFKELG 201

Query: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240
           +   +ELF +L GK+LRP WVYPG+SLL S RD FTG+I   +W   Q+ N +P++LCT+
Sbjct: 202 LFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEA-QNENFMPVVLCTV 260

Query: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300
           SY+ QDG DKRHGFTYVQGAADDHELW+EGLT  LFW HI  F++   ++++++ +V  L
Sbjct: 261 SYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNL 320

Query: 301 VQEQDDAGEQSD---INDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILS 357
           V   D   + +    ++D  +  + +T +L LG++ +N+ + K L ++L  +++L ++LS
Sbjct: 321 VTSGDANNKLTKSLRLDDMLN-ANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLS 379

Query: 358 ENVELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILICC 417
            ++ +   + EN+     IF             R  + +I  L+E+ + N+L  P+LICC
Sbjct: 380 TSISVYE-EAENI----RIFKLQSGSKKSSRALRAALTQICPLIEANLQNSL--PVLICC 432

Query: 418 NTGTDMSIGILLALLCRNYS-ERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRA 476
           N G DMS+ ++L++LCRN++ E W L +  +  + K +I+K L ++I+ L+GR +N  R 
Sbjct: 433 NNGKDMSVCVVLSVLCRNFNVESWQLEQRPS--VHKSIIKKHLAKMITKLDGRNLNPPRV 490

Query: 477 TLNSVNNYLM 486
           +LNSVN+YLM
Sbjct: 491 SLNSVNDYLM 500

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  480 bits (1236), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 330/486 (67%), Gaps = 17/486 (3%)

Query: 6   LESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPED 65
           L++L QI K+IR++  S+RNRLQS+  D+KF+ +EVLP FP++P++PNERCGLWY  P  
Sbjct: 7   LDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGK 66

Query: 66  FKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPI 125
           ++QT YFKSTDGHTNQWDFSTRRLNFH+   +  +GGIIIVDSTRRGKK+PDALSKTIPI
Sbjct: 67  YEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPI 126

Query: 126 WCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGN 185
           WCAVLN +ML  +   D I     LF PP T+SK E+D I  ++PDLV KL KL+I+ G 
Sbjct: 127 WCAVLNNLMLDYKGKEDSI---PSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGE 183

Query: 186 ELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQ 245
           EL+ + QGK+LRPFWVYPGS LL +SRD+FTGE+ G+ W   Q  N IP+ILCT SY+ Q
Sbjct: 184 ELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQ--NSIPVILCTASYQCQ 241

Query: 246 DGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQD 305
           DG DK HGFTYVQGAADDHELW+ GL P +FW +I F  + + +E ++  FV+ + + + 
Sbjct: 242 DGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEK 301

Query: 306 ---DAGEQSD--INDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360
               + +QSD   + +F  +D +T  L LG + + + + + + ++L  +++L II S++V
Sbjct: 302 LTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSV 361

Query: 361 ELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILICCNTG 420
                 N        ++             R  + EI GL++  + + L  PILICCNTG
Sbjct: 362 TAKADCNCE---RIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQL--PILICCNTG 416

Query: 421 TDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNS 480
            D+SIGI+L  LC++Y  +W L E E   ++K +++K L R+I+ L G  IN SR+TL +
Sbjct: 417 KDISIGIMLTALCQHYDLQWHLEEQET--VNKTIVKKHLARIITKLSGININPSRSTLKN 474

Query: 481 VNNYLM 486
           VN +L+
Sbjct: 475 VNAFLL 480

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  450 bits (1157), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/498 (46%), Positives = 331/498 (66%), Gaps = 21/498 (4%)

Query: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60
           MD   L  + +I+K++RKE+KS++NRLQSI+ DN FL ++V P F  +P++PNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120
             P+ +  TSYFKSTDGH NQWDFSTRRLNFHL P L  +GG++I+DSTRRGKKIPDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180
           KT+PIWCAVLNY+ML +       +  ++LF PP T+ ++E+D +  ++P+LV KL KLD
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFE-EEILFVPPSTVPESEFDRMFAKLPELVQKLKKLD 178

Query: 181 IVDGNELFILLQ-----GKLLRPFWVYPGSSLLQSSRDVFTGEITGDS-WNVPQHANIIP 234
           I+D  +L   LQ      KLLRP WVYPGSSLLQ   D+F+GE+  ++ W  P  +NIIP
Sbjct: 179 IIDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPP--SNIIP 236

Query: 235 IILCTISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQIN 294
           +ILCT+SY+ QDG DKR+GFTYVQGAADDHELW+E LTP LFW +I+   +++ ++ ++ 
Sbjct: 237 VILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELK 296

Query: 295 QFVETLV---QEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFA 351
                ++   + Q+      DI+   + ID +T +L LGKI     I     + L+ +++
Sbjct: 297 DSYNAVILRAKVQNSLDISGDISKMLE-IDTITARLHLGKITSQFRITPKTVKYLNQKYS 355

Query: 352 LSIILSENVELDPVDNENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQM---NNA 408
             ++  E + +  +    LP S HIF             R+ + +I  L+E Q+   + A
Sbjct: 356 AVVLCHEAISVTEI--TELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTA 413

Query: 409 LNKPILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEG 468
            N PILI C++G D+S+ ILL  LC+ Y+  W L   ++  ++K +I+K L ++I  L+G
Sbjct: 414 ANLPILIACDSGKDISVSILLVALCKYYNLDWELQPQDS--VNKTIIKKHLAKIIESLQG 471

Query: 469 RTINTSRATLNSVNNYLM 486
           R +N SRA+LNSVN++LM
Sbjct: 472 RNVNPSRASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  363 bits (932), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 190/419 (45%), Positives = 258/419 (61%), Gaps = 16/419 (3%)

Query: 69  TSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIWCA 128
           T YFKSTDGH N WDFS RRLNFHL P L    G IIVDSTRRGKKIPDALSKTIPIWCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 129 VLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNELF 188
           VLN ++L    GS      +VLF PP T+S+ EY+ I  ++P+LV KL ++D + G EL 
Sbjct: 65  VLNTLILEHTEGSG-----EVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELC 119

Query: 189 ILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQDGH 248
            LL G+LLRPFWVYPG+++L ++RD+FTGE   + W  P    +IP+ILCT S + QDG 
Sbjct: 120 SLLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQPP--PGVIPLILCTASRQCQDGV 177

Query: 249 DKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQDDAG 308
           DK  G+ YVQGAADDHELW+ GLTP+LFW+++    + +  E+ +   VE +V+      
Sbjct: 178 DKSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTH 237

Query: 309 EQSDIND-AFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDPVDN 367
            ++  ++      D VT  L LG +    +  K   E L  +++L ++   ++EL     
Sbjct: 238 TEAVAHELPCRETDVVTEHLRLGSVAPCQISDKQ-AELLEQQYSLVVLCGSSIELSAAAP 296

Query: 368 ENLPISTHIFXXXXXXXXXXXXXRNKIEEIIGLVESQMNNALNKPILICCNTGTDMSIGI 427
                   I+             R  + EII L+ + +  AL  P+LICC++G+D+S+GI
Sbjct: 297 HP---RIRIYPLNSGCKKSSRALRPALIEIIPLISTALCEAL--PVLICCSSGSDISVGI 351

Query: 428 LLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSVNNYLM 486
           +LA LC+NY   W     + K + K +I+K L +L S + GR IN SR TLNSVN +LM
Sbjct: 352 VLAALCKNYDLEW--RHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>TPHA0J00470 Chr10 (106019..107488) [1470 bp, 489 aa] {ON} Anc_6.38
           YMR004W
          Length = 489

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 222 DSWNVPQHANIIPIILCTISYRAQDGHDKRHGFTYVQGAADDHELWSEGLT 272
           DSWNV QHAN    IL T +    +   K+   T V    D++  W E +T
Sbjct: 53  DSWNVTQHAN----ILATSNEYQDENASKKTDKTNVLDTGDENNEWLEWIT 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,808,604
Number of extensions: 2437356
Number of successful extensions: 6900
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7003
Number of HSP's successfully gapped: 29
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)