Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C003108.850ON55655628320.0
NDAI0K003708.850ON56845418930.0
Suva_13.4758.850ON51545818030.0
CAGL0I02684g8.850ON49345918000.0
Kpol_237.18.850ON50345717920.0
YMR285C (NGL2)8.850ON51545817820.0
KAFR0L019608.850ON51145617680.0
TBLA0B029008.850ON52045617600.0
Smik_13.5018.850ON51545817570.0
Skud_13.4588.850ON51445817520.0
SAKL0D01166g8.850ON50543517460.0
ZYRO0C14872g8.850ON49643717400.0
TDEL0B001908.850ON49245617030.0
KNAG0K006508.850ON48245816990.0
TPHA0I003208.850ON52944316830.0
KLTH0C03608g8.850ON49545616720.0
Kwal_27.102048.850ON49443515540.0
KLLA0C06248g8.850ON51646115390.0
ABL118W8.850ON50445314980.0
Ecym_46198.850ON48745413980.0
NDAI0E002608.850ON49847512251e-163
NCAS0B002708.850ON47646511651e-155
TBLA0D033008.850ON48046411581e-154
CAGL0B02387g8.850ON4714689851e-128
Suva_13.258.850ON5024699791e-126
Smik_13.168.850ON5024569751e-126
KAFR0A028608.850ON4784679671e-125
YML118W (NGL3)8.850ON5054739671e-124
Skud_13.238.850ON4984739421e-121
KNAG0G034708.850ON4664728901e-113
KLLA0F15884g7.78ON7902161903e-14
KNAG0D048407.78ON7792271823e-13
ACR288W7.78ON7362381813e-13
SAKL0B10032g7.78ON7312351796e-13
Kwal_26.71127.78ON7422341761e-12
Ecym_73547.78ON7852161742e-12
KLTH0D02310g7.78ON7392321742e-12
Suva_1.457.78ON8312401733e-12
Skud_1.407.78ON8692461734e-12
KAFR0K006707.78ON7952151724e-12
NDAI0H025207.78ON8982151708e-12
CAGL0H06149g7.78ON8732371691e-11
ZYRO0D05302g7.78ON8572161662e-11
Kpol_1040.147.78ON7842381644e-11
TDEL0H037307.78ON7972351619e-11
YAL021C (CCR4)7.78ON8372221601e-10
Smik_1.457.78ON8392221591e-10
TPHA0H026807.78ON8722221582e-10
NCAS0F016407.78ON8552341502e-09
TBLA0A046607.78ON8962151431e-08
KLLA0F07733g7.90ON3712371312e-07
ZYRO0D05588g7.90ON3562471242e-06
ACR277C7.90ON3782661242e-06
KNAG0L005507.90ON3812381223e-06
TBLA0E022607.90ON3882771214e-06
KAFR0D012507.90ON3562351205e-06
Kwal_26.71707.90ON3722401189e-06
KLTH0D02574g7.90ON3682461152e-05
SAKL0B09768g7.90ON3682481124e-05
TPHA0L005307.90ON3912511116e-05
Ecym_26367.90ON3672371107e-05
Kpol_1044.67.90ON3722511108e-05
NCAS0I005007.90ON3892471062e-04
NDAI0A085307.90ON3652411044e-04
CAGL0F01001g7.90ON3592401000.001
TDEL0H036007.90ON366247990.002
Smik_15.1257.90ON363239850.077
Suva_15.1277.90ON363239840.12
Skud_15.1157.90ON36396830.14
YOL042W (NGL1)7.90ON36381800.31
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00310
         (556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850     1095   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   733   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   699   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   697   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   694   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   691   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   685   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   682   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   681   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   679   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   677   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   674   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   660   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   659   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   652   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   648   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   603   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   597   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   581   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   543   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   476   e-163
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      453   e-155
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   450   e-154
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   384   e-128
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   381   e-126
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   380   e-126
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   377   e-125
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   377   e-124
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   367   e-121
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   347   e-113
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    78   3e-14
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    75   3e-13
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    74   3e-13
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    74   6e-13
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    72   1e-12
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    72   2e-12
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    72   2e-12
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    71   3e-12
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    71   4e-12
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    71   4e-12
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      70   8e-12
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    70   1e-11
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    69   2e-11
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    68   4e-11
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    67   9e-11
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    66   1e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    66   1e-10
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    65   2e-10
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      62   2e-09
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    60   1e-08
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    55   2e-07
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    52   2e-06
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    52   2e-06
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    52   3e-06
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    51   4e-06
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    51   5e-06
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    50   9e-06
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    49   2e-05
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    48   4e-05
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    47   6e-05
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    47   7e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    47   8e-05
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    45   2e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    45   4e-04
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    43   0.001
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    43   0.002
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    37   0.077
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    37   0.12 
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    37   0.14 
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    35   0.31 

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/556 (94%), Positives = 527/556 (94%)

Query: 1   MNILKKVFSPNSKDVLTAEKIGEQQGDDKEMNKEPFVMVDAPPVETATPDQYQKSESKVE 60
           MNILKKVFSPNSKDVLTAEKIGEQQGDDKEMNKEPFVMVDAPPVETATPDQYQKSESKVE
Sbjct: 1   MNILKKVFSPNSKDVLTAEKIGEQQGDDKEMNKEPFVMVDAPPVETATPDQYQKSESKVE 60

Query: 61  MDLETKINENPAKEPNIETKNVPNSHXXXXXXXXXXXXXXXXXEEIAKIRAERQAKKEAA 120
           MDLETKINENPAKEPNIETKNVPNSH                 EEIAKIRAERQAKKEAA
Sbjct: 61  MDLETKINENPAKEPNIETKNVPNSHKSKKKSKGKSKGKKPSPEEIAKIRAERQAKKEAA 120

Query: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180
           LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK
Sbjct: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180

Query: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240
           WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII
Sbjct: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240

Query: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300
           WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV
Sbjct: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300

Query: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360
           GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF
Sbjct: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360

Query: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXXXXXXXNIEKFGKDQPQTPV 420
           DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR            NIEKFGKDQPQTPV
Sbjct: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTPV 420

Query: 421 PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH 480
           PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH
Sbjct: 421 PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH 480

Query: 481 TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG 540
           TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG
Sbjct: 481 TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG 540

Query: 541 EYPSDHLSMICELELI 556
           EYPSDHLSMICELELI
Sbjct: 541 EYPSDHLSMICELELI 556

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/454 (73%), Positives = 387/454 (85%), Gaps = 6/454 (1%)

Query: 104 EEIAKIRAERQAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLA 163
           EEIAK+RAER+  KEA     + P   P+LQFI+RPIL+LHEEEPV GFK S+MTYNCLA
Sbjct: 120 EEIAKLRAERKLLKEAKKEVSVIP---PELQFIKRPILYLHEEEPVQGFKFSMMTYNCLA 176

Query: 164 QALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGY 223
           QALIRRKLFPDSGDALKW++RSKVL NEF +Y+PD+ICLQE+DH+QYQSFWK EFEK+GY
Sbjct: 177 QALIRRKLFPDSGDALKWYRRSKVLLNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGY 236

Query: 224 ESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTE 283
           +SQ+HRK  KNHGV+IIWR+ LFT+TDKMLI+FDKE SG +PPRTTTNN GL LSLKFT 
Sbjct: 237 QSQYHRKGVKNHGVSIIWRRSLFTMTDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTP 296

Query: 284 KALSKFSN-GTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDG 342
           +A ++F N  T++ GII+GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHR+NVLQNNND 
Sbjct: 297 EAKAQFKNVETTKTGIIIGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDR 356

Query: 343 DTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXXX 402
           D SHWYPFFCGDFNSQPFD+PYLSM  KP+ Y GRAKTVIECSTSYKFSKKR        
Sbjct: 357 DLSHWYPFFCGDFNSQPFDSPYLSMVRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDD 416

Query: 403 XXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPE 462
               NIEKFG DQPQTPVP+ FIAN EQ  LVK+ME LHNSL+MRAISLYGVGY+ VHPE
Sbjct: 417 EEGGNIEKFGIDQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPE 476

Query: 463 NAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLR 522
           NA +DN+CGEPEISNWAHTWNGLLDY+LF+K W F DC   +TL++FE+ NS+++RG+LR
Sbjct: 477 NASIDNECGEPEISNWAHTWNGLLDYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLR 536

Query: 523 MPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           MPP+ EM+K  HGQPH GEYPSDHLSM+C +EL+
Sbjct: 537 MPPANEMTK--HGQPHVGEYPSDHLSMLCSIELL 568

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/458 (70%), Positives = 376/458 (82%), Gaps = 8/458 (1%)

Query: 104 EEIAKIRAER----QAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IAK+RAER    +AK+++ LAQG+DP+  P+L FI+RP L LHEEEPVTGF+  +MTY
Sbjct: 58  EHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTY 117

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSGDALKW++RS+VL NEF+HYN DVICLQEIDH+Q+QSFWK EF 
Sbjct: 118 NCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFS 177

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GYE Q+HR  +KNHGVAIIWR+++F   DKMLIDFDKE SG IP RTTTNN GL L+L
Sbjct: 178 KLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLAL 237

Query: 280 KFTEKALSKFSNGTSR-MGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQN 338
           KF+EK LS     +S+  GI++GT+HLFWHPFGTYERTRQCY+VL KM+EFMHR+NVLQN
Sbjct: 238 KFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQN 297

Query: 339 NNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXX 398
            NDGD SHW+PFFCGDFNSQPFDTPYLSMT KP+HY+ RAKTVIECSTS+KFSK R    
Sbjct: 298 ENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGEE 357

Query: 399 XXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRK 458
                   NIEKFGKDQP++PVP  F ANEEQ +LV  M  LHNSLDMRA+SLY V Y+ 
Sbjct: 358 GADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKN 417

Query: 459 VHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGF-DDCQHVDTLEKFEKENSIKV 517
           VHPENAGLDND GEPEISNWA+TW GLLDY+ +IK W    +CQ VD+L+ FEK+N IK 
Sbjct: 418 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKF 477

Query: 518 RGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           RG+LRMPP +EM+K  HGQPH GEY SDHLSM+C++EL
Sbjct: 478 RGFLRMPPGSEMTK--HGQPHVGEYASDHLSMVCDIEL 513

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/459 (71%), Positives = 376/459 (81%), Gaps = 11/459 (2%)

Query: 104 EEIAKIRAERQAKKEA----ALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           EEIA+IRAER+A +EA     L +G+DP+  P+LQFI+R +L LHEEEPV G KI IM+Y
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSY 97

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSG+ALKW++RS+VL NEFKHY+PDV+CLQEID++QYQSFWK EF+
Sbjct: 98  NCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ 157

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY SQFHRK SKNHGV IIW+ E F ++D+MLIDFD E SG+I PRTTTNNA L L+L
Sbjct: 158 KLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILAL 217

Query: 280 KFTEKAL---SKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVL 336
           KFT+K      K  +  S  GI+VGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHR+NVL
Sbjct: 218 KFTQKVKMMGKKLLDDKS--GILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVL 275

Query: 337 QNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXX 396
           QNNNDGD SHWYPFFCGDFNSQPFD+PYLSMT KPI Y  RAKTVIECSTS+KFSKKR  
Sbjct: 276 QNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRES 335

Query: 397 XXXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGY 456
                     NIEKFGKDQPQTPVP+ F+AN+EQ KLV  ME LHNSLDMRA+SLY V Y
Sbjct: 336 GEDAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAY 395

Query: 457 RKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIK 516
            KVHPEN+GLDN+ GEPEISNWAHTW GLLDY+  I++W FDD   +DTLE FE  N+IK
Sbjct: 396 HKVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIK 455

Query: 517 VRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           +RG LRMPP +EMS   HGQPH GEYPSDHL ++ E+EL
Sbjct: 456 IRGLLRMPPGSEMST--HGQPHVGEYPSDHLCLLSEVEL 492

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/457 (71%), Positives = 372/457 (81%), Gaps = 6/457 (1%)

Query: 104 EEIAKIRAERQAKKEAA----LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           EEI + RAER A KE      LA+GLDP+  P+LQFI+RP+LHLH++EPVTGF  ++MTY
Sbjct: 48  EEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTY 107

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSG+A+KWF+RSKVL  EF+HYN DVICLQEIDH+QYQ+FWK EFE
Sbjct: 108 NCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFE 167

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GYESQFHR  SKNHGVAI+W++E+F +TD+MLIDFDKE S +IPPRT TNN GL LSL
Sbjct: 168 KLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSL 227

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
           KF++K LS     T   GII+GTTHLFWHPFGTYERTRQCYV+LNKMKEFMHR+NVLQN 
Sbjct: 228 KFSDKILSTLPKNTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNG 287

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXX 399
           NDGD SHW PFFCGDFNSQPFD+PYLSMTSKPI Y  RAKTVI+CSTSYKFSK R     
Sbjct: 288 NDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEED 347

Query: 400 XXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKV 459
                  NIEKFGKDQPQTPVP+ FIANEEQ  LV+ M ++HN L MRA SLY VGY+ V
Sbjct: 348 VDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHV 407

Query: 460 HPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRG 519
           H ENAG+DN  GEP ISNWA+TW GLLDYI  +  W FD+ Q VD+LEKFE ENSI++RG
Sbjct: 408 HAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRG 467

Query: 520 YLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           +LRMP  +EM K  HGQPH GEY SDHLSMIC +EL+
Sbjct: 468 FLRMPLDSEMPK--HGQPHEGEYASDHLSMICNIELL 502

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/458 (70%), Positives = 373/458 (81%), Gaps = 8/458 (1%)

Query: 104 EEIAKIRAERQ----AKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IAK+RAER+    AK++A LAQG+DP+  P+L FI+RP L LHE EPVTGF+  +MTY
Sbjct: 58  EHIAKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTY 117

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSGDALKW++RSKVL NEFK+YN DVICLQEIDH+Q+QSFWK EF 
Sbjct: 118 NCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFS 177

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY+ Q++R  +KNHGVAI+WR+ELF   DKMLID+DKE S  I  RTTTNN GL L+L
Sbjct: 178 KLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLAL 237

Query: 280 KFTEKALSKFSNGTSR-MGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQN 338
           KF+EK LS     +S+  GI++GTTHLFWHPFGTYERTRQCY+VL KMKEFMHR+NVLQN
Sbjct: 238 KFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQN 297

Query: 339 NNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXX 398
            NDGD SHW+PFFCGDFNSQPFDTPYLSMTSKP+HY+ RAKTVI CSTSYKFSK R    
Sbjct: 298 ENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEE 357

Query: 399 XXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRK 458
                   NIEK+GKDQP++PVP+ F ANEEQ +LV  M  LHNSLDMRAISLY VGY+ 
Sbjct: 358 GADDEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKN 417

Query: 459 VHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWG-FDDCQHVDTLEKFEKENSIKV 517
           VHPENAGLDND GEPEISNWA+TW GLLDY+ ++K W    +CQ V+TL  FEKEN +K 
Sbjct: 418 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKC 477

Query: 518 RGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           RG+LRMPP  EM+K  HGQPH GEY SDHLSM+C+LEL
Sbjct: 478 RGFLRMPPGNEMTK--HGQPHVGEYASDHLSMVCDLEL 513

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/456 (70%), Positives = 366/456 (80%), Gaps = 5/456 (1%)

Query: 104 EEIAKIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IAK+RAER+A    K+EA LAQGLDP+  P+LQFI+RP+L L + E   GF+  IMTY
Sbjct: 55  EHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMTY 114

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSG+A+KWF+RSKVL NEFK+Y+ DVICLQE+D +Q+Q+FWK EF+
Sbjct: 115 NCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFD 174

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY+SQFH K SKNHG++I+W++ LFT+TDKMLID+DKE SG IPPRTTTNN GL L+L
Sbjct: 175 KLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLAL 234

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
           KF+ K L +F N T + GIIVGTTHLFWHPFGTYERTRQCY+VLNK KEFMHR+NVLQNN
Sbjct: 235 KFSPKVLERFPN-TRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNN 293

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXX 399
           ND    HWY FF GDFNSQPFDTPYLSMTSKP+ Y  RAKTVIECSTSY FSK R     
Sbjct: 294 NDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGEED 353

Query: 400 XXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKV 459
                  NIEKFGKDQP TPVP  F A+ EQ+ LV NME LHNSLDMRAISLY VGY  V
Sbjct: 354 AEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTV 413

Query: 460 HPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRG 519
           H ENAGLDN  GEPEISNWAH WNGLLDY+  IK W F D   VD+L+KFE EN +KV+ 
Sbjct: 414 HIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKA 473

Query: 520 YLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           +L+MP   EM K GHGQPH GEYPSDHLSMIC+LEL
Sbjct: 474 FLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/456 (68%), Positives = 373/456 (81%), Gaps = 7/456 (1%)

Query: 104 EEIAKIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IA++RA+R+A    K++A LAQG+DP+   +LQFI+RPIL +HE EPV GFK S+MTY
Sbjct: 66  EHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTY 125

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFP+ GDALKW +RSKVL NEFKHYNPD+ICLQEIDH+QYQSFWK EF 
Sbjct: 126 NCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFS 185

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GYE QF++K SKNHGV+++W+KELF +TD+ML+D+DKE SG+I PRTTTNN  L LSL
Sbjct: 186 KLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSL 245

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
           KF++K   +F    ++ GI++GTTHLFWHPFGTYERTRQCY++LNKMKEF+ R+N+LQNN
Sbjct: 246 KFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNN 305

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXX 399
            D D SHWYPFFCGDFNSQPFD+PYLSMTSKPI Y GR+KTVIECSTS+KFSKKR     
Sbjct: 306 GDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR-DGEE 364

Query: 400 XXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKV 459
                  NIEKFGKDQPQ PVPD + AN+EQK LV  M+ LHNSLDMRAISLY  GY KV
Sbjct: 365 GDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKV 424

Query: 460 HPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRG 519
           HPEN+G+DN+  EPEISNWAH W GLLDY+ +IK W F   + +D+LE FE+EN IK+RG
Sbjct: 425 HPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRG 484

Query: 520 YLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           YLRMPP+ E+    HGQP  GEYPSDHL M+CE+EL
Sbjct: 485 YLRMPPAKELP--SHGQPFEGEYPSDHLCMLCEVEL 518

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/458 (70%), Positives = 374/458 (81%), Gaps = 8/458 (1%)

Query: 104 EEIAKIRAER----QAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IAKIRAER    +AK++A LAQG+DP+  P+L FI+RP L LHE+EPVTGF+  +MTY
Sbjct: 58  EHIAKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTY 117

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSGDALKW++RS+VL NEFK+Y  DVICLQEIDH+Q+QSFWK EF 
Sbjct: 118 NCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFN 177

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY+ Q++R  +KNHGVAI+WR+E+F   DKMLID+DKE S  I  RTTTNN GL L+L
Sbjct: 178 KLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLAL 237

Query: 280 KFTEKALSKFSNGTSR-MGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQN 338
           KF+EK LS  S  +S+  GI++GTTHLFWHPFGTYERTRQCYVVL KMKEFMHR+NVLQN
Sbjct: 238 KFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQN 297

Query: 339 NNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXX 398
            NDGD SHW+PFFCGDFNSQPFDTPYLSMTSKP+HYK RAKTVIECSTS+KFSK R    
Sbjct: 298 ENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGDE 357

Query: 399 XXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRK 458
                   NIEK+GKDQP++PVP+++ ANEEQ +LV  M  LHNSLDMRAISLY VGYR 
Sbjct: 358 SADDEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRN 417

Query: 459 VHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGF-DDCQHVDTLEKFEKENSIKV 517
           VHPENAGLDND GEPEISNWA+TW GLLDY+ ++K W    +CQ V+ L  FEK N +K 
Sbjct: 418 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKC 477

Query: 518 RGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           RG+LRMPP  EM+K  HGQPH GEY SDHLSM+C+LEL
Sbjct: 478 RGFLRMPPGKEMTK--HGQPHVGEYASDHLSMVCDLEL 513

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/458 (69%), Positives = 373/458 (81%), Gaps = 8/458 (1%)

Query: 104 EEIAKIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IAK+RAER+A    K++A LA G+DP+  P+L FIQRP+L L E EPVTGF+  +MTY
Sbjct: 57  EHIAKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTY 116

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSGDALKWF+RSKVL NEFK+YN DVICLQE+DH+Q+QSFWK +F 
Sbjct: 117 NCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFN 176

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY+ Q+HR  +KNHGVAIIWR+ +F   DKMLID+DKE SG I  RTTTNN GL L+L
Sbjct: 177 KMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLAL 236

Query: 280 KFT-EKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQN 338
           KF+ E         + + GI++GTTHLFWHPFGTYERTRQCYVVL KMKEFMHR+NVLQN
Sbjct: 237 KFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQN 296

Query: 339 NNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXX 398
           +NDGD SHW+PFFCGDFNSQPFDTPYLSMTSKP+HYK RAKTVIECSTS+KFSK R    
Sbjct: 297 DNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGEE 356

Query: 399 XXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRK 458
                   NIEKFGKDQP++PVP++F AN+EQ ++V +M  LHNSLDMRAISLY VGY+ 
Sbjct: 357 GADDEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKS 416

Query: 459 VHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGF-DDCQHVDTLEKFEKENSIKV 517
           VHPENAGLDND GEPEISNWA+TW GLLDY+ +IK W    + Q V+ L  FEK+N IK 
Sbjct: 417 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKC 476

Query: 518 RGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           RG+LRMPP++EM+K  HGQPH GEYPSDHLSM+C+LEL
Sbjct: 477 RGFLRMPPASEMTK--HGQPHVGEYPSDHLSMVCDLEL 512

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/435 (73%), Positives = 357/435 (82%), Gaps = 4/435 (0%)

Query: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180
           LA GLDPN  PDLQFI+RP+L LHEEEPV GFK  IMTYN LAQALIRRKLFP SG+A+K
Sbjct: 73  LAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAVK 132

Query: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240
           WFKRSKVL NEFKHY+ DV CLQEIDH+QYQ+FWK EF+K+GY SQFHR  +KNHGVAI+
Sbjct: 133 WFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAIV 192

Query: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300
           WR  LFT+ D ML+D+DKEPSG+IPPRTTT NAGL L+LKFT+K L++F  GT + GI++
Sbjct: 193 WRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFP-GTKKSGILI 251

Query: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360
           GTTHLFWHPFGT+ERTRQCYVVLNKMKE +HR+NVLQNN D D SHWYPF CGDFNSQPF
Sbjct: 252 GTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQPF 311

Query: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXXXXXXXNIEKFGKDQPQTPV 420
           DTPYLSMTSKP+ Y+GRAKTVIECSTS+ FSK R            NIEKFGK QP+ PV
Sbjct: 312 DTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLR-DGEEGEDEEGGNIEKFGKGQPEHPV 370

Query: 421 PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH 480
           P  F A EEQ  LVK ME LHNSLDMRAISLY VGY+ VHPENAGLDND GEPEISNWA 
Sbjct: 371 PKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEISNWAE 430

Query: 481 TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG 540
           TW GLLDYI F+K+W   D   VD ++ FE+EN IK+RG LRMPP  EM+K  HGQPH G
Sbjct: 431 TWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTK--HGQPHEG 488

Query: 541 EYPSDHLSMICELEL 555
           EYPSDHLSM+CE+EL
Sbjct: 489 EYPSDHLSMMCEIEL 503

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/437 (71%), Positives = 363/437 (83%), Gaps = 5/437 (1%)

Query: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180
           +AQG+DP+  P+LQFI+RPIL LH+ E V GFK  +MTYNCLAQALIRRKLFP SGDALK
Sbjct: 63  MAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALK 122

Query: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240
           W++RSKVL NEFK+YN DVICLQEID++QYQSFWK E  K+GY+SQFHR+ SKNHGVAI+
Sbjct: 123 WYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIV 182

Query: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300
           W++E F +TDKMLIDFD+E SG+IPPRTTTNNAGL LSLKF++K   +  +   + GIIV
Sbjct: 183 WKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQE--HNLKKTGIIV 240

Query: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360
           GTTHLFWHPFGT+ERTRQCYVVLNK+KEF HR+NVLQN NDGD SHWYPFFCGDFNSQPF
Sbjct: 241 GTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPF 300

Query: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR-XXXXXXXXXXXXNIEKFGKDQPQTP 419
           D+PYLSMT KPI Y  RAKTVIECSTSY FSK R             NIEKFG DQP  P
Sbjct: 301 DSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPDHP 360

Query: 420 VPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWA 479
           VP H+ A + +++LV+ M+ LHNSLDMRA+SLY V YRKVHPENAGLDN+ GEPEISNWA
Sbjct: 361 VPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWA 420

Query: 480 HTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHT 539
           HTW GLLDY+ FI+HW F DC+ +D+LE FE+ENS+K+RG LR+PP  EM++  HGQPHT
Sbjct: 421 HTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTE--HGQPHT 478

Query: 540 GEYPSDHLSMICELELI 556
           GEYPSDHL M+CELEL+
Sbjct: 479 GEYPSDHLCMLCELELV 495

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/456 (67%), Positives = 369/456 (80%), Gaps = 7/456 (1%)

Query: 104 EEIAKIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E +AK+RAER+A    K+E  LA+G+DP+  P+LQFI+RP+L LHE+EP+ G    ++TY
Sbjct: 38  EHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLTY 97

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSGD+LKWF+RSKVL  EFKHYN DV+CLQEID++QYQ FWK E +
Sbjct: 98  NCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELD 157

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY++QF+++  KNHGV+I W++ LF LTD+MLID+DKE SG+I  RT T+N+GL L+L
Sbjct: 158 KLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILAL 217

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
           KFT+ A     +   + GI+VGT+HLFWHPFGTYERTRQCYVVL KMKEFM R+NVLQNN
Sbjct: 218 KFTDAAKQSCPH-IRKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNN 276

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXX 399
           NDG+ SHW PFFCGDFNSQPFDTPYLSMTSKP+ Y GRAKTV+ECSTSY FSK R     
Sbjct: 277 NDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRNGEED 336

Query: 400 XXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKV 459
                  NIEKFGKDQPQTPVP+ F A  EQ+KLV+ M+ LHNS+DMRAISLY VGY +V
Sbjct: 337 AEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEV 396

Query: 460 HPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRG 519
           HPEN+G+DND GEPE+SNWA+TW GLLDYIL I  W   D + VD+LE FEKENS+K+RG
Sbjct: 397 HPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRG 456

Query: 520 YLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
            LRMPP++EMS   HGQPH GEY SDHLSM+C +EL
Sbjct: 457 LLRMPPASEMSH--HGQPHEGEYASDHLSMMCTIEL 490

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/458 (66%), Positives = 366/458 (79%), Gaps = 7/458 (1%)

Query: 104 EEIAKIRAERQAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTG----FKISIMTY 159
           EEIA+IRAER+AK+EAA  QG   +   +L+FI+RP+L +H +  +        +++MTY
Sbjct: 24  EEIARIRAERKAKREAAALQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTY 83

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFPDSG ALKW++RS+VL N+FKHY PDV+CLQE+D +Q+ SFW+ EFE
Sbjct: 84  NCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFE 143

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY +QFH+KQ+KNHGVA++WR +LFT+ DKMLIDFDKE SG++PPRTTTNNAGL ++L
Sbjct: 144 KLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIAL 203

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
           KFTE+AL+   + T R GI+VGTTHLFWHPFGT+ERTRQCYVVLNKMKEFMHR+NVLQN 
Sbjct: 204 KFTEQALTGHRD-TPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNE 262

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR--XXX 397
           NDG+  HW+PFFCGDFNSQP+D PYLSMTSKP+ Y GRA+TVIECSTSY FSK+R     
Sbjct: 263 NDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDA 322

Query: 398 XXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYR 457
                    NIE FGKDQP  PVP  F  N EQ  LV  ME LHNSLDMRA+SLY VGYR
Sbjct: 323 AADEEEEGGNIEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYR 382

Query: 458 KVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKV 517
            VHPENAG DN  GEPEISNWAHTWNGLLDY+ ++ HW F D   VDTLE+FE+++ + V
Sbjct: 383 NVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTV 442

Query: 518 RGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           +  LRMP   EM + GHGQPHTGEYPSDHL+M+C+LEL
Sbjct: 443 KRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/443 (67%), Positives = 360/443 (81%), Gaps = 5/443 (1%)

Query: 116 KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDS 175
           K++  LA GLDP+  P+LQFI+RP+L LH++EP   F  ++MTYNCLAQALIRRKLFPDS
Sbjct: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146

Query: 176 GDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNH 235
           G+A+KW++RS+VL NEFK+YNPD+ICLQEIDH+Q+QSFW+ EF+K+GY SQFHR  SKNH
Sbjct: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206

Query: 236 GVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFS--NGT 293
           GVAI+W+  LF LTD+MLIDFDKE SG+I PRT TNN GL LSLK+++  L+K+      
Sbjct: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266

Query: 294 SRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCG 353
           ++ GII+GTTHLFWHPFGTYERTRQC+V+LNK+KEF  R+NVLQNNNDG+  HW  FFCG
Sbjct: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326

Query: 354 DFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRX-XXXXXXXXXXXNIEKFG 412
           DFNSQPFDTPYLS+TSKP+ YK RAK VIECSTSY +SK R             NIEKFG
Sbjct: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFG 386

Query: 413 KDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGE 472
           KDQPQTPVPD +    EQ  LV  ME LHNSL+M+A SLY VGY+KVHPEN+GLDN  GE
Sbjct: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446

Query: 473 PEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKH 532
           PEISNWAH+W GLLDYI ++ HW F DC+ V+  EKFEK+N +K+RGYLRMPP+TEMSK 
Sbjct: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSK- 505

Query: 533 GHGQPHTGEYPSDHLSMICELEL 555
            +GQPH GEYPSDHLSM+C++EL
Sbjct: 506 -YGQPHQGEYPSDHLSMMCKIEL 527

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/456 (67%), Positives = 361/456 (79%), Gaps = 8/456 (1%)

Query: 104 EEIAKIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E IA++RA+R+A    K+E  +A+GLDP+  PDLQFI RP+L L+  E   GF   +MTY
Sbjct: 42  EHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTY 101

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQALIRRKLFP SG+ALKWFKRS+VL NEF HYN DV+CLQE+D++QYQSFWK EFE
Sbjct: 102 NCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFE 161

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GYESQFHR  +KNHG+AI+W++++FT+ DKMLID+DKEPSG + PRTTT N GLA++L
Sbjct: 162 KLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIAL 221

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
            FT+K L+K+  G+S+ GIIVGTTHLFWHPFGT+ERTRQCYV+LNKMKEFMHRINVLQ+ 
Sbjct: 222 GFTKKVLAKYP-GSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDK 280

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXX 399
                + WYPFFCGDFNSQPFDTPYLS++SKP+ YKGRAKTVIECSTSY FSK R     
Sbjct: 281 GATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR-DGEE 339

Query: 400 XXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKV 459
                  NIEKFG  QP+ PVP+ F A EEQK LV++M  LHNSLDMR IS+Y VGY+ V
Sbjct: 340 CDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHV 399

Query: 460 HPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRG 519
           H ENAGLDN+  EPEISNWA TW GLLDYI FIK W F D    + LE F+ EN IK+RG
Sbjct: 400 HAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRG 459

Query: 520 YLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
            LRMPP+ EM    HGQPH GEY SDHLSM+CELEL
Sbjct: 460 LLRMPPAKEMP--NHGQPHEGEYGSDHLSMMCELEL 493

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/435 (66%), Positives = 337/435 (77%), Gaps = 5/435 (1%)

Query: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180
           LA+GLDP   PDLQFI RP+L L       GF   IMTYNCLAQALIRRKLFP SG+ALK
Sbjct: 63  LARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALK 122

Query: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240
           WFKRS+VL NEF HY  DV CLQEID++QYQSFWK EF K+GY+SQFHR  +KNHG+AI+
Sbjct: 123 WFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIV 182

Query: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300
           W+++LFT+ DKML+D+DKEPSG + PRTTT N GL L+L F++K L K+  GTS+ GI+V
Sbjct: 183 WKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYP-GTSKRGILV 241

Query: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360
           GTTHLFWHPFGT+ERTRQCYV+LNKMK+F+HR+NVLQ+ +  +   WYPFFCGDFN+QPF
Sbjct: 242 GTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKK-WYPFFCGDFNAQPF 300

Query: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXXXXXXXNIEKFGKDQPQTPV 420
           DTPYLSM+SKP+ YK RAKTVIECSTSY FSK R            NIEKFG  QP+ PV
Sbjct: 301 DTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-DGEECDDEEGGNIEKFGDGQPEHPV 359

Query: 421 PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH 480
           PD + A  EQK+LV+ M  LHNSLDMRAIS+Y V Y+ VHPENAG DN   EPEISNWA 
Sbjct: 360 PDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAE 419

Query: 481 TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG 540
           TW GLLDYI FIK W F D +  + L+ FEKEN +K+   LRMPPS EM    HGQPH G
Sbjct: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMP--NHGQPHEG 477

Query: 541 EYPSDHLSMICELEL 555
           EY SDHLS++CE+EL
Sbjct: 478 EYGSDHLSLMCEIEL 492

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/461 (62%), Positives = 346/461 (75%), Gaps = 12/461 (2%)

Query: 104 EEIAKIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFK----IS 155
           E IA++RA+R+A    KKEA +AQG+DP    DL+FI+RP+L +  +      +    IS
Sbjct: 59  EYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPIS 118

Query: 156 IMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWK 215
           IMTYNCLAQALIRR LFP SG+A+KWFKRS+VL NEFK+YN DV+CLQEID +QY+SFWK
Sbjct: 119 IMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWK 178

Query: 216 AEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGL 275
            EF K+GY  QFH   +KNHGV I W+++LF +TDKMLID+DKE +G I PRTTT N G+
Sbjct: 179 MEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGM 238

Query: 276 ALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINV 335
            LSLKF +K L K+ + T   GII+GTTHLFWHPFGTYERTRQCY+VL K+KEF +RINV
Sbjct: 239 LLSLKFKKKVLEKYPD-TKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINV 297

Query: 336 LQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRX 395
           LQN  DGD SHW  FFCGDFNSQPFD PYLS+TSKP+ Y GRAKTVIECSTS+ FSK R 
Sbjct: 298 LQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR- 356

Query: 396 XXXXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVG 455
                      NIEKFGK QP+TPVP+ F  NEEQK+L +NM+ LHN +DMRAISLY + 
Sbjct: 357 DGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIA 416

Query: 456 YRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSI 515
           Y KVHPEN+GLDN   EPEISNWAH W GLLDY+ ++  W   DC  +D L  FE+   +
Sbjct: 417 YSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGV 476

Query: 516 KVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           +V   LR+PP+ EM++  HGQPH GEYPSDHL MI +L +I
Sbjct: 477 QVLELLRIPPAKEMTE--HGQPHEGEYPSDHLCMIVKLGII 515

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/453 (60%), Positives = 340/453 (75%), Gaps = 10/453 (2%)

Query: 104 EEIAKIRAERQAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLA 163
           EEI KIRA+R+AKKEAA  QG +     D+ FI+RP+L  + +E   GF   +MTYNCLA
Sbjct: 61  EEIEKIRAQRKAKKEAAGKQGGE-----DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLA 114

Query: 164 QALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGY 223
           QALIRRKLFP SG+ALKWFKRSKVL +E ++YNPDVICLQEIDH QY+SFW    +  GY
Sbjct: 115 QALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGY 174

Query: 224 ESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTE 283
            S+FHR   KNHG+AI+WR+ LF   D+ LIDFD+E SGEI  RTTT N GL ++L++T+
Sbjct: 175 CSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTD 234

Query: 284 KALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGD 343
           +   ++  G+++ GI+VGT+HLFWHPFGTYER RQCY++L++MK F+ R+ +L+  + G 
Sbjct: 235 EIKRRYP-GSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGA 293

Query: 344 TSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXXXX 403
            S W+PFFCGDFNSQPFD PYLSM SKPI Y+GRA+TVIECSTSYKFS  R         
Sbjct: 294 ASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLR-DGCAADEE 352

Query: 404 XXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPEN 463
              NIEKFG  QP+TPVPD F    EQ+ LV  M+ LHN+LDMRAISLY + YR VHPEN
Sbjct: 353 EGGNIEKFGAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPEN 412

Query: 464 AGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRM 523
           AG+DN+ GEPEISNWAH W GLLDYI+++  W F D   VD + +F+K  S+ VR  LR+
Sbjct: 413 AGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRV 472

Query: 524 PPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           PP++EM    HGQPH GEYPSDHLS++CELEL+
Sbjct: 473 PPASEMPS--HGQPHEGEYPSDHLSLMCELELL 503

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 324/454 (71%), Gaps = 12/454 (2%)

Query: 104 EEIAKIRAERQAKKEAALAQGLDPNALP-DLQFIQRPILHLHEEEPV-TGFKISIMTYNC 161
           EE A  R+  QA  E+   Q + PN    +L+FI RP+L L   + V  GF  S+MTYNC
Sbjct: 42  EETA--RSGGQAATESN-DQQMAPNITSLNLEFIARPMLPLKVTQTVHKGFSFSLMTYNC 98

Query: 162 LAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKV 221
           LAQ+LIRR LFP SG ALKW KRS VL  EFKHYN DV+CLQEID+ QY SFW      +
Sbjct: 99  LAQSLIRRSLFPTSGRALKWTKRSMVLLKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNL 158

Query: 222 GYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKF 281
           GY S+FHR  +K+HGVAI W+K+LF   D+MLI+FD E SGEI PR TTNN G+ L+L F
Sbjct: 159 GYGSRFHRMDNKSHGVAIFWKKDLFIWMDQMLINFDNEDSGEIEPRKTTNNVGMILALGF 218

Query: 282 TEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNND 341
           ++K    F  GT + GIIVGT+HLFWHPFGTYERTRQCYV+LNKMKEF+HR+++ QN + 
Sbjct: 219 SDKVKQSFP-GTVKSGIIVGTSHLFWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHH 277

Query: 342 GDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXX 401
            D + WYPFFCGDFNSQPFD PYLS+TSKP+ Y GRAKTVIECS +YKF           
Sbjct: 278 TDLTKWYPFFCGDFNSQPFDAPYLSITSKPVLYSGRAKTVIECSAAYKFPD----LGAGA 333

Query: 402 XXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHP 461
                +    G+D+P  PVP+ F    E   LV+ ME LHNSLDMRAISLY V Y+ VHP
Sbjct: 334 RGANEDGGTVGEDRPVDPVPESFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHP 393

Query: 462 ENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYL 521
           +NAGLDN+ GEPEISNWA+TW GLLDYI++I  W   +   VD+LE FEK + I V+  L
Sbjct: 394 DNAGLDNERGEPEISNWAYTWRGLLDYIMYITPWQASNNVEVDSLESFEKLSHITVQEML 453

Query: 522 RMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           RMPP+ EMS   HGQPH GEYPSDHL+M+C+LE+
Sbjct: 454 RMPPAKEMSS--HGQPHDGEYPSDHLAMMCKLEV 485

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  476 bits (1225), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 232/475 (48%), Positives = 313/475 (65%), Gaps = 36/475 (7%)

Query: 104 EEIAKIRAERQAKKEAA----LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTY 159
           E I KIRAER+ K+E      +  G +P+   +LQFI+RP+L LH+++PV G  + IMTY
Sbjct: 37  EYITKIRAEREKKRELEREYRMKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTY 96

Query: 160 NCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFE 219
           NCLAQ+LI+R LFP SG ALKW +RSKVL NE K+Y+ D++ LQEID +Q++ +WK    
Sbjct: 97  NCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLA 156

Query: 220 KVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSL 279
           K+GY+ +F++K  K HGV I W++ LF     + IDFD+  SG I PRT T N GL ++L
Sbjct: 157 KLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIAL 216

Query: 280 KFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNN 339
           +F    L+K  +   + G+I+GTTHLFWH FGT+ERTRQCYV++++M +FM ++      
Sbjct: 217 EF----LNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL------ 266

Query: 340 NDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRX---- 395
             G    WYPFF GDFNSQP D PY+S+TSKP+ ++   K VIECS +YK+SKKR     
Sbjct: 267 --GGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEE 324

Query: 396 -------------XXXXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHN 442
                                     E+   +QP    P HF    EQ +LV  +  LHN
Sbjct: 325 EKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHN 384

Query: 443 SLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHW-GFDDCQ 501
           SL++RAISLY VGYRKV PENA ++ND GEPE+S WA  W+GLLDYI F++HW G  + +
Sbjct: 385 SLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHE 444

Query: 502 HVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
            VD+L+ FE+EN++K+RG L+MP S EM +  H  P+ GEYPSDHL M+ +LEL+
Sbjct: 445 KVDSLKTFERENNVKLRGLLKMPQSKEMCE--HAIPYKGEYPSDHLCMMIQLELL 497

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  453 bits (1165), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 232/465 (49%), Positives = 308/465 (66%), Gaps = 24/465 (5%)

Query: 104 EEIAKIRAERQAK----KEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTG---FKISI 156
           E I++IR +R  K    +E+ + QGLDP+  P+LQF +RP L LH+ EP  G    + SI
Sbjct: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSI 80

Query: 157 MTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKA 216
           +TYNCLAQ LI R +FP+SG+ALKW +RSK + NE K+YNPD++CLQEID    + FW  
Sbjct: 81  LTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSV 140

Query: 217 EFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLA 276
           +F+ +GY  +F +K+ K HGV I WR  +F   D+  +DFD+  +G+IPPRT T N GL 
Sbjct: 141 QFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200

Query: 277 LSLKFTEKALSKFSNGTSR--MGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRIN 334
           ++L+F    L   +N  SR   GI+V TTHLFWHPFGT+ERTRQCY++L++M +F+  + 
Sbjct: 201 VALQF----LDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL- 255

Query: 335 VLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR 394
               N     ++WYPF  GDFNSQP D PY+SMT+KPI Y    +TVIECSTSY +SKKR
Sbjct: 256 ----NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKR 311

Query: 395 ---XXXXXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISL 451
                            E+F K QP  P P  F   +EQ  LV  ++ LHNSL  RAISL
Sbjct: 312 NGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISL 371

Query: 452 YGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGF-DDCQHVDTLEKFE 510
           Y VGYR VHPEN+ ++N  GEPE S+W   W+GLLDYI +IK W   D    V+TLE FE
Sbjct: 372 YSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFE 431

Query: 511 KENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           K N++K+ G+L++P   EM+   H QP+ GEYPSDHL+++C+L+L
Sbjct: 432 KTNTLKILGFLKLPLRKEMAH--HSQPYEGEYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  450 bits (1158), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 224/464 (48%), Positives = 311/464 (67%), Gaps = 24/464 (5%)

Query: 108 KIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHL--HEEEPVTGFKISIMTYNC 161
           +IR +R+     K+E  L QG DP+   +L FI+RPIL+L  H      GFK S+MTYNC
Sbjct: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80

Query: 162 LAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEK- 220
           LAQA+IRR++F DSG ALKWF+RSKVL NE  +YNPD++CLQEID  QY++FWK + E  
Sbjct: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140

Query: 221 VGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLK 280
           +   + +++++ K+HGV I W+K +F   D M++DFD   +  I  RT T N  + ++LK
Sbjct: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200

Query: 281 FTEKALSK-FSN-----GTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRIN 334
           F ++ ++K F N       + +G I+ TTHLFWHPFGT+ERTRQCY++L KMK+F+  +N
Sbjct: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260

Query: 335 VLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR 394
           V     D   +HWYPF CGDFNS P D PYLSMTSKPI Y GR K VIECST+YKFSK+R
Sbjct: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316

Query: 395 XXXXXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGV 454
                         EK   +QP+  VPD F    EQ KLV  ++ LHN L +RA SLYG+
Sbjct: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373

Query: 455 GYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDD--CQHVDTLEKFEKE 512
            Y+ V P N  ++ND GEPE ++WA +W+G+LDYI+++ +W  ++   +  ++LE+FEK 
Sbjct: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433

Query: 513 NSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           N + ++G L+MP + +M    H QP   EYPSDH+S++CE+E++
Sbjct: 434 NQLLIKGLLKMPLNKDMP--FHTQPFEREYPSDHISILCEMEIL 475

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  384 bits (985), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 210/468 (44%), Positives = 280/468 (59%), Gaps = 41/468 (8%)

Query: 107 AKIRAERQAKK-------EAALAQGLDPNALPDLQFIQRPILHL-HEEEPVTGFKISIMT 158
           A+I A+R+A++       E  L++GLDP+   + QFI+RPIL + H +    G  +SIMT
Sbjct: 25  AEIEAKREARRLKKQKLREELLSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMT 84

Query: 159 YNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEF 218
           YNCLAQ LIRR++FP+SG ALKWF RSKVL +E KHYN D+ CLQEID +QY  FW  E 
Sbjct: 85  YNCLAQTLIRREMFPESGPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEEL 144

Query: 219 EKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALS 278
            K GY++ +  + SK+HGV I W++ELF L   M I+FDKE    I PRT TNN GL ++
Sbjct: 145 PKFGYKTIYFHQDSKSHGVMIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVA 204

Query: 279 LKFTEKALSKFSN-GTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQ 337
           L FT+   ++ +   TSR G+I+GT HLFWHPFGTY+RTRQC V+  K+ EF   +    
Sbjct: 205 LAFTDAFRARNNRIRTSRSGVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK--- 261

Query: 338 NNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXX 397
               GD   +   F GDFNSQP   PYL +T        + +T IE ST+Y++S++R   
Sbjct: 262 ----GD---YCKMFTGDFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLG 314

Query: 398 XXXXXXXXXNIEKF----------GKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMR 447
                      E+           G D   TP PD F + EEQ++LV N+    N + + 
Sbjct: 315 KEYSMEEEEEEEEEEEKREYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLC 374

Query: 448 AISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLE 507
           A SLY +GY  V P +     D  EPE+S+W+  W GLLDYI ++        Q   T  
Sbjct: 375 ATSLYSIGYHTVDPTHIA---DHHEPELSSWSTKWAGLLDYIFYVN-------QRPSTPA 424

Query: 508 KFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
            FE  N+I + GYL+MP   +M  H H QP+TGEYPSDH+SM+C LE+
Sbjct: 425 TFETANNIAIAGYLQMPTHAQM--HNHSQPYTGEYPSDHISMMCALEI 470

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  381 bits (979), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 280/469 (59%), Gaps = 36/469 (7%)

Query: 104 EEIAKIRAER----QAKKEAALAQGLDPN-ALPDLQFIQRPILHLHEE-------EPVTG 151
           E++ KIR ER    Q+++ + ++QG DP+   PDLQFI+RP LHLH E            
Sbjct: 45  EQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNS 104

Query: 152 FKISIMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQ 211
             + IMTYN LAQ LIRR  FP SG ALKW KRSKVL +E K Y PD++ LQE+D+ + +
Sbjct: 105 LDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK 164

Query: 212 SFWKAEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGE-IPPRTTT 270
            FW+  F K+G++  F R   K HG+ I W    F L ++ ++D+D   +G  IP RT T
Sbjct: 165 -FWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRT 223

Query: 271 NNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFM 330
            N  L  SL+       K  +  S  G+IV  THLFWHPFG +ER RQ Y+VL K++E  
Sbjct: 224 KNIALIASLRL------KNISDPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQE-- 275

Query: 331 HRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKF 390
             I      N      W+    GDFN++P + PYL++T KP+   G A+ + ECS +Y++
Sbjct: 276 --IKACPKYNG-----WHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRY 328

Query: 391 SKKRXXXXXXXXXXXXNIEKFGK---DQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMR 447
           SKKR            + +  G+   +QPQ P P  F A  EQK LV  +  LHNSL +R
Sbjct: 329 SKKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVR 388

Query: 448 AISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLE 507
            +SLYG+GY KV PEN+   N  GEPE+SNWA++W GLLDYI +I+H         + ++
Sbjct: 389 GVSLYGLGYGKVQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVD 446

Query: 508 KFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
            FE +N+++V GYL+MP + EM K  H QP  GEY SDH+S++C+L  +
Sbjct: 447 DFENKNNLRVMGYLKMPRAKEMPK--HSQPFEGEYASDHVSLMCQLRFL 493

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  380 bits (975), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 274/456 (60%), Gaps = 39/456 (8%)

Query: 119 AALAQGLDPN-ALPDLQFIQRPILHLHEEEPVTGFK------------ISIMTYNCLAQA 165
           + ++QG DP+   PDLQFI+RP+LH+  E+    FK            I IMTYN LAQ 
Sbjct: 62  SLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQT 121

Query: 166 LIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYES 225
           LIRR  FP SG ALKW KRSKVL +E K Y PD++ LQE+D+ + + FW+  F K+G++ 
Sbjct: 122 LIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDL 180

Query: 226 QFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGE-IPPRTTTNNAGLALSLKFTEK 284
            F R   K HG+ + W  E F L ++ ++D+D+  +G  I  RT T N  L +SL+F   
Sbjct: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRF--- 237

Query: 285 ALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDT 344
              K +   S  GI+V  THLFWHPFG +ER RQ Y+VL K++E            D   
Sbjct: 238 ---KDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPK 284

Query: 345 SH-WYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXXXXXXX 403
            H W+    GDFN++P + PYL++TSKP+   G  + ++ECS +Y++SKKR         
Sbjct: 285 YHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDD 344

Query: 404 XXXNIEKFGK---DQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVH 460
              +    G+   +QP+ P P HF A +E+K LV  +  LHNSL ++ ISLYG+GY KVH
Sbjct: 345 EDYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVH 404

Query: 461 PENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGY 520
           PENA  +   GEPE+SNWA+TW GLLDYI +I+    +  Q   +L  FE+ N + V GY
Sbjct: 405 PENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGY 462

Query: 521 LRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           LRMP   EM K  H QP  GEY SDH+S++C++ L 
Sbjct: 463 LRMPCKQEMPK--HSQPFEGEYASDHISLMCQIRLF 496

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  377 bits (967), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 208/467 (44%), Positives = 288/467 (61%), Gaps = 28/467 (5%)

Query: 104 EEIAKIRAERQAKKEAALAQGLDPNAL-PDLQFIQRPILHL-HEEEPVTGFKISIMTYNC 161
           E I+KIR  R+ K+  A  +  +P  L     FI+R IL L + EE      + IMTYN 
Sbjct: 23  EFISKIRKLREKKR--AENEENNPEFLNSKYDFIKRAILQLPNVEELDNSVDLKIMTYNT 80

Query: 162 LAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKV 221
           L+Q+LIRR+++PD+ DA+KW  RSKV+ NE K+YN D++C QE+D +Q+  FW  E  K+
Sbjct: 81  LSQSLIRREIYPDAHDAIKWHVRSKVILNEIKYYNCDIMCFQEVDVIQWDKFWLPELSKL 140

Query: 222 GYESQFHR--KQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTT-TNNAGLALS 278
           GYE +F++  +  K HGVAI WR  LF   D + I+FD   +G    +TT T N GL ++
Sbjct: 141 GYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDVIKINFDDIVAGNAISKTTRTWNVGLIVA 200

Query: 279 LKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQN 338
           LKF      K SN   R GI++GTTHLFWHPFGT+ERTRQ  ++L K ++ +  +N    
Sbjct: 201 LKF------KSSNAKFRSGIVIGTTHLFWHPFGTFERTRQLAILLKKFRKLIDNLNTECG 254

Query: 339 NNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRXXXX 398
           + +  ++ W P   GDFNSQP D PYLS+TSKP+   G AKTVIECST+YKFS++R    
Sbjct: 255 HINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSASGEAKTVIECSTAYKFSRRRSGSI 314

Query: 399 XXXXXXXXNIE----------KFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRA 448
                   N E          +  +  P  P P HF A  EQK L+  +E +HNS++++A
Sbjct: 315 NSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHFEATSEQKDLIAKLEKVHNSINLKA 374

Query: 449 ISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEK 508
            SL+G+ Y+KVH  + GL N   EPE+S+ +  W GLLDYI  ++ W   +     +LE 
Sbjct: 375 TSLFGIAYKKVH--SIGL-NCKNEPELSHTSIFWTGLLDYIFILEPWNEVEKTDWGSLED 431

Query: 509 FEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
           FEK  S++V+G L+MP   E+ K  + QPH G+YPSDHLSMIC+L +
Sbjct: 432 FEKRMSLRVKGLLKMPEMKELPK--NVQPHQGQYPSDHLSMICDLNV 476

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  377 bits (967), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 284/473 (60%), Gaps = 40/473 (8%)

Query: 104 EEIAKIRAER----QAKKEAALAQGLDPN-ALPDLQFIQRPILHLHEEE-----PVT--- 150
           ++I KIR ER    Q ++ + ++QG DP+   PDLQFI+RP L ++ +      P T   
Sbjct: 43  DQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQV 102

Query: 151 ---GFKISIMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDH 207
                 + IMTYN LAQ LIRR  FP+SG ALKW KRSKVL +E K Y PDV+ LQE+D+
Sbjct: 103 TQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDY 162

Query: 208 LQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGE-IPP 266
            +  +FW+  F K+G++  F R + K HG+ + W  + F L +  ++D+D   +G  I  
Sbjct: 163 NEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISA 221

Query: 267 RTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKM 326
           RT T N  L +SL F      K    +S  GIIV  THLFWHPFG +ER RQ Y+VL K+
Sbjct: 222 RTRTKNIALIISLYF------KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKI 275

Query: 327 KEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECST 386
           +E    I      N      W+    GDFN++P + PYL++T +P+  KG  + ++ECS 
Sbjct: 276 QE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSL 326

Query: 387 SYKFSKKRXXXXXXXXXXXXNIEKFGK---DQPQTPVPDHFIANEEQKKLVKNMELLHNS 443
           +Y++SKKR            + +  G+   DQPQ P P+ F A +E+K LV  +  LHNS
Sbjct: 327 AYRYSKKRNGEESDQDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNS 386

Query: 444 LDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHV 503
           L ++ +SLYG+GY KVHPENA  +   GEP +SNWA+TW GLLDYI +I+     D +  
Sbjct: 387 LHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQK 444

Query: 504 DTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           + L  FE  N++K+ GYLRMP + EM K  H QP  GEY SDH+S++C++ L 
Sbjct: 445 EPLNAFEGNNNVKIIGYLRMPCAQEMPK--HSQPFEGEYASDHISLMCQIRLF 495

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  367 bits (942), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 198/473 (41%), Positives = 278/473 (58%), Gaps = 41/473 (8%)

Query: 104 EEIAKIRAER----QAKKEAALAQGLDPN-ALPDLQFIQRPILHLHEEE----------- 147
           + I KIR ER    Q+++ + ++QG DP+   PDLQFI+RP LH++ E            
Sbjct: 45  DHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQV 104

Query: 148 PVTGFKISIMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDH 207
           P +   + IMTYN LAQ LIRR  FP SG ALKW KRSKVL +E K Y PD++ LQE+D+
Sbjct: 105 PPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDY 164

Query: 208 LQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGE-IPP 266
            +   FW   F K+G+ S F R + K HG+ + W  E F   ++ ++D+D   +G  I  
Sbjct: 165 NEL-GFWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISA 223

Query: 267 RTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKM 326
           RT T N  L +SL    K ++  S      G+IV  THLFWHPFG +ER RQ ++VL K+
Sbjct: 224 RTRTKNIALIVSLSV--KNMTNLSTS----GVIVANTHLFWHPFGVFERLRQSFLVLKKI 277

Query: 327 KEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECST 386
           +E                  W+    GDFN++P + PY+++T +P+   G A+ + ECS 
Sbjct: 278 EEI---------KTCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSL 328

Query: 387 SYKFSKKRXXXXXXXXXXXXNIEKFGK---DQPQTPVPDHFIANEEQKKLVKNMELLHNS 443
           +Y++SK R              E  G+   DQPQ P P +F+A +EQK LV  +  LHNS
Sbjct: 329 AYRYSKMRNGEESDQDEECDE-ESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNS 387

Query: 444 LDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHV 503
           L ++ ISLYG+ Y KVHP+N+    + GEPE+SNWA+TW GLLDYI +I+          
Sbjct: 388 LHVKGISLYGLSYGKVHPDNS--KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSKD 445

Query: 504 DTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556
           + ++ FE +N++K+ GYLRMP + EM K  H QP  GEY SDH+S++C+L L 
Sbjct: 446 EPVKNFEDQNNVKIIGYLRMPRAEEMPK--HSQPFEGEYASDHISLMCQLRLF 496

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  347 bits (890), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 277/472 (58%), Gaps = 42/472 (8%)

Query: 104 EEIAKIRAERQAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTG--------FKIS 155
           E I +IRA R+ K+E   A+  D   +    FI+RP+L    E P  G         ++ 
Sbjct: 15  EYIERIRALRREKREREKAERAD---VAREIFIKRPLL----EVPYVGGVPCRDGYVRVK 67

Query: 156 IMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWK 215
           IMTYN LAQ LIRR  FPD+ DA+KW +RS+VL  E ++Y+ DV+CLQE D +Q+  FW 
Sbjct: 68  IMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFWV 127

Query: 216 AEFEKVGYESQFHRKQSKNHGVAIIWRKELF--TLTDKMLIDFDKEPSG-EIPPRTTTNN 272
            EF+++GY+  F     K HGVAI+W+  +F  T  DK+ +  D   +G +I   T T  
Sbjct: 128 EEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTGTRT 187

Query: 273 AGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHR 332
             LA++L+      S+         II  TTHLFWH FGT+ERTRQ +V+L+++ +F+ +
Sbjct: 188 VALAVALRLKHHKTSR--------PIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKK 239

Query: 333 INVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSK 392
           +    + +       Y FF GDFNSQP D PYLS+T KP+  KGRAK++IECS SY++SK
Sbjct: 240 VT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSK 296

Query: 393 KRXX-------XXXXXXXXXXNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLD 445
           +R                   ++E    ++PQ P P  + A  EQ + V++++ LHN + 
Sbjct: 297 RRNSILEDDEDSMVREPSDQESVED-ETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIP 355

Query: 446 MRAISLYGVGYRKVHPENAGLDNDC--GEPEISNWAHTWNGLLDYILFIKHWGFDDCQHV 503
           ++ +SLYG+GY  VHPEN+   +     EP++S+ A  W+GLLDYI  I  W  ++   +
Sbjct: 356 LQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWS-ENATKI 414

Query: 504 DTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555
             L+  E++  IK+ GYLRMP   EM    H +PH  EYPSDHL+M+C++ L
Sbjct: 415 SDLQALERQTGIKINGYLRMPLKEEMC--DHTEPHENEYPSDHLAMMCDISL 464

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 97/216 (44%), Gaps = 14/216 (6%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L       K++  +   AL W  R + L  +   ++ DVICLQE++ L Y+ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 213 FWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTDKMLIDFDKEPSG 262
           +W    EK  Y   FH K            K  G AI ++K+ F L  +  IDF      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
                 T +    A++ K     +++  +  +   + V TTHL W P     +T Q  V+
Sbjct: 574 HKKFHRTEDYLNRAMN-KDNVALIAELKHLNTNENVWVVTTHLHWDPQFNDVKTFQVGVM 632

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358
           L+ ++  + + + + NNN  D        CGDFNSQ
Sbjct: 633 LDYLETLIKQHHHVNNNN--DIKKIPMVICGDFNSQ 666

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 93/227 (40%), Gaps = 31/227 (13%)

Query: 149 VTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDH 207
           +T    ++++YN L Q     K++  +   AL W  R   L ++   Y+ D++CLQE++ 
Sbjct: 430 LTKKSFTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEA 489

Query: 208 LQYQSFWKAEFEKVGYESQF----------HRKQSKNHGVAIIWRKELFTLTDKMLIDF- 256
             ++ FW    EK GY   F          HR   K  G  + +++  F L  K  +DF 
Sbjct: 490 RTFEDFWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFS 549

Query: 257 ------DKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPF 310
                 +K    E       N   +AL  K    A        S   I V TTHL W P 
Sbjct: 550 STWMKHEKFQRTEDFLNRAMNKDNIALYFKLQHIA--------SGEHIWVATTHLHWDPK 601

Query: 311 GTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
               +T Q  V+L+ ++  +      Q+N   D        CGDFNS
Sbjct: 602 FNDVKTFQVGVLLDHLQTLIR-----QDNPRQDVKKAPVIICGDFNS 643

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 102/238 (42%), Gaps = 36/238 (15%)

Query: 142 HLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVI 200
           HL+EE     F  ++++YN L Q     K++      AL W  R + L +E   Y  D+I
Sbjct: 388 HLNEELLKKSF--TLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDII 445

Query: 201 CLQEIDHLQYQSFWKAEFEKVGYESQFHRK------QSKN----HGVAIIWRKELFTLTD 250
           CLQE++   Y+ FW    EK GY   FH K      QSK+     G  I ++   FT   
Sbjct: 446 CLQEVESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVF 505

Query: 251 KMLIDFD-------KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMG--IIVG 301
           K  IDF        K    E       N   +AL +K   +          R G  + V 
Sbjct: 506 KDAIDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLRHE----------RTGEHVWVV 555

Query: 302 TTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPF-FCGDFNSQ 358
           TTHL W P     +T Q  V+L+ +++ + +   + +  D       P   CGDFNSQ
Sbjct: 556 TTHLHWDPHFNDVKTFQVAVMLDYIEKLLKQHGGVGSPQDKKK---IPLVICGDFNSQ 610

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 102/235 (43%), Gaps = 18/235 (7%)

Query: 136 IQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKH 194
           +Q    HL +E     F  ++++YN L Q     K++  +   AL W  R   L  +   
Sbjct: 383 LQESTQHLSKETLKRSF--TLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIIS 440

Query: 195 YNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKE 244
           +  DV+CLQE++   ++ FW    +K GY   FH K      QSK+     G  + ++  
Sbjct: 441 FQADVVCLQEVECKTFEDFWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNS 500

Query: 245 LFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTH 304
            F L  K  +DF          + T +    A++ K       K  +  +   I V TTH
Sbjct: 501 EFKLVFKDAVDFSSVWMKHKKFQRTEDYLNRAMN-KDNVALFVKLQHLKTNEQIWVTTTH 559

Query: 305 LFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPF-FCGDFNSQ 358
           L W P     +T Q  V+L+ M++ +   N + NN +       P   CGDFNSQ
Sbjct: 560 LHWDPQFNDVKTFQVGVLLDYMEKLLRDQNGVGNNQEMKK---VPLVICGDFNSQ 611

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 99/234 (42%), Gaps = 16/234 (6%)

Query: 136 IQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKH 194
           +Q    HL+ E     F  ++++YN L Q     K++  +   AL W  R + L  +  +
Sbjct: 394 LQESDSHLNRETAKKSF--TLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILY 451

Query: 195 YNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKE 244
           Y+ D+ICLQE++   Y+ FW     + GY   FH K            K  G  + +R  
Sbjct: 452 YSTDIICLQEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDS 511

Query: 245 LFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTH 304
            F L  K  +DF          + T +    A++ K     L K  +  S   +   TTH
Sbjct: 512 EFKLIFKDTVDFSSVWMKHKKFQRTEDYLNRAMN-KDNVALLVKLQHLKSGEHVWAATTH 570

Query: 305 LFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358
           L W P     +T Q  V+L+ M++ +   +    NN  +        CGDFNSQ
Sbjct: 571 LHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGY--NNSQELKKVPVIICGDFNSQ 622

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 92/216 (42%), Gaps = 14/216 (6%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++      AL W  R + L  E   Y  DVICLQE++   Y+ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 213 FWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTDKMLIDFDKEPSG 262
           FW    EK GY   FH K            K  G  I ++   F+   K  IDF      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
               + T +    A++ K     + K  +  S   + V TTHL W P     +T Q  V+
Sbjct: 565 HKKFQRTEDYLNRAMN-KDNIALIVKLKHELSGEHVWVVTTHLHWDPHFNDVKTFQVGVL 623

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358
           L+ +++ + + + + N  +          CGDFNSQ
Sbjct: 624 LDYIEKLLKQQSNIGNPQEKKKVPL--IICGDFNSQ 657

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 93/232 (40%), Gaps = 14/232 (6%)

Query: 144 HEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICL 202
           H+         +I++YN L Q     K++  +   AL W  R + L  +   YN D++CL
Sbjct: 398 HQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCL 457

Query: 203 QEIDHLQYQSFWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTDKM 252
           QE++   Y+ FW     + GY   FH K            K  G    ++   F L  K 
Sbjct: 458 QEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKE 517

Query: 253 LIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGT 312
            +DF          + T +    A++ K     + K  +  S   +   TTHL W P   
Sbjct: 518 AVDFSSVWMKHKKFQRTEDYLNRAMN-KDNVALVVKLQHIKSGEHVWAATTHLHWDPQFN 576

Query: 313 YERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPY 364
             +T Q  V+L+ M++ +   N    NN  +        CGDFNSQ     Y
Sbjct: 577 DVKTFQVGVLLDYMEKVIKEQN--NCNNTQELKKVPVVICGDFNSQTNSAVY 626

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 102/240 (42%), Gaps = 30/240 (12%)

Query: 136 IQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKH 194
           +Q+   HL  +     F  ++++YN L Q     K++  +   AL W  R   L  +   
Sbjct: 483 LQQSTEHLTADLAKRSF--TVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILS 540

Query: 195 YNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKE 244
           Y+ DV+CLQE++   ++ +W    EK GY   FH K            K  G  I ++++
Sbjct: 541 YSSDVLCLQEVESKTFEDYWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRD 600

Query: 245 LFTLTDKMLIDFD-------KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMG 297
            F + ++  +DF        K    E       N   +AL LK     L   S+G +   
Sbjct: 601 QFKMVNRDSMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLK-----LQHVSSGDT--- 652

Query: 298 IIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           I V TTHL W P     +T Q  V+L+ ++  +       +N+  D        CGDFNS
Sbjct: 653 IWVVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEDTT--HNSRQDIKKSPVLICGDFNS 710

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 103/246 (41%), Gaps = 30/246 (12%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            S+++YN L Q     K++  +   AL W  R   L  +   Y+ DV+CLQE++   ++ 
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFED 596

Query: 213 FWKAEFEKVGYESQF---------HRKQSKN-HGVAIIWRKELFTLTDKMLIDFD----- 257
           +W    +K GY   F         H K SK   G  I ++++ F L  K  +DF      
Sbjct: 597 YWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMK 656

Query: 258 --KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYER 315
             K    E       N   +AL LK     L   S+G +   I V TTHL W P     +
Sbjct: 657 HKKFQRTEDYLNRAMNKDNVALFLK-----LQHVSSGDT---IWVVTTHLHWDPKFNDVK 708

Query: 316 TRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPY--LSMTSKPIH 373
           T Q  V+L+ ++  +       +N+  D        CGDFNS      Y  +S     +H
Sbjct: 709 TFQVGVLLDHLESLLKEDTT--HNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQVH 766

Query: 374 YKGRAK 379
            +G  +
Sbjct: 767 QEGNGR 772

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 93/215 (43%), Gaps = 17/215 (7%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            +I++YN L Q     K++  +   AL+W  R + L  +   Y  D++CLQE++   Y+ 
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 213 FWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKELFTLTDKMLIDFDKEPSG 262
           FW    EK GY   FH K      Q+K+     G  + ++K  F L  K  +DF      
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQK 585

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
               + T +    A++ K       K  +  S   + V TTHL W P     +T Q  V+
Sbjct: 586 HKRFQRTEDYLNRAMN-KDNVAIYMKLQHVQSGEYLWVVTTHLHWDPKFNDVKTFQVGVL 644

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           L+ M+  +   N  Q     D   +     GDFNS
Sbjct: 645 LDHMESIIKEENPKQ-----DVKKFPIIITGDFNS 674

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 90/215 (41%), Gaps = 17/215 (7%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            +I++YN L Q     K++  +   AL W  R + L  +   Y  D++CLQE++   ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 213 FWKAEFEKVGYESQFH----------RKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSG 262
           FW    EK  Y+  FH          ++  K  G  I ++K  F L  K  +DF      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
               + T +    A++ K       K  + TS   + V TTHL W P     +T Q  ++
Sbjct: 689 HKKFQRTEDYLNRAMN-KDNVALYMKLQSITSGETVWVVTTHLHWDPKFNDVKTFQVGIL 747

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           L+ M+  +   N  Q     D        CGD NS
Sbjct: 748 LDHMETLLKEENPKQ-----DVKKANVVICGDLNS 777

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 102/237 (43%), Gaps = 23/237 (9%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++  +   AL W  R + L  +  ++N D+ICLQE++   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 213 FWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKELFTLTDKMLIDFDKEPSG 262
           FW+   EK GY   FH K      QSK+     G    ++   F +  K  +DF      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
               + T +    A++ K     + K  +  S   + + TTHL W P     +T Q  V+
Sbjct: 658 HKKFQRTEDYLNRAMN-KDNVAIVMKLQHIQSGEIMWLVTTHLHWDPKFNDVKTFQVGVL 716

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAK 379
           L+ M+  +   N  Q     D   +    CGD NS      YLS +   +   GR +
Sbjct: 717 LDHMETLLKEQNPKQ-----DVKKYPLVICGDLNS------YLSSSVYELFSTGRVQ 762

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 91/216 (42%), Gaps = 14/216 (6%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            +IM+YN L Q     K++  +   AL W  R + L+ E   Y  D++CLQE++   Y+ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 213 FWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTDKMLIDFDKEPSG 262
            W     K GY   FH K            K  G  + +++  F L  K  +DF      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
               + T +    A++ K       K ++  S   + + TTHL W P     +T Q  ++
Sbjct: 644 HKKFQRTEDYLNRAMN-KDNVVIYIKLNHLKSGESVWIATTHLHWDPQFNDVKTFQVGIL 702

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358
           ++ ++E +       +  D   S      CGDFNSQ
Sbjct: 703 MDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQ 736

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 104/238 (43%), Gaps = 38/238 (15%)

Query: 142 HLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVI 200
           HL+ E     F  ++++YN L Q     K++  +   AL W  R + L ++   +  DVI
Sbjct: 442 HLNPELQKKSF--TVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVI 499

Query: 201 CLQEIDHLQYQSFWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKELFTLTD 250
           CLQE++   Y+ FW    +K GY   F+ K      Q+K+     G  I +++  F +  
Sbjct: 500 CLQEVESKSYEEFWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLY 559

Query: 251 KMLIDFD-------KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTT 303
           K  +DF        K    E       N   +AL +K     L    +G S   + V TT
Sbjct: 560 KDSVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALYMK-----LEHIKSGES---VWVVTT 611

Query: 304 HLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWY----PFFCGDFNS 357
           HL W P     +T Q  ++L+ ++E      +L++NN+  +           CGD NS
Sbjct: 612 HLHWDPQFNDVKTFQVGILLDHLEE------LLKDNNNASSKQEIRKCPVIICGDLNS 663

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 97/235 (41%), Gaps = 30/235 (12%)

Query: 142 HLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVI 200
           HL  E     F  ++++YN L Q     K++  +   AL W  R + L+ +   Y  DVI
Sbjct: 454 HLSSELSKRSF--TVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVI 511

Query: 201 CLQEIDHLQYQSFWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTD 250
           CLQE++   ++ +W    +K GY   FH K            K  G  + +R+  F L  
Sbjct: 512 CLQEVEAKTFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAY 571

Query: 251 KMLIDFD-------KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTT 303
           K  +DF        K    E       N   +A+ LK     L    +G S   + + TT
Sbjct: 572 KDAVDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLK-----LQHIKSGES---VWIVTT 623

Query: 304 HLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358
           HL W P     +T Q  V+++ ++  +   +  Q+  +          CGD NS+
Sbjct: 624 HLHWDPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCP--VILCGDLNSE 676

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 92/222 (41%), Gaps = 28/222 (12%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++  +   AL W  R   L  +   Y+ D++CLQE++   ++ 
Sbjct: 505 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEE 564

Query: 213 FWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTDKMLIDFD----- 257
           +W    +K GY   FH K            K  G  I ++++ F L  K  +DF      
Sbjct: 565 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMK 624

Query: 258 --KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYER 315
             K    E       N   +AL LK     L    +G +   +   TTHL W P     +
Sbjct: 625 HKKFQRTEDYLNRAMNKDNVALFLK-----LQHIPSGDTIWAV---TTHLHWDPKFNDVK 676

Query: 316 TRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           T Q  V+L+ ++  +       +N   D   +    CGDFNS
Sbjct: 677 TFQVGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 91/222 (40%), Gaps = 28/222 (12%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++  +   AL W  R   L  +   Y+ D++CLQE++   ++ 
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFED 566

Query: 213 FWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKELFTLTDKMLIDFD----- 257
           +W    +K GY   FH K            K  G  I ++K+ F L  K  +DF      
Sbjct: 567 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMK 626

Query: 258 --KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYER 315
             K    E       N   +AL LK     L    +G +   I   TTHL W P     +
Sbjct: 627 HKKFQRTEDYLNRAMNKDNVALFLK-----LQHIPSGDT---IWAVTTHLHWDPKFNDVK 678

Query: 316 TRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           T Q  V+L+ ++  +       +N   D        CGDFNS
Sbjct: 679 TFQVGVLLDHLETLLREETT--HNFRQDIKKSPVLICGDFNS 718

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 94/222 (42%), Gaps = 28/222 (12%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++  +    L W  R + L N+      DVICLQE++   Y+ 
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 213 FWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKELFTLTDKMLIDFD----- 257
           FW    +K GY   FH K      QSK+     G  I +++  F L  +  +DF      
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 258 --KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYER 315
             K    E       N   +AL +K     L   ++G S   + V TTHL W P     +
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVK-----LEHINSGES---VWVVTTHLHWDPQFNDVK 711

Query: 316 TRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           T Q  V+L+ ++  +   N    ++  +        CGD NS
Sbjct: 712 TFQVGVLLDHLESLLKDYN--NASSKQEIRKCPVIICGDLNS 751

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 100/234 (42%), Gaps = 32/234 (13%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++  +   AL W  R + L ++   Y  D++CLQE++   ++ 
Sbjct: 526 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEE 585

Query: 213 FWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKELFTLTDKMLIDFD----- 257
           FW    EK  Y+  FH K      QSK+     G  I ++K  F L  K  +DF      
Sbjct: 586 FWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMK 645

Query: 258 --KEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYER 315
             K    E       N   +AL LK     L   ++G S   + V TTHL W P     +
Sbjct: 646 HKKFQRTEDYLNRAMNKDNVALYLK-----LQSLTSGES---VWVVTTHLHWDPKFNDVK 697

Query: 316 TRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTS 369
           T Q  ++L+ M+  +   N  Q     D        CGD NS  FD+    + S
Sbjct: 698 TFQVGILLDHMEALLKEENPKQ-----DVKKANVVICGDLNSY-FDSAVYELLS 745

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 92/215 (42%), Gaps = 14/215 (6%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQS 212
            ++++YN L Q     K++  +   AL W  R   L ++   +  D++CLQE++   Y  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 213 FWKAEFEKVGYESQFHRK------QSKNH----GVAIIWRKELFTLTDKMLIDFDKEPSG 262
           FW+   +K GY+  FH K      Q+K+     G  I +++  F +  K  +DF      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 263 EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVV 322
               + T +    A++ K       K  +  S     + TTHL W P     +T Q  V+
Sbjct: 684 HKNFQRTEDYLNRAMN-KDNVAIYMKLQHIKSGEVTWIVTTHLHWDPQFNDVKTFQVGVL 742

Query: 323 LNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           L+ ++  +   + + +    D        CGD NS
Sbjct: 743 LDHLESLLKEHSNIHSKQ--DVKKCPIIICGDLNS 775

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 103/237 (43%), Gaps = 38/237 (16%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQEIDHLQY 210
           + +++TYN L+   +  +++    D  K W  R ++L +E F  Y  D+ICLQE+    Y
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 211 QSFWKAE-FEKVGYESQFHRKQSKNH---------GVAIIWRKELF-------TLTDKML 253
             FWK +   ++ Y S F  K    +         GV I +  + F          + ++
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 254 IDFDKEPSGEIPPR--TTTNNAGLAL---SLKFTEKALSK------FSNGTSRMGIIVGT 302
             FD++    +     T TN AG  +   SL    KA ++        +  S+  I+V  
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVIN 212

Query: 303 THLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           THL+W     Y+  +  QC +++ K++  +    +L        S+    F GDFNS
Sbjct: 213 THLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSGDFNS 263

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 102/247 (41%), Gaps = 58/247 (23%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQEIDHLQY 210
           K+S++TYN L+   +  +++    D  K W  R K+L  E    Y  D++CLQE+  L Y
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDY 80

Query: 211 QSFW-KAEFEKVGYESQF---------HRKQSKNHGVAI--------------IWRKELF 246
           Q +W K   EK  Y S++          R  S+  GV +              I+  +LF
Sbjct: 81  QQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLF 140

Query: 247 TLTD---------KM--LIDFDKEPSGEIPPRTTT---NNAGLALSLKFTEKALSKFSNG 292
              D         KM  L D    P  ++         N   + +SL+   KA + F   
Sbjct: 141 GTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLR--HKATNTF--- 195

Query: 293 TSRMGIIVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPF 350
                +IV  THL+W     Y+  +  QC +++ ++ + +   ++L    D   +     
Sbjct: 196 -----LIVINTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYNKVKII 244

Query: 351 FCGDFNS 357
           F GD NS
Sbjct: 245 FAGDMNS 251

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 114/266 (42%), Gaps = 46/266 (17%)

Query: 129 ALPDLQFIQRPILHLHEEEPVTGFK----ISIMTYNCLAQALIRRKLFPDSGDALK-WFK 183
           ALP  + I R +L ++      G +     +++TYN L+   +  +++    +  K W  
Sbjct: 14  ALPA-RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEY 72

Query: 184 RSKVLSNEFKH-YNPDVICLQEIDHLQYQSFWKAEFE-KVGYESQF---------HRKQS 232
           R K+L  E  H Y+ D++CLQE+    Y+ FW+ + + ++ +ESQ+          R Q 
Sbjct: 73  RHKLLEYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQE 132

Query: 233 KNHGVAIIWRKELF--------TLTDKM--LIDFDKEPSGEIPPRTTTNNAGL----ALS 278
           +  GV   +  + F         L+D +  L   +KE   +     T     +    +L 
Sbjct: 133 EMDGVGTFYNADKFEHVATDLEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLK 192

Query: 279 LKFTEK-----ALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMH 331
              T++      ++     T  + ++V  T L+W     Y+  +  QC++++ ++K  + 
Sbjct: 193 TVLTQRNQVCLFVTLLHKPTGSLFVVVN-TQLYWK----YDEVKLAQCFIIMRRLKAIVK 247

Query: 332 RINVLQNNNDGDTSHWYPFFCGDFNS 357
           R   L    D   S+      GD NS
Sbjct: 248 R---LLTRKDTSYSNIKVLLSGDLNS 270

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 97/238 (40%), Gaps = 40/238 (16%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQY 210
           + +++TYN L+ A +  +++    +  K W  R  +L  E    Y  D++C+QE+    Y
Sbjct: 38  RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDY 97

Query: 211 QSFWK----------AEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLT-------DKML 253
           Q FW           +EF        + R+  +  GVAI + +++F          ++ML
Sbjct: 98  QQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQML 157

Query: 254 IDFDKE------------PSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVG 301
             F+                G   P   TN     L LK          + ++ M  +V 
Sbjct: 158 DAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNF-LKLKNQVSLFVSLQHKSTGMYFVVI 216

Query: 302 TTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
            THL+W     Y+  +  QC V++ ++ + +   ++L++  D         F GD NS
Sbjct: 217 NTHLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 111/277 (40%), Gaps = 43/277 (15%)

Query: 113 RQAKKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVT-GFKISIMTYNCLAQALIRRKL 171
           R+    A+L++G+   +L        PI   H+  P       + ++YN L+   +  ++
Sbjct: 8   RKLIPTASLSKGVRGPSL------SIPIQQPHQTLPAAKNPTFTFLSYNMLSPHYMWPQV 61

Query: 172 FPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQEIDHLQYQSFWKAEFEK-VGYESQFH 228
           +       K W  R  +L  E    Y  D++C+QE+  + Y SFW+    K   Y S+F 
Sbjct: 62  YTYVPQEYKDWKYRHNLLEKEILDKYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFI 121

Query: 229 RKQSKNH---------GVAIIWRKELFTLTDKMLID-------FDKEPSGEIPPRTTT-- 270
            K   N+         GV I +  ++F       I+       FD++    +  +  T  
Sbjct: 122 AKNPPNYWTKSLVEMDGVGIFYNLDMFDYIGSRSINLNDLASTFDRKELDYMAAKEITIL 181

Query: 271 -NNAGLALSLKFTEKALSK--------FSNGTSRMGIIVGTTHLFWHPFGTYERTR--QC 319
             N  +       E ALSK          +  S+   ++  THL+W     YE  +  QC
Sbjct: 182 NGNGDVTGKESLYELALSKNQVCLFVMVEHKISKDVFVIINTHLYW----KYEEVKLTQC 237

Query: 320 YVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFN 356
            +++ K+ + ++ +     + D + +     F GD N
Sbjct: 238 MIIMRKLAKIVNELLFNAESRDMNYNKVKILFSGDLN 274

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 100/235 (42%), Gaps = 41/235 (17%)

Query: 155 SIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQEIDHLQYQS 212
           +++TYN L+Q+ +  +++       K W  R K+L  E  K YN D+ICLQE+    Y+ 
Sbjct: 23  TLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYEY 82

Query: 213 FWKAEFEKVGYESQFHRKQSKNH---------GVAIIWRKELFTLTDK--------MLID 255
           +W+ +  K    S F  K    +         GV I +  ++F L D         ++ D
Sbjct: 83  YWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLISD 142

Query: 256 FDKEPSGEIPPR--TTTNNAGLALSLKFTEKALSKFSNGTSRMGI---------IVGTTH 304
           F++     +  R    T+  G  + +      L + +     M +         +V TTH
Sbjct: 143 FEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVTTH 202

Query: 305 LFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
           L+W     Y+  +  QC +++ ++ + M      Q   DG +S     F GD NS
Sbjct: 203 LYWK----YDEIKLTQCMIIMRQLSKIMKD----QLKKDG-SSFVKVLFAGDLNS 248

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 99/240 (41%), Gaps = 37/240 (15%)

Query: 155 SIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEFKH-YNPDVICLQEIDHLQYQS 212
           + MTYN L+   +  +++    +  K W  R ++L  E  + Y  D++C+QE+    Y  
Sbjct: 35  TFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYDG 94

Query: 213 FWKAEFE-KVGYESQF---------HRKQSKNHGVAIIWRKELF--------TLTDKM-L 253
           FWK  F+ K+ Y S F          R   +  GV I +  + F         L D + L
Sbjct: 95  FWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIGL 154

Query: 254 IDFDKEPSGEIPPRTTTNNAG------LALSLKFTEKALSKFSN---GTSRMGIIVGTTH 304
            +  +    +    T TN AG        L++      +S F +     +R   +V  TH
Sbjct: 155 FNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINTH 214

Query: 305 LFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDT-SHWYPFFCGDFNSQPFDTP 363
           L+W     Y+  + C   L  M++    I  L    +G T S     F GD NS P D+P
Sbjct: 215 LYW----KYDEVKLCQ-CLTIMRKLHRVIKSLLMGREGVTYSKVKILFAGDLNSAP-DSP 268

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 103/246 (41%), Gaps = 37/246 (15%)

Query: 149 VTGFKISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEFKH-YNPDVICLQEID 206
           V+    ++MTYN L+   +  +++    +  K W  R ++L  E  + Y  D++C+QE+ 
Sbjct: 25  VSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELT 84

Query: 207 HLQYQSFWKAEFE-KVGYESQF---------HRKQSKNHGVAIIWRKELF--------TL 248
              Y+ FWK  F+ K+ Y S +          R + +  GV I +    F         L
Sbjct: 85  CKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYL 144

Query: 249 TDKM-LIDFDKEPSGEIPPRTTTNNAG------LALSLKFTEKALSKFSN---GTSRMGI 298
            D + L +  +    +    T TN AG        L++      +S F +     +R   
Sbjct: 145 NDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLF 204

Query: 299 IVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDT-SHWYPFFCGDFNS 357
           +V  THL+W     Y+  + C   L  M++    I  L    +G T S     F GD NS
Sbjct: 205 VVVNTHLYW----KYDEVKLC-QCLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNS 259

Query: 358 QPFDTP 363
            P D+P
Sbjct: 260 AP-DSP 264

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 99/248 (39%), Gaps = 48/248 (19%)

Query: 147 EPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQE 204
           +P    K +++TYN L+   +  +++    +  K W  R ++L +E FK Y  D++CLQE
Sbjct: 23  KPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQE 82

Query: 205 IDHLQYQSFWKAEF-EKVGYESQF---------HRKQSKNHGVAIIWRKELFTLTDKMLI 254
           +    Y +FW  +  E + Y S F          R   +  GV I +  + F       I
Sbjct: 83  LTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI 142

Query: 255 DFDKEPSGEIPPR----------TTTNNAGLALSLKFTEKALSKFSNGTSRMGI------ 298
            +  +  G    R          T TN AG A+     +  L     G +++ +      
Sbjct: 143 -YLNDVLGIFNVRELKYMKETMITLTNGAGEAIG----KDNLMNILQGRNQVCLFVSLRH 197

Query: 299 -------IVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYP 349
                  +V  THL+W     Y+  +  QC  ++ K++  +   ++L        S    
Sbjct: 198 KDTNTVFVVINTHLYWK----YDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKI 251

Query: 350 FFCGDFNS 357
            F GD NS
Sbjct: 252 LFSGDLNS 259

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 101/251 (40%), Gaps = 60/251 (23%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQY 210
           K +++TYN L+   +  +++    D  K W  R K+L  E  + Y  D++CLQE+    Y
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 211 QSFWKAEF-EKVGYESQF---------HRKQSKNHGVAIIWRKELFT--------LTDKM 252
            S+WK +  EK+ Y S+F          + + +  G  I + +E F         L D +
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVV 166

Query: 253 -----------------LIDFDKEPSGE---IPPRTTTNNAGLALSLKFTEKALSKFSNG 292
                            L D   +P+G        TT N   L +SL+          + 
Sbjct: 167 GTFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLR----------HK 216

Query: 293 TSRMGIIVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYP- 349
            +    +V  THL+W     Y+  +  QC +++ K+   ++ + +  N    D S     
Sbjct: 217 ATNTVFVVINTHLYWK----YDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKD 272

Query: 350 ---FFCGDFNS 357
               F GD NS
Sbjct: 273 VKIIFSGDLNS 283

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 93/237 (39%), Gaps = 40/237 (16%)

Query: 154 ISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQEIDHLQYQ 211
           +S++TYN L+   +  +++    D  K W  R K+L  E F  +  D++CLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 212 SFWKAEFE-KVGYESQFHRKQSKNH---------GVAIIWRKELFTLTDKMLI------- 254
            FW+ + + ++ Y S F  K    +         GV   +  E        +I       
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 255 DFDKEPSGEIPPRTTTNNAGL--------ALSLKFTEKALSKF---SNGTSRMGIIVGTT 303
            F K     +  R  T   G          LS+      +  F       ++  I+V  T
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTKSLIVVVNT 209

Query: 304 HLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDT-SHWYPFFCGDFNS 357
           HL+W     Y+  +  QC  ++ K+K+    IN L    +G T S       GD NS
Sbjct: 210 HLYWK----YDEVKLSQCLTIMRKLKQV---INKLTTTLEGVTYSQIKIILGGDLNS 259

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 100/251 (39%), Gaps = 59/251 (23%)

Query: 149 VTGFKISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEID 206
           + G K +++TYN L+   +  +++    D  K W  R  +L +E  + Y  DV+CLQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 207 HLQYQSFWKAEFEK-VGYESQFHRK---------QSKNHGVAIIWRKELFT--------L 248
              Y S+WK  F K + Y S+F  K         + +  G  I +  + F         L
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 249 TDKM-----------------LIDFDKEPSGE---IPPRTTTNNAGLALSLKFTEKALSK 288
            D +                 L D    P GE          N   L +SLK  E     
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKE----- 206

Query: 289 FSNGTSRMGIIVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSH 346
               T+ + +++  THL+W     Y+  +  QC +++ K+ +    IN L    D   S 
Sbjct: 207 ----TNNVFVVIN-THLYWK----YDEVKLTQCMIIMRKLSQI---INELLIGADPSLSK 254

Query: 347 WYPFFCGDFNS 357
              F  GD NS
Sbjct: 255 DVIFITGDLNS 265

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 95/247 (38%), Gaps = 60/247 (24%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQY 210
           K +++TYN L+ + +  +++    D  K W  R K+L +E    Y  D++CLQE+    Y
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 211 QSFWKAEF-EKVGYESQF---------HRKQSKNHGVAIIWRKELFTLTDK--------- 251
              WK      +GY S+F          R+  +  GV I +  + F              
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 252 ----------------MLIDFDKEPSGE---IPPRTTTNNAGLALSLKFTEKALSKFSNG 292
                           +L D    P GE   +   +  N   L +SLK  E         
Sbjct: 149 NVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKE--------- 199

Query: 293 TSRMGIIVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPF 350
           T  M +++  THL+W     Y+  +  QC ++   M+E    I+ L    D D       
Sbjct: 200 TGEMFVVI-NTHLYWK----YDEVKLTQCMII---MRELSKIIDELVKGVD-DPGKVKIL 250

Query: 351 FCGDFNS 357
           F GD NS
Sbjct: 251 FTGDLNS 257

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 103/241 (42%), Gaps = 49/241 (20%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQY 210
           K ++++YN L+ + +  +++    D  K W  R  +L  E    Y  D++C+QE+    Y
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 211 QSFWKAEF-EKVGYESQFHRKQSKNH---------GVAIIWRKELFTLT-------DKML 253
             +W+ +    +GY S+F  K    +         GVAI +  + F          ++ L
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 254 IDFDKEPSGEIPPRT--TTNNAGLALSLKFTEKALSKFSNGTSRMGI------------- 298
             F+ E    +  +T   T+ AG    +K  EK L +  +  +++ +             
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAG----IKIDEKTLFEILSVKNQVSLFVCLKHKETGQVF 204

Query: 299 IVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFN 356
           I+  THL+W     Y+  +  QC +++ ++ + +  +  LQ   D   S     F GD N
Sbjct: 205 IIINTHLYWK----YDEVKLSQCIIIMRELSKIIDEL--LQ---DVRHSKVKIIFAGDLN 255

Query: 357 S 357
           S
Sbjct: 256 S 256

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 98/240 (40%), Gaps = 48/240 (20%)

Query: 155 SIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQYQS 212
           ++++YN L+ + +  +++    +  K W  R K+L  E    Y  D++CLQE+    Y +
Sbjct: 23  TLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYSN 82

Query: 213 FWKAEFE-KVGYESQF---------HRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSG 262
           FWK   +  + Y S +          R   +  GV I +  + F    +  I  ++    
Sbjct: 83  FWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLGV 142

Query: 263 ---------EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGI-------------IV 300
                    E  P T T+ AG  +     E++L +     +++ +             +V
Sbjct: 143 FSNNELEYLEKKPVTLTDGAGNQVG----EQSLLQILKSKNQVALFVSLKHKETGNVFVV 198

Query: 301 GTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINV-LQNNNDGDTSHWYPFFCGDFNS 357
             THL+W     Y+  +  QC +++ ++   + +  V L+N  D         F GD NS
Sbjct: 199 INTHLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 97/247 (39%), Gaps = 58/247 (23%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNE-FKHYNPDVICLQEIDHLQY 210
           K + MTYN L+   +  +++    D  K W  R K+L  E    Y  D++CLQE+    Y
Sbjct: 28  KFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDY 87

Query: 211 QSFWKAEFEK-VGYES--------QFHRKQSKN-HGVAIIWR------------------ 242
             +W+   ++   Y S        Q+ +K +K+  GV I +                   
Sbjct: 88  HQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLI 147

Query: 243 -----KELFTLTDKM--LIDFDKEPSGE---IPPRTTTNNAGLALSLKFTEKALSKFSNG 292
                 EL  L  K   L D    P GE   +    + N  GL ++LK  +         
Sbjct: 148 GSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKD--------- 198

Query: 293 TSRMGIIVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPF 350
            +    +V  THL+W     Y+  +  QC +++ K+ + +   ++L   +    +     
Sbjct: 199 -TNTIFVVINTHLYW----KYDEVKLTQCLIIMRKLAKIIR--DLLVGEHGTTYNKMKVV 251

Query: 351 FCGDFNS 357
           F GD NS
Sbjct: 252 FAGDLNS 258

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 98/239 (41%), Gaps = 43/239 (17%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEFKH-YNPDVICLQEIDHLQY 210
           + +++TYN L+ + +  +++    +  K W  R K+L  E  + +  D++CLQE+    Y
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDY 85

Query: 211 QSFWKAEF-EKVGYESQFHRKQSKNH---------GVAIIWRKELF-------TLTDKML 253
           + +W+      + Y S+F  K    +         GV+I +  E F          +++L
Sbjct: 86  EDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQLL 145

Query: 254 IDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV-------GT---- 302
             F++     +  +  T   G   S    E +L     G +++ + V       GT    
Sbjct: 146 NVFNERELKYLFNKKVTLTDG--ASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFVV 203

Query: 303 --THLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
             THL+W     Y+  +  QC ++   M+E    I  L + +          F GD NS
Sbjct: 204 LNTHLYWK----YDEVKLTQCMII---MRELSKIIKQLLSGDVKSQRKVKILFTGDLNS 255

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 96/239 (40%), Gaps = 43/239 (17%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQY 210
           + +++TYN L+ + +  +++    +  K W  R K+L  E    +  D++CLQE+    Y
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDY 85

Query: 211 QSFWKAEF-EKVGYESQFHRKQSKNH---------GVAIIWRKELF-------TLTDKML 253
           +++W       + Y S+F  K    +         GV+I +  E F          +++L
Sbjct: 86  ENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLL 145

Query: 254 IDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGI-------------IV 300
             F++     +  +  T   G +  +   E +L     G +++ +             +V
Sbjct: 146 NVFNERELKYLYNKKVTLTDGASNVIG--EDSLLDVLKGKNQVCLFVSLKHKETNTIFVV 203

Query: 301 GTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNS 357
             THL+W     Y+  +  QC ++   M+E    I  L   +          F GD NS
Sbjct: 204 LNTHLYWK----YDEVKLTQCMII---MRELSKIIKQLLPGDANAQEKVKILFTGDLNS 255

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEF-KHYNPDVICLQEIDHLQY 210
           + +++TYN L+ + +  +++    +  K W  R K+L  E    +  D++CLQE+    Y
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDY 85

Query: 211 QSFWKAEF-EKVGYESQFHRKQSKNHGVAIIWRKEL 245
           + +W       + Y S+F  K    +     W+K L
Sbjct: 86  EDYWHDSIGVNINYGSKFISKTPPKY-----WKKPL 116

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 153 KISIMTYNCLAQALIRRKLFPDSGDALK-WFKRSKVLSNEFKH-YNPDVICLQEIDHLQY 210
           + +++TYN L+ + +  +++    +  K W  R ++L  E  + +  D++CLQE+    Y
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDY 85

Query: 211 QSFWKAEF-EKVGYESQFHRK 230
           + +W       V Y S+F  K
Sbjct: 86  EDYWHDSIGVDVNYGSKFISK 106

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,297,279
Number of extensions: 2771627
Number of successful extensions: 7823
Number of sequences better than 10.0: 82
Number of HSP's gapped: 7878
Number of HSP's successfully gapped: 83
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)