Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C003208.849ON60860832090.0
NDAI0K003608.849ON62060319450.0
Suva_13.4748.849ON60257417100.0
TDEL0B001808.849ON58259016810.0
YMR284W (YKU70)8.849ON60257716810.0
Skud_13.4578.849ON60258116790.0
KAFR0L019508.849ON58858616620.0
Smik_13.5008.849ON60257716600.0
ZYRO0C14850g8.849ON59459216260.0
KNAG0M02650singletonON57458715440.0
SAKL0D01188g8.849ON58157515360.0
Kwal_27.101998.849ON57257514840.0
TPHA0I003108.849ON60858714810.0
KLTH0C03586g8.849ON57856914630.0
KLLA0C06226g8.849ON59260413950.0
TBLA0B028908.849ON64864413820.0
CAGL0I02662g8.849ON60660213620.0
Kpol_1068.18.849ON51450213071e-175
AFR443CsingletonON57657310511e-135
Ecym_46208.849ON5975819461e-119
ABL117C8.849ON6025676882e-81
TPHA0G024602.444ON626152970.004
NDAI0I019406.75ON126085790.62
TDEL0A021902.444ON626143751.8
KNAG0B061204.253ON281255741.9
ZYRO0A03036g3.265ON86742742.2
Kwal_47.180238.48ON834135724.8
KLLA0C09526g8.711ON33380706.1
AAL116W8.711ON32681697.8
Suva_8.3118.711ON33381689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00320
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...  1240   0.0  
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     753   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   663   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   652   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   652   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   651   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   644   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   644   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   630   0.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   599   0.0  
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   596   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   576   0.0  
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   575   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   568   0.0  
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   541   0.0  
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   536   0.0  
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   529   0.0  
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   508   e-175
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   409   e-135
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   369   e-119
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   269   2e-81
TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.4...    42   0.004
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     35   0.62 
TDEL0A02190 Chr1 (394031..395911) [1881 bp, 626 aa] {ON} Anc_2.4...    33   1.8  
KNAG0B06120 Chr2 (1204380..1205225) [846 bp, 281 aa] {ON} Anc_4....    33   1.9  
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    33   2.2  
Kwal_47.18023 s47 complement(648144..650648) [2505 bp, 834 aa] {...    32   4.8  
KLLA0C09526g Chr3 (828109..829110) [1002 bp, 333 aa] {ON} highly...    32   6.1  
AAL116W Chr1 (141617..142597) [981 bp, 326 aa] {ON} Syntenic hom...    31   7.8  
Suva_8.311 Chr8 complement(555127..556128) [1002 bp, 333 aa] {ON...    31   9.6  

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score = 1240 bits (3209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/608 (100%), Positives = 608/608 (100%)

Query: 1   MEVDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQL 60
           MEVDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQL
Sbjct: 1   MEVDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQL 60

Query: 61  VIIRPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLE 120
           VIIRPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLE
Sbjct: 61  VIIRPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLE 120

Query: 121 YFNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKD 180
           YFNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKD
Sbjct: 121 YFNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKD 180

Query: 181 ATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDE 240
           ATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDE
Sbjct: 181 ATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDE 240

Query: 241 EYSEYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKP 300
           EYSEYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKP
Sbjct: 241 EYSEYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKP 300

Query: 301 ATRYKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKIND 360
           ATRYKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKIND
Sbjct: 301 ATRYKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKIND 360

Query: 361 DYSKHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKC 420
           DYSKHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKC
Sbjct: 361 DYSKHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKC 420

Query: 421 MIVWGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYL 480
           MIVWGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYL
Sbjct: 421 MIVWGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYL 480

Query: 481 NLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRF 540
           NLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRF
Sbjct: 481 NLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRF 540

Query: 541 LKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLK 600
           LKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLK
Sbjct: 541 LKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLK 600

Query: 601 KGKFELNL 608
           KGKFELNL
Sbjct: 601 KGKFELNL 608

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/603 (63%), Positives = 470/603 (77%), Gaps = 13/603 (2%)

Query: 13  SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCY 72
           S+KKYDIHEGIIFCIELSK MF+EVPELNY VQLLEILESL ELMS LVIIRPSTG+GCY
Sbjct: 24  SYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGVGCY 83

Query: 73  FHYCDRKNGDSK-------NGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFD 125
            HYC++ + ++        +GIYE FPLRDVNA DMKK+SDL EDL  +RITL++YF FD
Sbjct: 84  IHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFD 143

Query: 126 PTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRI 185
              D + +K+VPLE LF FLLD+FT    D N YHS+KIFLFTDNDSP E  + +A LRI
Sbjct: 144 N--DENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRI 201

Query: 186 RRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEY 245
           RR+VDDMNDNYINF TFFIG   +PF +SFYS++LKLG+K  + +        D+EYSE+
Sbjct: 202 RRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEF 261

Query: 246 DGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYK 305
           DGPNT PIPA YIKS+ILRKKEIKR  FQ PLIL E+  FI+ +RGY + + EKP TRYK
Sbjct: 262 DGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYK 321

Query: 306 LVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKH 365
           LVYE EN+RKEA S RK+LNPNTGEE++ DE  K+FPYGD +IELNDKEV K+ ++ S  
Sbjct: 322 LVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCP 381

Query: 366 ESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWG 425
           E+FLK+IGFRS    + YFNNI    FVVPDESQYEG+I+TMASLFR LKK+DK  I+WG
Sbjct: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWG 441

Query: 426 KVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRI 485
           K+K+NS   LY+L PT+N DRNEGFYLYR+PFL+EIRKFPKLLDY   +++ DY NL++I
Sbjct: 442 KMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKI 501

Query: 486 TENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDD 545
           T  I+ YF+L+ GY PS+F+NPSLQR Y+ LHDYLLQVEQ + E GD   Q  + L+EDD
Sbjct: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAE-GDEQHQIQKLLEEDD 560

Query: 546 TLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLKKGKFE 605
           TL KI  IR+KI++SK+SDD TQQRL KY++LWNT+Y+K+++E+ +   ++   KK K  
Sbjct: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEENSL---SNPPKKKSKPT 617

Query: 606 LNL 608
           LNL
Sbjct: 618 LNL 620

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/574 (57%), Positives = 424/574 (73%), Gaps = 16/574 (2%)

Query: 13  SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCY 72
           S++K+DIHEGI+FCIELS SMF+E PELNYK  LLEILESL+ELMSQLVI RP T IGCY
Sbjct: 22  SYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCY 81

Query: 73  FHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDS 132
           F+YC R   D+K GIYE FPLRD+NA+ MK ++DL+ED++  RITL EYFNF  +   + 
Sbjct: 82  FYYCGRD--DAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHS---EK 136

Query: 133 QKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDM 192
           Q ++PL  LF F+LD F +      +  SKKIFLFTDND P E  D D   R+RR+  D+
Sbjct: 137 QMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDL 196

Query: 193 NDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTP 252
            DN +NF TFFIG     F N FYS+IL+LGS  NK         G +  SE+DGPNT P
Sbjct: 197 FDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNK---------GVDLDSEFDGPNTKP 247

Query: 253 IPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHEN 312
           I A YIKSKILRKKE+KR  FQCPLI  E+ NFI+ V+GY + + EK   RYKLVYEHE+
Sbjct: 248 IDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHED 307

Query: 313 IRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVI 372
           IR+EA S+RKFLNP TG ++      KV+PYGD DI L++K+   I + Y++ + FL++I
Sbjct: 308 IRQEAYSKRKFLNPTTGADVT-GSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRII 366

Query: 373 GFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSN 432
           GFRS  +SI YFNNI+K+ F+VPDE++YEG+I+T+ASL + L+K+DK  IVWGK+KSNS+
Sbjct: 367 GFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSH 426

Query: 433 LRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-DYLNLVRITENIIG 491
             L++LSP++  + NEGFYLYRIPFLDEIRKFP LL Y+     E +Y N+ RI+++I+G
Sbjct: 427 PSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMG 486

Query: 492 YFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKIL 551
           YFNL+ GY PSDFKNPSLQRH+K LHDYLLQ+E  + E+  S+ + +R + EDD+L K+ 
Sbjct: 487 YFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLY 546

Query: 552 HIREKIIASKESDDVTQQRLSKYVSLWNTFYIKM 585
           HIR KI+ S++S+D   QRL+KYV +WNTFY K 
Sbjct: 547 HIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKF 580

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/590 (54%), Positives = 431/590 (73%), Gaps = 23/590 (3%)

Query: 13  SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCY 72
            +++YDIHEGIIFCIELS  MF+E+PELNYK+QL+EILE+L +LMSQLVI RPSTGIGCY
Sbjct: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74

Query: 73  FHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDS 132
           F  C+R   D+K+GIY F PL+DVNA+ MKK+SDL+EDL  +R TL ++  +D      +
Sbjct: 75  FFNCNR--SDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYD------A 126

Query: 133 QKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDM 192
            K  PLE+L   + ++F K   D   +++KKIF FTDNDSP E +D DA  R+R +V+D+
Sbjct: 127 SKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDL 186

Query: 193 NDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTP 252
           +D +INF TFFIG+ G PF   FYS+IL+LG+     +             E+DGPNTTP
Sbjct: 187 DDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASD-------------EFDGPNTTP 233

Query: 253 IPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHEN 312
           I A+YIKS++LRK+EIKR MFQCPLIL+E++ FIV V+GY I++ EKP  RYKLVYE+E+
Sbjct: 234 ISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENED 293

Query: 313 IRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVI 372
           IR+EA SRRK+LN  TGEEIK D L KV+PYGD DIEL++ ++A+I +DY+  ESFLKVI
Sbjct: 294 IRQEAFSRRKYLNAKTGEEIK-DGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVI 352

Query: 373 GFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSN 432
           GF+ST+  + Y+NNI+KA FVVPDE +YEG+I+T++SLF+ L++++K  IVWGK+KSNSN
Sbjct: 353 GFQSTETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSN 412

Query: 433 LRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGY 492
             ++   P+     NEGFYLYR+PFLDE+R+ P +L  +     +DY NL   T+ +I +
Sbjct: 413 PAIFFFVPSDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINH 472

Query: 493 FNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILH 552
           FNLK G+ PS+FKNP LQ+H+K LHDYLLQ+E+   +D D + Q S+ L+EDD+L +I  
Sbjct: 473 FNLKNGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKD-DVEWQRSKLLEEDDSLRRISQ 531

Query: 553 IREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLKKG 602
           IR+KI  S  S D  +Q+LSKY+++WN+ Y K+  +     D     KKG
Sbjct: 532 IRDKIDESANSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKG 581

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/577 (56%), Positives = 426/577 (73%), Gaps = 16/577 (2%)

Query: 10  DHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGI 69
           D   ++K+DIHEGI+FCIELS++MF+E  +L YK  LLEILESL ELMSQLVI RP T I
Sbjct: 19  DETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAI 78

Query: 70  GCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLD 129
           GCYF+YC+R+  D+K GIYE FPLRD+NA  MKK++DL+EDL+  RI+L +YF F  T  
Sbjct: 79  GCYFYYCNRE--DAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQT-- 134

Query: 130 NDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIV 189
             S+K+V L  LF F+LD F +      +  +K++FLFTD D P E  D D   R+RR+ 
Sbjct: 135 -GSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLT 193

Query: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249
            D+ DN +NF TFFIG   KPF N FYS+IL+LGS  N       + TG +  SE+DGP+
Sbjct: 194 IDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTN-------ENTGLD--SEFDGPS 244

Query: 250 TTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYE 309
           T PI A YIKS+ILRKKE+KR MFQCPLIL E+ NFIV V+GY + T EK   RYKLVYE
Sbjct: 245 TKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYE 304

Query: 310 HENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFL 369
           HE+IR+EA S+RKFLNP TGE++   +  KV+PYGD DI L+D +   + + Y++ ++FL
Sbjct: 305 HEDIRQEAYSKRKFLNPITGEDV-TGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFL 363

Query: 370 KVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKS 429
           K+IGFRS+  SI YFNNIDK+ F+VPDE++YEG+I+T+ASL ++L+K+DK  I+WGK+KS
Sbjct: 364 KIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKS 423

Query: 430 NSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-DYLNLVRITEN 488
           NS+  LY LSP++  D NEGFYLYR+PFLDEIRKFP LL Y+  +  + DY N+ ++T++
Sbjct: 424 NSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQS 483

Query: 489 IIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLN 548
           I+GYFNL+ GY PSDFKNP LQ+HYK LHDYLLQ+E    E+   + +  R ++EDD+L 
Sbjct: 484 IMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLR 543

Query: 549 KILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKM 585
           K+ +IR KI+ S++S+D   QRL+KYV +WN FY K 
Sbjct: 544 KLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKF 580

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/581 (54%), Positives = 425/581 (73%), Gaps = 16/581 (2%)

Query: 10  DHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGI 69
           D   ++K+DIHEGI+FC+ELS++MF+E  EL+YK  LLEILESL+ELMSQLVI RP T I
Sbjct: 19  DDAGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAI 78

Query: 70  GCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLD 129
           GCYF+YC R   D+K GI+EF PLRD+NA  MK+++DL+EDL+  R+TL EYFNF PT  
Sbjct: 79  GCYFYYCSRD--DAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPT-- 134

Query: 130 NDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIV 189
            + Q+++PL  LF F+LD F +      +  SKK+FLFTDND P E  D D   R+R + 
Sbjct: 135 -EKQRQMPLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLT 193

Query: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249
            D+ DN +NF TFFIG   K F N FYS+IL+LGS  NK       G G    SE+DGPN
Sbjct: 194 IDLFDNKVNFSTFFIGYANKSFDNEFYSDILQLGSHTNK-------GVGLN--SEFDGPN 244

Query: 250 TTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYE 309
           T PI A YIKSKILRKKEIKR MFQCPL+  E  +F V V+GY + + EK   RYKLVYE
Sbjct: 245 TKPINAKYIKSKILRKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYE 304

Query: 310 HENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFL 369
           HE++R+EA S+RKFLNP TGE++    + KV+PYGD DI  ++ +   + + Y++ ++FL
Sbjct: 305 HEDVRREAFSKRKFLNPMTGEDVTSSTV-KVYPYGDLDINFSENQNQIVMEAYTQKDAFL 363

Query: 370 KVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKS 429
           ++IGFRS+  +I YFNNI+K+ F+VPDE++YEG+++T+ SLF+ L+K+DK  I+WGK+K+
Sbjct: 364 RIIGFRSSSKAIHYFNNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKT 423

Query: 430 NSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-DYLNLVRITEN 488
           NS+  L++LSP++  + NEGFYLYR+PFLDEIRKFP LL Y++    + DY N+ +IT+N
Sbjct: 424 NSHASLFVLSPSSIKEYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKITQN 483

Query: 489 IIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLN 548
           I+GYFNLK GY PSDF+NPSLQ+H+K LHDYLLQ+E     +   D + +R + EDD+L 
Sbjct: 484 IMGYFNLKDGYNPSDFRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLR 543

Query: 549 KILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKES 589
           K+ HIR KI+ S++S+D   QRL+KYV +WN FY K   +S
Sbjct: 544 KLYHIRNKILDSEKSEDPAIQRLNKYVKIWNVFYNKFNDDS 584

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/586 (54%), Positives = 423/586 (72%), Gaps = 29/586 (4%)

Query: 7   ENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPS 66
           E+  + S+KK++ HE +IF +ELS  MFE VPELN K+QL+EILESL ELMSQL+++RP+
Sbjct: 10  EDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQLIVVRPN 68

Query: 67  TGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDP 126
             IGCYFHYC ++  D   GIYEFFPL D+NA++MKK+SDL+EDL L RI L+++F ++ 
Sbjct: 69  AAIGCYFHYCGKEGNDY--GIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQYN- 125

Query: 127 TLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIR 186
                + K+  +E LF F L+QF+   A   KY  ++IFLFTDNDSP +  DK+A   +R
Sbjct: 126 -----NAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILR 180

Query: 187 RIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYD 246
           +IVDD++++++NFV FFIGR   PF ++ YS ILKLG        A+ D +     +EYD
Sbjct: 181 KIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLG--------ARKDSS-----TEYD 227

Query: 247 GPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKL 306
           GPNTTPI ASYIKSK+LRK+EIKR  F+CPLIL E+ NFIV +RGY  V+ EK ATRYKL
Sbjct: 228 GPNTTPIQASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKL 287

Query: 307 VYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDK---EVAKINDDYS 363
           VYE+EN+R+EA SRRKFL+  T EEIK  EL K+F  GD DIE++++   EV K +DD  
Sbjct: 288 VYEYENLRQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDV- 346

Query: 364 KHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIV 423
              SFLKV+GFRS K+ ++Y NNIDK +FVVPDE QY  +IK + SLF+ L+ + K  I+
Sbjct: 347 --RSFLKVVGFRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAII 404

Query: 424 WGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLV 483
           WGK+K+NSN  L++L P+   D NEGFYL+R+PFLDEIRK P ++ Y     + DY NL+
Sbjct: 405 WGKLKANSNPSLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLI 464

Query: 484 RITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE 543
           ++TE I+ YFNLK GY P D KNP +Q+++K LHDYLLQ+E     D  S  +  R L+E
Sbjct: 465 KVTEYIMAYFNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKT-SDESSTERKQRLLRE 523

Query: 544 DDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKES 589
           DDTL K+ HIREKII+S  S+D   Q+LSKY+ +WN FY K+EKES
Sbjct: 524 DDTLRKVSHIREKIISSSRSEDAGAQKLSKYIKVWNNFYAKIEKES 569

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/577 (54%), Positives = 425/577 (73%), Gaps = 16/577 (2%)

Query: 10  DHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGI 69
           D P ++K+D+HEGI+FC+ELS++MF+E  EL+YK  LLEILESL+ELMSQLVI RP T I
Sbjct: 19  DEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAI 78

Query: 70  GCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLD 129
           GCYF+YC R   D+K GIYE FPLRD+N R MKK++DL+EDL+ +R+TL EYFNF  T  
Sbjct: 79  GCYFYYCYR--DDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKT-- 134

Query: 130 NDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIV 189
            ++QK++PL +LF F+LD F + ++   + ++K++FLFTDND P E  + D   R+RR+ 
Sbjct: 135 -ENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLT 193

Query: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249
            D+ DN INF TFFIG     F N FYS+IL+LGS  NK     + G      SE+DGPN
Sbjct: 194 VDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNK-----TIGLN----SEFDGPN 244

Query: 250 TTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYE 309
           T PI A YIKS+ILRK+E+KR MFQC LI  E+ +FI+ ++GY + + EK   RYKLVYE
Sbjct: 245 TKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYE 304

Query: 310 HENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFL 369
           HE+IR+EA S+RKFLN  +GE++  D   KV+PYGD DI L++ +   + + Y++ ++FL
Sbjct: 305 HEDIRQEAYSKRKFLNFMSGEDV-TDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFL 363

Query: 370 KVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKS 429
           K+ GFRS+  S+ YFNNI+K+ F+VPDE +YEG+I+ + SL ++L+K+DK  I+WGK+KS
Sbjct: 364 KITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKS 423

Query: 430 NSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-DYLNLVRITEN 488
           NS+  L++LSP+   + NEGFYLYR+PFLDEIRKFP LL Y+  +  E DY N+ ++T++
Sbjct: 424 NSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQS 483

Query: 489 IIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLN 548
           IIGYFNL+ GY PSDFKNP LQ+HYK LHDYLLQ E    E+  SD +  R + EDD+L 
Sbjct: 484 IIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLR 543

Query: 549 KILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKM 585
           K+ HIR KI+ S++S+D   QRL+KYV +WN FY K 
Sbjct: 544 KLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKF 580

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/592 (51%), Positives = 429/592 (72%), Gaps = 22/592 (3%)

Query: 1   MEVDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQL 60
           +E  + ++    S++KY++HEGIIFCIELS  MF+E+ ELNYKVQL+EILE+L +LMSQL
Sbjct: 11  LEQQDKQHTQSKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQL 70

Query: 61  VIIRPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLE 120
           VI+RP TGIGCYF+ C++   D+KN IYEFFPLRD+NA+ MKK+SDL++DL   RITL +
Sbjct: 71  VIVRPGTGIGCYFYNCNK--DDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQK 128

Query: 121 YFNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKD 180
           +  +D +      +R PL+ L+ F+ D+F K       +++KK+FLFTDNDSP E  D +
Sbjct: 129 FLPYDES------ERTPLDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNE 182

Query: 181 ATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDE 240
              R+R +VDDM+D++INF TFFIG+E  PF +SFYS++LKLG+            T ++
Sbjct: 183 TKSRLRHLVDDMDDHFINFTTFFIGKEEAPFDDSFYSDVLKLGA------------TAED 230

Query: 241 EYSEYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKP 300
             +E+DGPNTTPI ASYIKS++LRK+E+KR MFQC LIL+E   F+V ++GY I+ QE+P
Sbjct: 231 PNTEFDGPNTTPISASYIKSRVLRKQEVKRIMFQCCLILEERMQFMVGIKGYTIIIQERP 290

Query: 301 ATRYKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKIND 360
             RY+LVYE + +RKEA+S+RKFL+ NTGE I+ + L KVFPYGD DI + D+E+ ++  
Sbjct: 291 GQRYRLVYEKDEVRKEANSKRKFLDSNTGEVIE-EGLTKVFPYGDLDITITDEELNEVRK 349

Query: 361 DYSKHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKC 420
            Y++ ESFLK+IGFR     I YFNNID+ALFVVPDE ++EG+I+T+ASLF+ L+ + K 
Sbjct: 350 SYTEEESFLKIIGFRDYNKCIHYFNNIDRALFVVPDEFRFEGSIRTLASLFKNLRAKGKV 409

Query: 421 MIVWGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYL 480
            +VWGK+K+NS+  +++LSP+ N D NEGFYLYRIPF +E+R+FP+ L  ++   + +Y 
Sbjct: 410 AVVWGKLKTNSHPAVFVLSPSRNEDPNEGFYLYRIPFAEELRRFPQSLIRHNSYDTPEYN 469

Query: 481 NLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRF 540
            L   T++II +F   KGYRPS+F+NP LQ+H+K LHDYLLQVEQ   ED   +    R 
Sbjct: 470 QLKDTTKSIIDHFQFAKGYRPSEFRNPDLQKHFKILHDYLLQVEQE-EEDDSPESSKQRL 528

Query: 541 LKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGID 592
           L EDD+L K+  IR+KI+ S +S D  + +L +Y  LWN  Y  + K + ++
Sbjct: 529 LSEDDSLLKLAQIRDKIMDSAQSSDPKKFQLDEYFQLWNRLYEDVSKATTLE 580

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/587 (51%), Positives = 414/587 (70%), Gaps = 33/587 (5%)

Query: 1   MEVDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQL 60
           +EV++  +G++  +KKYD HEGI+FCIEL+ ++FE V  L  +  LLEIL SL ELM QL
Sbjct: 4   LEVNKTVDGEY-GYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQL 62

Query: 61  VIIRPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLE 120
           VI+RP + +GC FHY D  NG + +G+YEF PLRDVNA+DMK +SD +ED+  KRI + +
Sbjct: 63  VIVRPGSSVGCIFHYTD-ING-AVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQ 120

Query: 121 YFNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKD 180
           YF FD        K V LE LF  + +++++   D  K+  K+ FLFTDND+P E ND +
Sbjct: 121 YFKFD------GSKHVSLERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTE 174

Query: 181 ATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDE 240
           AT RI +IVDD+++  ++F TFFIG E  PF N FYSN+LKLG+++              
Sbjct: 175 ATRRISKIVDDLDETAVSFTTFFIGSEEAPFDNRFYSNVLKLGAQL-------------- 220

Query: 241 EYSEYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKP 300
           ++S+YDGP+  PI  S IK++ILR KEIKRTMFQCPL L +++NFI+ +RGYAIVT EK 
Sbjct: 221 KHSDYDGPSVRPITGSDIKARILRGKEIKRTMFQCPLYLNKDSNFIIGIRGYAIVTHEKY 280

Query: 301 ATRYKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKIND 360
            TRYKL YE E+IR+EA S+RK+LN  TGEE+ P ++ KV PYGD +IEL+ + + ++  
Sbjct: 281 GTRYKLTYEKEDIRQEAFSKRKYLNSKTGEEVDPKDISKVIPYGDVNIELSAEALQQMRA 340

Query: 361 DYSKHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKC 420
            Y +   F+KV+GFRST   ++YFNNIDK  F+VPDE QYEG+IKT+ASLFR L+ ++K 
Sbjct: 341 SYEEEGPFMKVLGFRSTDLCVKYFNNIDKPSFIVPDELQYEGSIKTLASLFRTLRSKNKS 400

Query: 421 MIVWGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFP-KLLDYNHITTSEDY 479
            I+WGK KSNSN  LYI+ P+   DRN+GFY++RIPFLDE+RK P K++D +      D 
Sbjct: 401 AIIWGKPKSNSNSALYIMVPSHREDRNDGFYMHRIPFLDELRKVPIKMVDNDWTQLDND- 459

Query: 480 LNLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSR 539
             L+ +TE I+ YFNL++GY PS+FKNP +Q +YK LHDY+LQVE+ ++ +G  D     
Sbjct: 460 --LLTVTETILKYFNLRQGYIPSEFKNPGIQNYYKVLHDYILQVEE-IKHEG-WDFSQEE 515

Query: 540 FLKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKME 586
            L++DDTL KI HIR KI AS +SD V    LS Y+++WN FY  +E
Sbjct: 516 LLRQDDTLKKISHIRGKIEASNDSDKV----LSGYMNMWNLFYKSLE 558

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 412/575 (71%), Gaps = 25/575 (4%)

Query: 10  DHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGI 69
           D   +KKY++H GI+FCIEL+ +M+ +V ELN+K+QL+EILESL ELMSQL++  P+TG+
Sbjct: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74

Query: 70  GCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLD 129
           GCYF  C++ N  S++GIYEF PL+DVNA++MKK++DL+EDL  KR TL E F F P+LD
Sbjct: 75  GCYFFQCNKDN--SEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLD 132

Query: 130 NDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIV 189
                 V LE++  FL +QF K   +   Y++ K+FLFTDN  P+   + ++   +R+IV
Sbjct: 133 ------VSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIV 186

Query: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249
           +D+ND YINF  FFI  E KPF  SFYS+ILKL +K +       DG+       +DGPN
Sbjct: 187 NDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTD-----YVDGS-----EMFDGPN 236

Query: 250 TTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYE 309
           TTPIPASYIKS++ RKKE +R  FQCPLIL + NNF +S++GY I++ EKP TRYKLVYE
Sbjct: 237 TTPIPASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYE 296

Query: 310 HENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFL 369
           +E +RKEA S R++L+ +TG ++  D++ K+FPYGD++IEL+ +++AK++     + SFL
Sbjct: 297 NEQLRKEAFSHRRYLDASTGVDVS-DKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFL 355

Query: 370 KVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKS 429
           K+IGFRST   + Y+NN+DK  FVVPDE  YEG+I+ MASL+R L+ + K  +VWGK+K 
Sbjct: 356 KIIGFRSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKI 415

Query: 430 NSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENI 489
           NSN  +Y+++P+T  D NEGFYL RIPF+DEIR+FP +  Y  + +S+DY ++ + TE I
Sbjct: 416 NSNPGIYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETI 475

Query: 490 IGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNK 549
           I YFNL+ GY+PS+FKNP LQ ++  LHD LL+     +E+  +D +      +DDTL K
Sbjct: 476 IAYFNLRNGYKPSEFKNPGLQHYFSLLHDQLLE----AKEESSADEEQESL--KDDTLLK 529

Query: 550 ILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIK 584
           +  IR+KII S +SD+  +QRLSKY   WNT Y K
Sbjct: 530 LSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK 564

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/575 (50%), Positives = 398/575 (69%), Gaps = 25/575 (4%)

Query: 14  FKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCYF 73
           ++K+++HEGIIFCIELSK MFE+  ++N KVQL+EILE+L ELMSQ++I  P TGIGCYF
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 74  HYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDSQ 133
            +C  +N  +  GIYE  PL DVNAR MKK++DL++D+T    TL + F  D       Q
Sbjct: 69  FHCGHEN--ATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLD------EQ 120

Query: 134 KRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDMN 193
              PLET+F  L +QF         Y++KKIFLFTDNDSP E +D D  LR+R++VDD++
Sbjct: 121 LSTPLETVFILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLD 180

Query: 194 DNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTPI 253
           D +INF TFFIG E KPF  SFYS+ILKLG+K           T  +  S ++GP+T PI
Sbjct: 181 DCHINFTTFFIGTEQKPFDQSFYSDILKLGAK----------KTASQGGSTFNGPSTAPI 230

Query: 254 PASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENI 313
            A+ IK++ LRKKEIKR  FQC L L E  +F VS++GY +V+ E+  T+YK VY+H  +
Sbjct: 231 NANLIKARALRKKEIKRIRFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGL 290

Query: 314 RKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVIG 373
           RKE  S RK+LN NTGE++  D + +VF + + DIE +++E+AKI+ DYS ++SFLK+IG
Sbjct: 291 RKEVISHRKYLNANTGEDVT-DSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIG 349

Query: 374 FRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNL 433
           FR T   + +++NI  + FVVPDES  EG+IKTM+SLFR L K+ K  +VWGK+KSNSN 
Sbjct: 350 FRDTSKCLFFYDNIGNSSFVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNP 409

Query: 434 RLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGYF 493
            +YILSP+T+ D NEGFYL R+PF+DE+RKFP +  Y+     +++  + +ITE +I YF
Sbjct: 410 AVYILSPSTSKDLNEGFYLTRVPFVDEVRKFPPIPRYDEELGGKNFEQMCKITETLISYF 469

Query: 494 NLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILHI 553
           +L++ Y+PSDFKNP+LQ+H+K L+DYLLQVE     +   DG     LK DDTL K+  +
Sbjct: 470 SLRRPYKPSDFKNPTLQKHFKLLYDYLLQVEVDCSSES-VDGA----LKHDDTLLKLYQV 524

Query: 554 REKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKE 588
           R KI  S  S D  ++RL  YV  WN+ Y K+  +
Sbjct: 525 RRKIQESLSSKDPEEERLGTYVKAWNSLYNKISNQ 559

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/587 (51%), Positives = 402/587 (68%), Gaps = 33/587 (5%)

Query: 10  DHP--SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPST 67
           D+P  S++KY+ HEG +FCIELS+ MF E+ +LNYKVQL+E+LESL ELMSQLVI RPST
Sbjct: 29  DNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPST 88

Query: 68  GIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPT 127
           G+GC+F  CD  N +SK  IYEF PLRD+N  DMKK+ DL++D+  +R+++ + F FD  
Sbjct: 89  GVGCFFFNCD--NKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEI 146

Query: 128 LDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRR 187
            D    K   LE+LF  + D+F+        Y +KK+FLFTDND P E NDK+ T+R+RR
Sbjct: 147 ND----KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRR 202

Query: 188 IVDDMNDNYINFVTFFIGR--EGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEY 245
           + DD++DNYI FVTFFI +      F +SFYS+ILKL                +    E+
Sbjct: 203 LFDDISDNYIQFVTFFINKIDSSDNFDDSFYSDILKLR---------------NSNSIEF 247

Query: 246 DGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYK 305
           DGP+T PI  +YIK+K+LRKKEIKR MFQCPLIL  +++F V+V+GY I++ EKP +RYK
Sbjct: 248 DGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYK 307

Query: 306 LVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKH 365
           LVYEHENIR+EA S+RK LN  TG  +  D+  K+F  G+  I   + E  K ND+    
Sbjct: 308 LVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQ 367

Query: 366 ESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWG 425
           E FLK+IGFRS +NS+  FNNI KALF+VPDES+  G+I+T++S++R ++ +++  IVWG
Sbjct: 368 EPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWG 427

Query: 426 KVKSNSNLRLYILSPT-TNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-----DY 479
           K+KSNSN  ++ILSP+    D+NEGFYLY++PFLDEIRK P    Y H  + E     DY
Sbjct: 428 KLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKIPS--QYTHFPSDELIRNKDY 485

Query: 480 LNLVRITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSR 539
            NL R+T NI+GYFNL  GY P +FKNP LQ++YK LHDYLLQVE     +   +    +
Sbjct: 486 ENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQK 545

Query: 540 FLKEDDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKME 586
            L+EDDT+ K   IR+KII S  S +  +QRLS   ++WN  Y K+E
Sbjct: 546 ILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLE 592

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/569 (51%), Positives = 406/569 (71%), Gaps = 25/569 (4%)

Query: 14  FKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCYF 73
           +KK+++HEGIIFC+ELS++MF+E  +LN KVQLLEILE+L ELM+Q++II P TGIGC+F
Sbjct: 16  YKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQVIIILPGTGIGCFF 74

Query: 74  HYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDSQ 133
             C  +   +K GIYEF PL DVNAR MKK++DL++DL +   TL E F F     ND Q
Sbjct: 75  FQCSHEG--AKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPF-----NDKQ 127

Query: 134 KRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDMN 193
               LE +F  L +QF++       Y++KKIFLFTDND P E +D++A  R+R+++DD++
Sbjct: 128 -NTSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLD 186

Query: 194 DNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTPI 253
           D++IN + FF+G E +PF  SFYS+ILKLG+K        SDG       +Y+GPNTTPI
Sbjct: 187 DSFINIIPFFVGSEQRPFDQSFYSDILKLGAKKK-----ASDGP-----FKYEGPNTTPI 236

Query: 254 PASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENI 313
            A  IKS++LRKKEIKR  FQC LIL E ++F VS++GY  ++ E+  ++YK VY+H+ +
Sbjct: 237 SAKLIKSRVLRKKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGL 296

Query: 314 RKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVIG 373
           RKEA S RK+L+ NTGE++  + + KVF + + DIEL++ E+AK+N DYS ++SFLK++G
Sbjct: 297 RKEALSHRKYLDANTGEDVT-ERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVG 355

Query: 374 FRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNL 433
           FR T   + YFNNI  + FVVPD+S ++G+IKTMASLFR L+++ K  +VWGK+KSNSN 
Sbjct: 356 FRDTNRCVFYFNNISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNP 415

Query: 434 RLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGYF 493
            LY L+P+   D NEGFYL R+PF+DEIRKFP    + +++ ++ +  + +ITE +I YF
Sbjct: 416 SLYTLTPSNFNDHNEGFYLTRVPFIDEIRKFPPTAYHGNLSKTKTFEQMCKITETLISYF 475

Query: 494 NLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILHI 553
           +L+  YRPSDF+NP+LQ+H++ LHDYLLQVE        + G     LK+DDTL K+  +
Sbjct: 476 SLRHSYRPSDFENPTLQKHFELLHDYLLQVEV-----DPTSGSKEHLLKKDDTLLKLHQV 530

Query: 554 REKIIASKESDDVTQQRLSKYVSLWNTFY 582
           R KI+ S ESDD  Q RLS YV  WN+ Y
Sbjct: 531 RAKILESAESDDPVQARLSNYVKAWNSMY 559

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/604 (45%), Positives = 403/604 (66%), Gaps = 30/604 (4%)

Query: 4   DEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVII 63
           D+ +  DH  +++Y+ H+GI+FCI+L+ +M+   P+L  K+QLLEIL+SL++LMSQLV++
Sbjct: 18  DDDKESDHKKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVV 77

Query: 64  RPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFN 123
            PST +GCY + C   N +  + +YE  PLRDVN ++MK+VSDL+ED+   RI L     
Sbjct: 78  MPSTAVGCYIYNCSHPNAE--DNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLK---- 131

Query: 124 FDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATL 183
            D     D    + L  +   + + F +      +  +KKIF FTD+D P E  + D+  
Sbjct: 132 -DEIPIADPNNPIELSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRS 190

Query: 184 RIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYS 243
           R+R++VDD+ D YINFVTFFIG E KPF +S Y++ILK GSK+N+   AQS       + 
Sbjct: 191 RLRKVVDDLYDYYINFVTFFIGSEDKPFDDSMYADILKWGSKINE---AQS-------WL 240

Query: 244 EYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATR 303
              GP+T PI ASYIKSK+ R KEIKR  F+CPL+L E  + +VSV GY IV+ E P ++
Sbjct: 241 SSHGPSTNPINASYIKSKVKRTKEIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSK 300

Query: 304 YKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYS 363
           YKLVY + ++R+EA S R++L+  TGE +   +L KV+ +GD+ IEL + E  KI   YS
Sbjct: 301 YKLVYANGSVRREAYSHREYLDAETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYS 360

Query: 364 KHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIV 423
           +HESFLK+IGFRST+  + Y++NID   FVVP+E  Y G+IKT+ASL+R +  + K  +V
Sbjct: 361 EHESFLKLIGFRSTEQCLHYYDNIDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMV 420

Query: 424 WGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLV 483
           WGK++ NS   +++L+P++  D N+GFYLY++PF++E+RK P  L+++ +  S+DY  + 
Sbjct: 421 WGKLRPNSPPSMFVLTPSSKKDYNQGFYLYKVPFMEEVRKLPDFLNHSALIESDDYKVMS 480

Query: 484 RITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE 543
           ++TE +I +FNLK GYRPSDF NP+LQ+H+K L +YLLQ+E    +  D         + 
Sbjct: 481 KVTETLINFFNLKNGYRPSDFHNPALQKHFKILREYLLQIEVDKSKPED---------EG 531

Query: 544 DDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDT-SHKLKKG 602
           D+TL K+  I  +I +S +SDDV QQRL KY+ LWN+FY ++   S +++DT   K KK 
Sbjct: 532 DETLQKVKQIYARIASSAKSDDVKQQRLVKYLKLWNSFYNRL---SNLEVDTKPTKNKKA 588

Query: 603 KFEL 606
           K  L
Sbjct: 589 KLNL 592

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/644 (45%), Positives = 414/644 (64%), Gaps = 45/644 (6%)

Query: 3   VDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVI 62
           +D+ +   + S+KK+ IHEGIIFC+ELS  MFE +PEL  K QLLEILESL +L  QL+I
Sbjct: 12  MDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLII 71

Query: 63  IRPSTGIGCY-FHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEY 121
            RP+T IG Y FH+       +K GIYEFF L D+N + MKKV+DL+EDL+  R  L + 
Sbjct: 72  SRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDI 131

Query: 122 FNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTA--DSNKYHSKKIFLFTDNDSPHEVNDK 179
           F FD      + +   LE +FN + +QF    +   S  ++ KK+FLFT+ND P E  + 
Sbjct: 132 FKFD------NSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENN 185

Query: 180 DATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKL-----GSKVNKENLAQS 234
           +   ++RR+V+D+N++ I F TFFI +    F ++FYS+ILKL      S+++ E+    
Sbjct: 186 ETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDD 245

Query: 235 DGTGDEEY-----------------------SEYDGPNTTPIPASYIKSKILRKKEIKRT 271
            G     Y                         +  PNT PI AS IK +ILRK+EI+R 
Sbjct: 246 AGENGNHYLLINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRV 305

Query: 272 MFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENIRKEASSRRKFLNPNTGEE 331
            FQCPLIL E +NFI+ + GY I + EKP TRYKLVYEHEN+RKEA SRRKFL+PNTGEE
Sbjct: 306 RFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEE 365

Query: 332 IKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVIGFRSTKNSIRYFNNIDKAL 391
           +K ++  KV+ YGD +IEL+D+    I ++Y ++  F+K++GFRS   S++Y+NNIDKA 
Sbjct: 366 LKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKAS 425

Query: 392 FVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLRLYILSPTTNIDRNEGFY 451
           FVVPDES YEG+IKTMASLFR L K+ K  IVWG   S  +  ++ILSP+   + NEG Y
Sbjct: 426 FVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLY 485

Query: 452 LYRIPFLDEIRKFPKLLDYNHITTS--EDYLNLVRITENIIGYFNLKKGYRPSDFKNPSL 509
           L+++PFLDEIR+FP L  Y+  T     +Y  + ++TE I+G  +L+KGYRPS ++NP+L
Sbjct: 486 LFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPAL 545

Query: 510 QRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILHIREKIIASKESDDVTQQ 569
           Q++YK LHDYLLQ+E     D   +    R + EDDTL ++  +R++II S ++ ++  Q
Sbjct: 546 QKYYKILHDYLLQIEDTSLTDTPQE-VLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQ 604

Query: 570 RLSKYVSLWNTFYIKMEKESGIDIDTS-----HKLKKGKFELNL 608
           RLSK++  WN  + K+ +++ +DI+ +      + +K K  LNL
Sbjct: 605 RLSKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/602 (46%), Positives = 400/602 (66%), Gaps = 27/602 (4%)

Query: 11  HPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIG 70
             SFK+++IHEGI+FCIELS+ MFE   EL+ K Q+  IL SL ELM  L++ RPST IG
Sbjct: 28  QASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPSTAIG 87

Query: 71  CYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDN 130
           CYF+ C+R+  DSK  I+EF PL D+N + MKKV+DL+ED++ +RIT  EY N++  +D 
Sbjct: 88  CYFYNCERE--DSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYN--IDQ 143

Query: 131 DSQKRVP--LETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRI 188
           + +  +P  LE LF+ +L+ F +      +++SKK+FLFTDND P+  + + +   ++ I
Sbjct: 144 NKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDVLKGI 203

Query: 189 VDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGP 248
           + D++DN INF  FFI ++ KPF  +FYS +L+        N    +  G + Y    GP
Sbjct: 204 LKDIDDNMINFTNFFISKKDKPFNPAFYSKVLR--------NDRDYNSLGSQAYF---GP 252

Query: 249 NTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVY 308
           +T PI  + IK +I ++KEI+R +FQCPL+L E  NF++S++GY+I   EK + RYKLVY
Sbjct: 253 STKPIGVNDIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVY 312

Query: 309 EHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESF 368
           E++ IRKEA S+RKF+NP TGE++   +  K+ PYG+++IE+ DK +A   + Y    + 
Sbjct: 313 ENQEIRKEAFSKRKFINPKTGEDVSK-QTVKIIPYGEKEIEMEDKNIANALNVYGNTSAS 371

Query: 369 LKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVK 428
           L VIGF +  NS+ ++NNIDK LF+ PDE+  EG+    ASLFR LKK  K  +VWG  K
Sbjct: 372 LTVIGFLNEDNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTK 431

Query: 429 SNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITEN 488
           SNS+  LY+L P+ + D N+GFYL ++PF+DEIRK+P L + N     E+Y N+  +T+ 
Sbjct: 432 SNSSPSLYLLWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELTQG 491

Query: 489 IIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLN 548
           II +FNLK GY   +F+NP+L RHYK LHDYLLQVE P     D +    R+L+EDDTL 
Sbjct: 492 IISHFNLKSGYHAEEFRNPALNRHYKLLHDYLLQVEIP----QDDNDIRDRYLREDDTLL 547

Query: 549 KILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLKKG--KFEL 606
           KI  IRE+I+     DDV ++RLSKY+ +WN +Y K ++++     TS  L K   K +L
Sbjct: 548 KITKIRERIMKDTTIDDVEKRRLSKYLEVWNIYYRKFKEDTN---QTSSSLLKSEKKPKL 604

Query: 607 NL 608
           NL
Sbjct: 605 NL 606

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  508 bits (1307), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 271/502 (53%), Positives = 366/502 (72%), Gaps = 23/502 (4%)

Query: 5   EIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIR 64
           E+ +G  PS++KYD+HEGI+FC+ELS+ MF+++PELNYKVQLLEILESL ELMSQLVI R
Sbjct: 32  EVPDGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITR 91

Query: 65  PSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNF 124
           P TG+GCY + C + N ++    +   PL DVN + MKKV+DL++DL+ +R TL +YF +
Sbjct: 92  PGTGVGCYIYNCHKDNSNNNIFNFI--PLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPY 149

Query: 125 DPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLR 184
           D T      +R PLE+L     D+  K  +    +++KK+FLFTDNDSP E +DK    R
Sbjct: 150 DKT------QRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKAR 203

Query: 185 IRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSE 244
           +RR+ DD N+N+I FV FFI RE KPF +SFYS+I KLG   N EN      + D E  E
Sbjct: 204 LRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFKLG---NSEN-----PSSDYEI-E 254

Query: 245 YDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRY 304
           +DGP+T PI ASYIKS++LRK+EIKR +FQC LIL +E NF V+++GY+IV+QEK  +RY
Sbjct: 255 FDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRY 314

Query: 305 KLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSK 364
           K+VYEHE++RKEA S+RK LN  T EE+K + L KVFPYGD +IEL+++++ K+ + Y +
Sbjct: 315 KMVYEHEDVRKEAFSKRKILNCITAEEVK-EGLTKVFPYGDLNIELSEEDIKKVKEAYLE 373

Query: 365 HESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVW 424
              FLK++GFRS + S+ Y+NNI K  FVVPDES+ +G+I+ +ASLFR ++K++K  ++W
Sbjct: 374 DGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLW 433

Query: 425 GKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKL----LDYNHITTSEDYL 480
           GK+K NS+  L++LS +   D NEGF+LYRIPFLDEIRKFP +       N + T E Y 
Sbjct: 434 GKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIE-YE 492

Query: 481 NLVRITENIIGYFNLKKGYRPS 502
           N+ R TENI+GYFNLK GY PS
Sbjct: 493 NIKRTTENIVGYFNLKHGYIPS 514

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  409 bits (1051), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 241/573 (42%), Positives = 342/573 (59%), Gaps = 39/573 (6%)

Query: 16  KYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCYFHY 75
           +Y++HEGI+FC+ELS +M++  PEL  K QLLEILE+L ELM QLV + P TG+GCYF  
Sbjct: 27  RYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGCYFFQ 86

Query: 76  CDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDSQKR 135
           C  ++ ++K GIYE FPLRDVN   MKKV  L+E +   + +L E       L  D +  
Sbjct: 87  C--RHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEE------ELPYDGRHP 138

Query: 136 VPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDMNDN 195
             L+ +F  + DQF +   +   Y++KKIFLFTDNDSP E     +  R+R++VDD+ND 
Sbjct: 139 TSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDY 198

Query: 196 YINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTPIPA 255
           YINF TFFIG E +PF  SFYS+ILKLG++V  E  ++           YDGP+T PI  
Sbjct: 199 YINFSTFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKP---------LYDGPSTKPISV 249

Query: 256 SYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENIRK 315
           SYI+S++LRKKE++R  + CPL L EE   +VSV+GYA  T E+P  RY++VY+HE++++
Sbjct: 250 SYIRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQR 309

Query: 316 EASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDK-EVAKINDDYSKHESFLKVIGF 374
           EA S R++L+P+TGEE   D LCKV+  GD  ++L D  E    N      +SFL+++G 
Sbjct: 310 EAFSHRRYLDPDTGEEATED-LCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGS 368

Query: 375 RSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLR 434
           R+    + Y+NNI    F+VPD+S Y G+   +ASL R L+   + ++++GK+++ S   
Sbjct: 369 RTAVAVLPYYNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPA 428

Query: 435 LYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGYFN 494
           LY L+P      +  F L R+PF +E+RKFP L        S DY  L +IT  II    
Sbjct: 429 LYALAPAAAPLPDAVFILARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRIIDLLV 488

Query: 495 LKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILHIR 554
           L   Y P+DFKNP +  H++ L D+L +  Q  R               DDT      I 
Sbjct: 489 LSSPYAPADFKNPVIATHFRLLSDHLFETAQDPR--------------TDDT------IA 528

Query: 555 EKIIASKESDDVTQQRLSKYVSLWNTFYIKMEK 587
             +       D  + RL+KY+  WN FY + ++
Sbjct: 529 RLLRLRHRVLDDPESRLAKYLRHWNAFYARHQQ 561

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  369 bits (946), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/581 (36%), Positives = 339/581 (58%), Gaps = 27/581 (4%)

Query: 4   DEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVII 63
           D +    H    K++  + II CIELS  +++   E++ K QL E+LE+L ELM QL ++
Sbjct: 5   DPLTKVQHSKNIKHERRQSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAML 63

Query: 64  RPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFN 123
            P++ + CY + C R N   K+GIYE  PL  VN + + K+S L+ D+  K++ L +   
Sbjct: 64  LPNSEVCCYVYQCRRLN--VKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIP 121

Query: 124 FDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATL 183
           F+  +D       PL ++   +  Q    T D  K+ +K+I L T ND P E  D +   
Sbjct: 122 FE-EIDGS-----PLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQK 175

Query: 184 RIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYS 243
           + +  ++ + D+  + VTFFI  + +PF ++FY+++LK   +   E+L       D+   
Sbjct: 176 KFKNTINALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRR--PEDL-------DKNIQ 226

Query: 244 EYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATR 303
            YDGPNT PI    +K K+L+KKE  +  F+C  I+ ++N+FI+S++G+  +TQEK   R
Sbjct: 227 YYDGPNTKPIEIKELKGKLLQKKEGNKFHFKCAFIINKQNDFIISLKGFFAITQEKAGER 286

Query: 304 YKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYS 363
           +K +Y+     ++A S RKF N N GE      L KVF  G  +IE  +++  K+ + +S
Sbjct: 287 FKYIYQKGAKPQDAFSHRKFYNANDGEAAD-SRLTKVFDIGGLNIEFTEEQDQKMINSFS 345

Query: 364 KHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIV 423
           +HE+FL++IGFRS      Y+NNI  + +V+PD++ YEG+ KT++ L+  + K+ K  IV
Sbjct: 346 EHETFLELIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIV 405

Query: 424 WGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLV 483
           WGK+   ++ +L+++      + N+GFYL R+PF++EIR+FP+ L  N     ++Y  + 
Sbjct: 406 WGKLTRIAHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMK 465

Query: 484 RITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE 543
           +IT NII +FNLK  YR ++F +P L+  Y TL D LLQ     +   D  G   + L  
Sbjct: 466 KITGNIIAFFNLKSSYRAAEFPSPVLKSFYTTLSDKLLQ-----KSLSDQWGMGFK-LSN 519

Query: 544 DDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIK 584
           D TL K+ H+RE I  +K S ++ Q  L+KY+  WNT+Y K
Sbjct: 520 DITLGKVQHLRELI--NKSSQNMEQPILAKYMKYWNTYYNK 558

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  269 bits (688), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/567 (29%), Positives = 301/567 (53%), Gaps = 44/567 (7%)

Query: 18  DIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCYFHYCD 77
           D ++ I+ CIELS+++      L     +LE++ +L  ++ +L+I++P++ +GC      
Sbjct: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG 84

Query: 78  RKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDSQKRVP 137
           R+   +++GI E FPLR ++A  ++ +SD + DL    + + ++F F  T+         
Sbjct: 85  RR---AEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPAS------ 134

Query: 138 LETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDMNDNYI 197
           L+ +       FT+ T +++     +IFL TD D+P E  D     +++  +  +    I
Sbjct: 135 LDVMLAASDRYFTEDTQNADN----RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRI 190

Query: 198 NFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGP-NTTPIPAS 256
           +  TFF+  E   F +S Y+ ILK                   E+     P +T+P+   
Sbjct: 191 DITTFFLHTEHAAFNDSSYAEILK-----------------TREWGIPGAPQSTSPLSIC 233

Query: 257 YIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENIRKE 316
            ++ K+L +K++ R  F CPL++ +  + +VSV GY   T E+P TRYK + +H+   K 
Sbjct: 234 KLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKS 293

Query: 317 ASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVIGFRS 376
               RK+   +  + I+  +   V+  G   IE+ D E+ K+    SK+ESFL+++GFR+
Sbjct: 294 VHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRA 353

Query: 377 TKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLRLY 436
              +  Y++NI +A +++P E  + G+ K +ASL R + ++ K  IVWG++K+  +  L+
Sbjct: 354 INTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLF 413

Query: 437 ILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGYFNLK 496
            L P+          L RIPF++E+R FP L   + +  + +Y  +  +++N+I +F+L+
Sbjct: 414 ALIPSDG--ETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLR 471

Query: 497 KGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE-DDTLNKILHIRE 555
             YRPSD +NP L+  Y TL+      EQ   +D        ++L E D TL+K+  +R+
Sbjct: 472 TSYRPSDIRNPLLRNFYSTLYH-----EQ--SQDAKRKMPELQYLPESDSTLHKVQLVRD 524

Query: 556 KIIASKESDDVTQQRLSKYVSLWNTFY 582
           +I  S   D+     +S+Y++ WN +Y
Sbjct: 525 RIENSIIHDE--PPIISEYINCWNIYY 549

>TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.444
           YMR106C
          Length = 626

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 13/152 (8%)

Query: 332 IKPDELCKVFPYGDQDIELNDKEVAKINDDYS-KHESFLKVIGFRSTKNSIRYFNNIDKA 390
           + P+ + K F YG   + L     A IND  +  +++ + + GF +  +  RYF N +  
Sbjct: 317 VSPNSVSKAFRYGSDYVIL----PAVINDQRTMNNKANIDIRGFMNETSLPRYFLNSESK 372

Query: 391 LFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLRLYILSPTTN--IDRN- 447
                  +  +  + +M +L  VL +  K  IV    K N  + +  L P  +   DRN 
Sbjct: 373 FIFFDSRNGSKSDVYSMYALVDVLMENKKIAIVRYVQKHNGEVEMCALYPMVSKISDRNI 432

Query: 448 -EGFYLYRIPFLDE--IRKFPKLLDYNHITTS 476
              F L R+PF ++  +  FPKL+  N ++TS
Sbjct: 433 VRYFVLNRLPFAEDERVSDFPKLV--NRLSTS 462

>NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75
          Length = 1260

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 62  IIRPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEY 121
           II PSTG+G    + ++ +    N      P+   ++ D    S+ I      +  L E+
Sbjct: 335 IIPPSTGVGNVSSFVNQNSNPYHNQNTNMIPVLSSDSLDSVDYSNCI----FAKYNLKEF 390

Query: 122 FNFDPTLDNDSQ-KRVPLETLFNFL 145
           FN+DP  + D Q  R  L+T F  L
Sbjct: 391 FNYDPAFEFDEQLSRSFLDTFFTRL 415

>TDEL0A02190 Chr1 (394031..395911) [1881 bp, 626 aa] {ON} Anc_2.444
           YMR106C
          Length = 626

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 62/143 (43%), Gaps = 11/143 (7%)

Query: 332 IKPDELCKVFPYGDQDIELNDKEVAKINDD-YSKHESFLKVIGFRSTKNSIRYFNNIDKA 390
           + P+ + K + YG   + L     + +++  + +    + + GF   K   RYF N +  
Sbjct: 308 VAPESIAKAYRYGSDYVVLP----STLDEQRFYRTTPGIDIRGFLERKRLPRYFLNSESR 363

Query: 391 LFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLRLYILSPTT----NIDR 446
             +    S     I +   L   L ++DK ++     K N+ +++ ++ P      + D+
Sbjct: 364 FILADTRSGSVADIVSFNVLVDSLSEQDKLIVARFVAKPNAEVQMCMMCPMLVNDEHGDK 423

Query: 447 NEGFYLYRIPFLDE--IRKFPKL 467
                L R+PF ++  +  FP+L
Sbjct: 424 IRTLILNRLPFAEDERVASFPRL 446

>KNAG0B06120 Chr2 (1204380..1205225) [846 bp, 281 aa] {ON} Anc_4.253
           YLR393W
          Length = 281

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 92/255 (36%), Gaps = 50/255 (19%)

Query: 83  SKNGIYE--FFPLRDVNARDMKKVSDLIEDLTLKRITLLEYF-----NFDPTLDNDSQKR 135
           ++NG +   F P+   +  D  +V  L++ + L +            NF    D+D  +R
Sbjct: 15  ARNGFFNKFFQPIISASKPDEHQVEQLVKPVGLPKPPTASTVYSRGNNFRDLFDDDKTQR 74

Query: 136 ----VPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDS--PHEVNDKDATLRIRRIV 189
               + LE   + + D +T        + S K +   D     PH V    A    R  V
Sbjct: 75  RTEELTLELSKSGMYDMYTFRKTRGKMFLSPKSYWRADKALYFPHLVGTAVAPGSRRTNV 134

Query: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249
           +DM    I+ V  F  R G+     F++                  G G  E+  +   N
Sbjct: 135 EDMMRGKISVVRVFGNRVGEDISTEFFTK----------------QGQGTPEFESWQDVN 178

Query: 250 TTPIPASYIKSKILRKKEIKRTMF--------------------QCPLILKEENNFIVSV 289
           T  I  S+I++  L+   +K +M+                    Q P +++E+ N     
Sbjct: 179 TQLIEISWIENA-LKSFVMKLSMWSLRNHLSAQRQSKYVLCERKQLPFMIREQLNLNNLY 237

Query: 290 RGYAIVTQEKPATRY 304
            GY +V   +   R+
Sbjct: 238 TGYVLVVDPQLRIRW 252

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 187 RIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNK 228
           R+V +++D+ +  V F I  +  P K SF+ ++ KL  K+NK
Sbjct: 458 RVVSELSDSIVKVVGFKILLKSNPTKYSFWQSLKKLCEKLNK 499

>Kwal_47.18023 s47 complement(648144..650648) [2505 bp, 834 aa] {ON}
           YFL023W (FYV11) - Hypothetical ORF [contig 430] PARTIAL
          Length = 834

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (45%), Gaps = 20/135 (14%)

Query: 123 NFDPTLDNDSQKRVPLETLFNFL----------LDQFTKLTADSNKYHSKKIFLFTDNDS 172
           N  P+LDN S + V  E   N +          LD+F  ++A S K    +I + + NDS
Sbjct: 465 NASPSLDNKSAEAVDAERPLNDIVERDFTSSVGLDKFEPISAISTKLS--EIDMGSKNDS 522

Query: 173 PHEVNDKDATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSK-VNKENL 231
                   A   +  IV++ N   +N V     +   P K++  S++ K   K + K N+
Sbjct: 523 ------TKAEAEV-AIVEERNAPRVNEVNLAASKTETPPKHTQKSSLFKKTLKSLQKPNI 575

Query: 232 AQSDGTGDEEYSEYD 246
            +++ T   E+S+YD
Sbjct: 576 KRTNRTQPVEHSQYD 590

>KLLA0C09526g Chr3 (828109..829110) [1002 bp, 333 aa] {ON} highly
           similar to uniprot|Q6Q5I7 Saccharomyces cerevisiae
           YOR261C
          Length = 333

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 453 YRIPFLDEIRKFPKL--LDYNHITTSEDYLNLVRITENIIGYFNLKKGYRPSDFKNPSLQ 510
           + +PF +E  K P +  LD+N+I T  +    +   E +IG+++     R SD K   L 
Sbjct: 52  FALPF-EEDEKNPDVWFLDHNYIETMNEMCKKINAKEKLIGWYHSGGKLRASDLKINELF 110

Query: 511 RHYKTLHDYLLQVEQPVRED 530
           + Y T ++ +L +    +ED
Sbjct: 111 KKYSTNNNPVLLILDVKQED 130

>AAL116W Chr1 (141617..142597) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR261C (RPN8)
          Length = 326

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 453 YRIPFLDEIRKFPKL--LDYNHITTSEDYLNLVRITENIIGYFNLKKGYRPSDFKNPSLQ 510
           + +PF +E  K P +  LD+N+I    D    +   E +IG+++     R SD K   L 
Sbjct: 52  FALPF-EEDEKNPDVWFLDHNYIENMNDMCKKINAKEKMIGWYHSGPKLRSSDLKINGLF 110

Query: 511 RHYKTLHDYLLQVEQPVREDG 531
           + Y   +  LL V+  V++ G
Sbjct: 111 KKYTQGNSLLLIVD--VKQQG 129

>Suva_8.311 Chr8 complement(555127..556128) [1002 bp, 333 aa] {ON}
           YOR261C (REAL)
          Length = 333

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 453 YRIPFLDEIRKFPKL--LDYNHITTSEDYLNLVRITENIIGYFNLKKGYRPSDFKNPSLQ 510
           + +PF +E  K P +  LD+N+I    D    +   E +IG+++     R SD K   L 
Sbjct: 52  FALPF-EEDEKNPDVWFLDHNYIENMNDMCKKINAKEKLIGWYHSGPKLRASDLKINELF 110

Query: 511 RHYKTLHDYLLQVEQPVREDG 531
           + Y   +  LL V+  V++ G
Sbjct: 111 KKYTQSNPLLLIVD--VKQQG 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.138    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,955,709
Number of extensions: 3846787
Number of successful extensions: 12913
Number of sequences better than 10.0: 87
Number of HSP's gapped: 13278
Number of HSP's successfully gapped: 87
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)