Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B091501.1ON1501507881e-109
Smik_92.1singletonON1561442001e-19
YCR040W (MATALPHA1)1.120ON1751451992e-19
YCL066W (HMLALPHA1)1.1ON1751451992e-19
Suva_3.1481.1ON1751351983e-19
Suva_69.2singletonON1451301954e-19
Skud_71.1singletonON1551111764e-16
Skud_3.1191.120ON1741111757e-16
TDEL0C070101.1ON2051861768e-16
ZYRO0F18590g1.1ON2001821636e-14
ZYRO0F15840g1.120ON2001821636e-14
NDAI0A001001.1ON1351001581e-13
CAGL0B01243g1.120ON143511441e-11
CAGL0B00242g1.1ON184511443e-11
KNAG0C001501.1ON1451431423e-11
TBLA0A070401.120ON2011901411e-10
TBLA0A075901.1ON2011901411e-10
Kpol_2002.21.1ON209751341e-09
KLTH0F00374g1.1ON2491481332e-09
Kwal_33.matalpha1singletonOFF2441521252e-08
Kwal_33.12992singletonOFF2441521252e-08
Kwal_YGOB_matalpha11.120ON2441521252e-08
Kwal_YGOB_HMalpha11.1ON2441521252e-08
KLLA0C00352g1.1ON2611521122e-06
KAFR0D007101.120ON172441102e-06
Ecym_10031.1ON263521024e-05
Ecym_11141.120ON263521024e-05
TPHA0E036201.120ON195631005e-05
TPHA0E040801.1ON195631005e-05
KNAG0H007203.354ON51659690.92
SAKL0D10450g1.432ON55857671.7
Skud_16.3503.354ON37257671.8
YPR065W (ROX1)3.354ON36857662.1
TPHA0E036401.52ON113778662.4
Skud_6.1051.359ON50082635.4
NCAS0A010506.224ON63864636.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09150
         (150 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1     308   e-109
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    82   1e-19
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    81   2e-19
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    81   2e-19
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    81   3e-19
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        80   4e-19
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    72   4e-16
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    72   7e-16
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    72   8e-16
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    67   6e-14
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    67   6e-14
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    65   1e-13
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    60   1e-11
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    60   3e-11
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    59   3e-11
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    59   1e-10
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    59   1e-10
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    56   1e-09
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    56   2e-09
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    53   2e-08
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    53   2e-08
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    53   2e-08
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    53   2e-08
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    48   2e-06
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    47   2e-06
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    44   4e-05
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    44   4e-05
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    43   5e-05
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    43   5e-05
KNAG0H00720 Chr8 (114623..116173) [1551 bp, 516 aa] {ON} Anc_3.3...    31   0.92 
SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly...    30   1.7  
Skud_16.350 Chr16 (644526..645644) [1119 bp, 372 aa] {ON} YPR065...    30   1.8  
YPR065W Chr16 (679693..680799) [1107 bp, 368 aa] {ON}  ROX1Heme-...    30   2.1  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    30   2.4  
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    29   5.4  
NCAS0A01050 Chr1 complement(207858..209774) [1917 bp, 638 aa] {O...    29   6.3  

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score =  308 bits (788), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%)

Query: 1   MSSTIYCNQNKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNW 60
           MSSTIYCNQNKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNW
Sbjct: 1   MSSTIYCNQNKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNW 60

Query: 61  VLQELETIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAK 120
           VLQELETIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAK
Sbjct: 61  VLQELETIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAK 120

Query: 121 FWKSSDTDQALWDYFALQYSTVGCEMGVWV 150
           FWKSSDTDQALWDYFALQYSTVGCEMGVWV
Sbjct: 121 FWKSSDTDQALWDYFALQYSTVGCEMGVWV 150

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 11  KPLFKVN--IPRRVRNRNSKQPLKPKPVTYDT---CFNIFLKDPKNITIPQPPNWVLQEL 65
           KP F++N  I +  RN    + +K + +T      CFN+     K+I IP P +  L+++
Sbjct: 5   KPAFRINNKISKSHRNPVVSKKIKERRITKHVKPNCFNVIRPLKKDIQIPIPSSRFLKKI 64

Query: 66  ETIRIIYPSK--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWK 123
           +  RI   ++  Q  +  K    +  K +N F+ FR+YYS++G G+KQ +LS LL++ W 
Sbjct: 65  QIHRIASGNQHIQCRQLNKTSIKSTKKYLNSFMAFRAYYSQFGSGVKQNILSSLLSEEWH 124

Query: 124 SSDTDQALWDYFALQYSTVGCEMG 147
           +  T   +WDYFA QY+ +    G
Sbjct: 125 ADKTQHGIWDYFAQQYNFINPGFG 148

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 7/145 (4%)

Query: 10  NKPLFKVN--IPRRVRNRNSKQPLKPKPVTYD---TCFNIFLKDPKNITIPQPPNWVLQE 64
           +KP FK+     +  RN    + LK K +      +CFNI     K+I IP P +  L +
Sbjct: 4   SKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNK 63

Query: 65  LETIRIIYPSK--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFW 122
           ++  RI   S+  Q  +  K    +  K +N F+ FR+YYS++G G+KQ +LS LLA+ W
Sbjct: 64  IQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEW 123

Query: 123 KSSDTDQALWDYFALQYSTVGCEMG 147
            +      +WDYFA QY+ +    G
Sbjct: 124 HADKMQHGIWDYFAQQYNFINPGFG 148

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 7/145 (4%)

Query: 10  NKPLFKVN--IPRRVRNRNSKQPLKPKPVTYD---TCFNIFLKDPKNITIPQPPNWVLQE 64
           +KP FK+     +  RN    + LK K +      +CFNI     K+I IP P +  L +
Sbjct: 4   SKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNK 63

Query: 65  LETIRIIYPSK--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFW 122
           ++  RI   S+  Q  +  K    +  K +N F+ FR+YYS++G G+KQ +LS LLA+ W
Sbjct: 64  IQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEW 123

Query: 123 KSSDTDQALWDYFALQYSTVGCEMG 147
            +      +WDYFA QY+ +    G
Sbjct: 124 HADKMQHGIWDYFAQQYNFINPGFG 148

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 80.9 bits (198), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 73/135 (54%), Gaps = 8/135 (5%)

Query: 15  KVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPS 74
           K +I ++V  +   + + P      +CFNI     KNI IP P    L++++  RI   +
Sbjct: 20  KTDIAKKVEGKRIAKLINP------SCFNIIRPLKKNIQIPAPSPLFLKKIQLYRIASGN 73

Query: 75  K--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALW 132
           +  Q  + RK   +   K +N F+ FR+YYS++G G+KQ +LS LL++ W +      +W
Sbjct: 74  QNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIW 133

Query: 133 DYFALQYSTVGCEMG 147
           DYFA QY+ +    G
Sbjct: 134 DYFAQQYNFINPGFG 148

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 79.7 bits (195), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 8/130 (6%)

Query: 15  KVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPS 74
           K +I ++V  +   + + P      +CFNI     KNI IP P    L++++  RI   +
Sbjct: 20  KTDIAKKVEGKRIAKLINP------SCFNIIRPLKKNIQIPAPSPLFLKKIQLYRIASGN 73

Query: 75  K--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALW 132
           +  Q  + RK   +   K +N F+ FR+YYS++G G+KQ +LS LL++ W +      +W
Sbjct: 74  QNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIW 133

Query: 133 DYFALQYSTV 142
           DYFA QY+ +
Sbjct: 134 DYFAQQYNFI 143

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 40  TCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPSKQKPKPRK---QVTSNPSKPINGFI 96
           +CFN+     K+I IP P +  L++++  RI     Q  + R+       +  K IN F+
Sbjct: 38  SCFNVIRPLKKDIQIPAPASRFLKKIQIHRI-SSGNQTTQCRQLSKASIKSSKKHINSFM 96

Query: 97  LFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTVGCEMG 147
            FR+YYS++G G+KQ +LS LL++ W +      +WDYFA QY+ +    G
Sbjct: 97  AFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFG 147

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 40  TCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPSKQKPKPRK---QVTSNPSKPINGFI 96
           +CFN+     K+I IP P +  L++++  RI     Q  + R+       +  K IN F+
Sbjct: 38  SCFNVIRPLKKDIQIPAPASRFLKKIQIHRI-SSGNQTTQCRQLSKASIKSSKKHINSFM 96

Query: 97  LFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTVGCEMG 147
            FR+YYS++G G+KQ +LS LL++ W +      +WDYFA QY+ +    G
Sbjct: 97  AFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFG 147

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 80/186 (43%), Gaps = 47/186 (25%)

Query: 10  NKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTC------------FNIFLKDPKNITIPQP 57
           N+PLFKV I +  R    K   K K    D C               F+   + I IP P
Sbjct: 14  NRPLFKVQINKDSRTSQCKAKTKFKKAKLDKCQPENSGRLEERHVKTFVVILRPIKIPLP 73

Query: 58  PNWVLQELETIRIIYPSKQKP-------------------------------KPRKQVTS 86
           PN +L+++E  +    S+  P                               KP ++  S
Sbjct: 74  PNILLEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVLGNIYKKPARETAS 133

Query: 87  NPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GC 144
           N  KP+N F+ FR+Y S++GYG+KQ +LS LLA  W S    Q +WD FA Q++ V   C
Sbjct: 134 N--KPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDTFAQQFNFVKPKC 191

Query: 145 EMGVWV 150
               WV
Sbjct: 192 GFVEWV 197

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 67.4 bits (163), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 75/182 (41%), Gaps = 44/182 (24%)

Query: 10  NKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCF----------NIFLKDPKNITIPQPPN 59
           N+PLFKV + ++ R   SK+P          C           N+F+   K I IP PP 
Sbjct: 12  NQPLFKVKVEKKGR---SKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68

Query: 60  WVLQELETIR-----------------------------IIYPSKQKPKPRKQVTSNPSK 90
            +L+++E  +                             I   S      +        K
Sbjct: 69  VLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEK 128

Query: 91  PINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GCEMGV 148
           P+N F+ FR+Y S++G G+KQ +LS LLA  W S    Q +WD FA Q++ V   C    
Sbjct: 129 PLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVE 188

Query: 149 WV 150
           WV
Sbjct: 189 WV 190

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 67.4 bits (163), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 75/182 (41%), Gaps = 44/182 (24%)

Query: 10  NKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCF----------NIFLKDPKNITIPQPPN 59
           N+PLFKV + ++ R   SK+P          C           N+F+   K I IP PP 
Sbjct: 12  NQPLFKVKVEKKGR---SKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68

Query: 60  WVLQELETIR-----------------------------IIYPSKQKPKPRKQVTSNPSK 90
            +L+++E  +                             I   S      +        K
Sbjct: 69  VLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEK 128

Query: 91  PINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GCEMGV 148
           P+N F+ FR+Y S++G G+KQ +LS LLA  W S    Q +WD FA Q++ V   C    
Sbjct: 129 PLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVE 188

Query: 149 WV 150
           WV
Sbjct: 189 WV 190

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 62/100 (62%), Gaps = 6/100 (6%)

Query: 54  IPQPPNWVLQELE-----TIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYG 108
           +P PP W L  +      T R+ Y  K+    R   +   +K INGF+LFRSYYS++G G
Sbjct: 21  VPPPPKWFLDSINFEHNPTTRLTYFQKESIL-RPYQSRCYAKSINGFMLFRSYYSQYGKG 79

Query: 109 IKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTVGCEMGV 148
           +KQ++LS LL+K W + +TDQ LWD FA Q + +G E G+
Sbjct: 80  LKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGGI 119

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 60.1 bits (144), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 38/51 (74%)

Query: 90  KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYS 140
           +P+N F+ FR+YY++ G G+KQ  LS +L++ W + +TDQ +WD FA Q++
Sbjct: 73  RPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 123

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 38/51 (74%)

Query: 90  KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYS 140
           +P+N F+ FR+YY++ G G+KQ  LS +L++ W + +TDQ +WD FA Q++
Sbjct: 114 RPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 66/143 (46%), Gaps = 14/143 (9%)

Query: 11  KPLFKVNIPRRVRNRNS--KQPLKPKPVTYDTCFNIFLKDPKNITIPQPP---NWVLQEL 65
           KPLFK+NI +   +  S  K+  +P   ++ +  N     PK   IP P      + + L
Sbjct: 5   KPLFKMNITQSHSSNKSIRKRTRRPNLNSFAST-NAAKNTPK---IPDPNIIRAVLFRNL 60

Query: 66  ETIRIIYPSKQKPKPRKQVTSNPSK-----PINGFILFRSYYSRWGYGIKQTMLSQLLAK 120
              R I           +   +P +      +N FI FR+YYS++  GI Q  LS +L+K
Sbjct: 61  NDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSK 120

Query: 121 FWKSSDTDQALWDYFALQYSTVG 143
           FWKS+ + Q  WD    QY  + 
Sbjct: 121 FWKSNQSQQTFWDRLTEQYKQID 143

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 41/190 (21%)

Query: 1   MSSTIYCNQNKPLFKVNIP--RRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPP 58
           MS+    +  K LFKVN+   + +R + + + ++ K        +I L    NI IP PP
Sbjct: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNK-FNETRGISILLYKNHNIKIPFPP 59

Query: 59  NWVLQELETIRIIYPSKQKPKPRKQVTSNPS----------------------------- 89
             +L  +E  +    S Q       + ++ +                             
Sbjct: 60  TTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSN 119

Query: 90  -------KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV 142
                  + +NGFI FR+Y S++GYG+KQ +LS LL+  W  +   Q +W++F+ +Y+ V
Sbjct: 120 PNPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFV 179

Query: 143 --GCEMGVWV 150
              C    W+
Sbjct: 180 KPKCGFVEWL 189

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 41/190 (21%)

Query: 1   MSSTIYCNQNKPLFKVNIP--RRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPP 58
           MS+    +  K LFKVN+   + +R + + + ++ K        +I L    NI IP PP
Sbjct: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNK-FNETRGISILLYKNHNIKIPFPP 59

Query: 59  NWVLQELETIRIIYPSKQKPKPRKQVTSNPS----------------------------- 89
             +L  +E  +    S Q       + ++ +                             
Sbjct: 60  TTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSN 119

Query: 90  -------KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV 142
                  + +NGFI FR+Y S++GYG+KQ +LS LL+  W  +   Q +W++F+ +Y+ V
Sbjct: 120 PNPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFV 179

Query: 143 --GCEMGVWV 150
              C    W+
Sbjct: 180 KPKCGFVEWL 189

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 78  PKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFAL 137
           P    +V ++  K +NGF+ FR+Y S++GYG+KQ +LS LL++ W S    Q  W   + 
Sbjct: 123 PNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQ 182

Query: 138 QYSTV--GCEMGVWV 150
           Q++ V   C    WV
Sbjct: 183 QFNFVKPKCGFVEWV 197

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 77/148 (52%), Gaps = 17/148 (11%)

Query: 8   NQNKPLFKVNIPRRVRNRNSKQPLKPKPVTY-DTCFNIFLKDPKNITIPQPPNWVLQELE 66
           N  KP FKV I ++ +  N +  LK    +Y +   N+++   K   IP+PPN ++  + 
Sbjct: 2   NSTKPSFKVLIKKKGKTLNRR--LKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVR 59

Query: 67  T----------IRIIYPSKQKPKPRKQVTSNPS---KPINGFILFRSYYSRWGYG-IKQT 112
           +          ++  Y  K+    +  + SN +   K IN FI FRSYY+++  G ++Q 
Sbjct: 60  SKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQ 119

Query: 113 MLSQLLAKFWKSSDTDQALWDYFALQYS 140
            LS++L+++W  +    ++W++F   Y+
Sbjct: 120 ELSKILSEYWTKNSKIHSVWEFFTQHYN 147

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query: 11  KPLFKVNIPRR----VRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELE 66
           KP FKV++ +R    ++ + SK+ LK   V+     N+++   K   IP+PP  V++ L 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVS--EGVNLYMSYSKQELIPKPPKAVMKILG 62

Query: 67  T----------IRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYG-IKQTMLS 115
           +           + I+  ++             K IN FI FRSYY+R   G I+Q  LS
Sbjct: 63  SDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQELS 122

Query: 116 QLLAKFWKSSDTDQALWDYFALQY---STVGC 144
            +L+++W S       W++F   Y   +TV C
Sbjct: 123 TILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query: 11  KPLFKVNIPRR----VRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELE 66
           KP FKV++ +R    ++ + SK+ LK   V+     N+++   K   IP+PP  V++ L 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVS--EGVNLYMSYSKQELIPKPPKAVMKILG 62

Query: 67  T----------IRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYG-IKQTMLS 115
           +           + I+  ++             K IN FI FRSYY+R   G I+Q  LS
Sbjct: 63  SDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQELS 122

Query: 116 QLLAKFWKSSDTDQALWDYFALQY---STVGC 144
            +L+++W S       W++F   Y   +TV C
Sbjct: 123 TILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query: 11  KPLFKVNIPRR----VRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELE 66
           KP FKV++ +R    ++ + SK+ LK   V+     N+++   K   IP+PP  V++ L 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVS--EGVNLYMSYSKQELIPKPPKAVMKILG 62

Query: 67  T----------IRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYG-IKQTMLS 115
           +           + I+  ++             K IN FI FRSYY+R   G I+Q  LS
Sbjct: 63  SDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQELS 122

Query: 116 QLLAKFWKSSDTDQALWDYFALQY---STVGC 144
            +L+++W S       W++F   Y   +TV C
Sbjct: 123 TILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query: 11  KPLFKVNIPRR----VRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELE 66
           KP FKV++ +R    ++ + SK+ LK   V+     N+++   K   IP+PP  V++ L 
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLKRNYVS--EGVNLYMSYSKQELIPKPPKAVMKILG 62

Query: 67  T----------IRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYG-IKQTMLS 115
           +           + I+  ++             K IN FI FRSYY+R   G I+Q  LS
Sbjct: 63  SDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQELS 122

Query: 116 QLLAKFWKSSDTDQALWDYFALQY---STVGC 144
            +L+++W S       W++F   Y   +TV C
Sbjct: 123 TILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 21/152 (13%)

Query: 10  NKPLFKVNIPRR-----------VRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPP 58
           N P FKV + +R           +R+   ++P            N+++      +IP PP
Sbjct: 4   NAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPP 63

Query: 59  NWVLQEL-ETIRIIYPSK--------QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGI 109
             ++  + E ++ +  S+         +   R   T    K IN FI FRSYYSR   GI
Sbjct: 64  QVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLLNGI 123

Query: 110 -KQTMLSQLLAKFWKSSDTDQALWDYFALQYS 140
             QT LS +++K W      +  W+  A +Y+
Sbjct: 124 LTQTELSTIISKHWTVDKQTRKNWELIAQEYN 155

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%)

Query: 89  SKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALW 132
           ++ +N F+ FRSYYS++  G+KQ  LS++LAK W S   +Q  W
Sbjct: 118 NRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYW 161

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 90  KPINGFILFRSYYSRWGYGIK-QTMLSQLLAKFWKSSDTDQALWDYFALQYS 140
           K IN F+ FRSYYSR+  GI  Q  LS++LA+ W      +  W+ FA  Y+
Sbjct: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYN 162

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 90  KPINGFILFRSYYSRWGYGIK-QTMLSQLLAKFWKSSDTDQALWDYFALQYS 140
           K IN F+ FRSYYSR+  GI  Q  LS++LA+ W      +  W+ FA  Y+
Sbjct: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYN 162

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 90  KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GCEMG 147
           K +N FI FR+Y +++G G+ Q +LS LL+  W S+     +WD FA Q++ V   C   
Sbjct: 122 KSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFV 181

Query: 148 VWV 150
            WV
Sbjct: 182 EWV 184

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 90  KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GCEMG 147
           K +N FI FR+Y +++G G+ Q +LS LL+  W S+     +WD FA Q++ V   C   
Sbjct: 122 KSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFV 181

Query: 148 VWV 150
            WV
Sbjct: 182 EWV 184

>KNAG0H00720 Chr8 (114623..116173) [1551 bp, 516 aa] {ON} Anc_3.354
           YPR065W
          Length = 516

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 90  KPINGFILFRSYYSR-----WG-YGI---KQTMLSQLLAKFWKS-SDTDQALWDYFALQ 138
           +P N FILFR +Y R     W  +G+     T +S++L   WK     ++  WD  A Q
Sbjct: 57  RPRNAFILFRQHYHRILIDDWTKHGVDIPHNTQISKILGTKWKELGPEEKHQWDELARQ 115

>SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly
           similar to gnl|GLV|KLLA0A11110g Kluyveromyces lactis
           KLLA0A11110g
          Length = 558

 Score = 30.4 bits (67), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 9/57 (15%)

Query: 53  TIPQPPNWVLQELETIRIIYPSKQKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGI 109
           ++PQP  +  +  +TIRI  P ++KP  R  + S+       ++   S+   WG GI
Sbjct: 367 SVPQPNGF--EGDDTIRIRIPEEEKPAARAVIASS-------YLFVCSFAPTWGIGI 414

>Skud_16.350 Chr16 (644526..645644) [1119 bp, 372 aa] {ON} YPR065W
           (REAL)
          Length = 372

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 90  KPINGFILFRSYYSR-----W-GYGIK---QTMLSQLLAKFWKS-SDTDQALWDYFA 136
           +P N FILFR +Y R     W   G++    + +S+++   WK     D+A W+  A
Sbjct: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLA 68

>YPR065W Chr16 (679693..680799) [1107 bp, 368 aa] {ON}
           ROX1Heme-dependent repressor of hypoxic genes; contains
           an HMG domain that is responsible for DNA bending
           activity
          Length = 368

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 90  KPINGFILFRSYYSR-----W-GYGIK---QTMLSQLLAKFWKS-SDTDQALWDYFA 136
           +P N FILFR +Y R     W   G++    + +S+++   WK     D+A W+  A
Sbjct: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLA 68

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 3/78 (3%)

Query: 17  NIPRRVRNRNSKQPL---KPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELETIRIIYP 73
           N+PRR +NRNS   +     KPV+Y+    +       I++P   N      + I +   
Sbjct: 411 NVPRRRKNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLS 470

Query: 74  SKQKPKPRKQVTSNPSKP 91
           S  K   R    SN S P
Sbjct: 471 SSNKRNSRLYTQSNSSSP 488

>Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W
           (REAL)
          Length = 500

 Score = 28.9 bits (63), Expect = 5.4,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 19  PRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPSKQKP 78
           PRR+R  N+K+      VT+ T       +   + +       + ++ T+R+++  +  P
Sbjct: 72  PRRLRIINTKKHSIICEVTFPTSILSVKMNKSRLVVLLQEQIYIYDINTMRLLHTIETNP 131

Query: 79  KPRKQVTSNPSKPINGFILFRS 100
            PR  + ++PS   N ++++ S
Sbjct: 132 NPRGLMATSPSVA-NSYLVYPS 152

>NCAS0A01050 Chr1 complement(207858..209774) [1917 bp, 638 aa] {ON}
           Anc_6.224 YPL210C
          Length = 638

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 82  KQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKF--WKSSDTDQALWDYFALQY 139
           K  +S+ S  I  +ILF  Y     +  K+ +L + L     W S + D   W + A Q 
Sbjct: 409 KDKSSSKSNHIVKYILFELYKVTGRHNSKRMLLFRTLTTLDNWDSIEQDLPFWKHVAFQN 468

Query: 140 STVG 143
            T+G
Sbjct: 469 LTIG 472

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,655,592
Number of extensions: 760476
Number of successful extensions: 2050
Number of sequences better than 10.0: 45
Number of HSP's gapped: 2027
Number of HSP's successfully gapped: 48
Length of query: 150
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 50
Effective length of database: 42,014,799
Effective search space: 2100739950
Effective search space used: 2100739950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)