Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B091401.2ON20520510721e-150
NDAI0A001101.2ON2112095021e-63
KAFR0D007201.121ON2062053769e-45
Kpol_2002.31.2ON2232243604e-42
KNAG0C001601.2ON2032053515e-41
TPHA0E040701.2ON2312273458e-40
TPHA0E036101.121ON2312273458e-40
Suva_3.1471.2ON2102043239e-37
YCR039C (MATALPHA2)1.121ON2102043239e-37
YCL067C (HMLALPHA2)1.2ON2102043239e-37
Skud_3.1181.121ON2102043231e-36
ZYRO0F15818g1.121ON2252203152e-35
ZYRO0F18568g1.2ON2252203152e-35
CAGL0B01265g1.121ON1861982819e-31
Skud_102.1singletonON1851792757e-30
Smik_95.1singletonON1851792757e-30
Suva_3.135singletonON119912699e-30
Suva_3.74singletonON119912699e-30
Suva_3.751.121ON119912699e-30
YCR096C (HMRA2)singletonOFF119912699e-30
CAGL0B00264g1.2ON2102062751e-29
Smik_3.1421.121ON2281792752e-29
TBLA0A070501.121ON2612512493e-25
TBLA0A076001.2ON2302382412e-24
Ecym_11151.121ON2301522263e-22
Ecym_10021.2ON2301522263e-22
TDEL0C070001.2ON2371672212e-21
KLLA0C00374g1.2ON2232232115e-20
KLTH0F00396g1.2ON108761206e-08
AFL049C6.170ON2571101204e-07
Kwal_27.110926.170ON229631195e-07
Kwal_YGOB_matalpha21.121ON110451128e-07
Kwal_33.12995singletonOFF110451128e-07
Kwal_YGOB_HMalpha21.2ON110451128e-07
Kwal_33.matalpha2singletonOFF110451128e-07
TPHA0B025806.170ON264571179e-07
Ecym_22476.170ON349601161e-06
Kpol_1036.566.170ON265871161e-06
KAFR0A043706.170ON409521162e-06
NCAS0D035706.170ON257521142e-06
Smik_7.1816.170ON274521143e-06
KLTH0H05236g6.170ON234521115e-06
Skud_16.1036.170ON295601125e-06
Suva_7.1726.170ON270851125e-06
Suva_16.1326.170ON292601116e-06
Skud_7.1816.170ON274601109e-06
Smik_6.3746.170ON294561109e-06
YPL177C (CUP9)6.170ON306601109e-06
ZYRO0G22044g6.170ON201581072e-05
YGL096W (TOS8)6.170ON276521082e-05
NDAI0F021706.170ON383561073e-05
CAGL0C01551g6.170ON221571044e-05
TDEL0F018106.170ON256561054e-05
KAFR0G036506.170ON177521034e-05
SAKL0A05610g6.170ON320681055e-05
CAGL0H02959g6.170ON259691045e-05
KNAG0M005006.170ON298521045e-05
NCAS0H011306.170ON280561036e-05
KNAG0F022106.170ON324521029e-05
TBLA0C037406.170ON293521021e-04
NDAI0I013206.170ON409471011e-04
KLLA0B10450g6.170ON38952975e-04
Suva_69.1singletonON3434700.11
Skud_71.2singletonON4537710.11
TBLA0H027302.584ON16761750.19
TBLA0B070702.337ON645112692.0
SAKL0H02266g5.73ON242654657.5
ACR027Cna 1ON99066648.4
KAFR0E022305.73ON242559649.5
TDEL0B053601.463ON1093100649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09140
         (205 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   417   e-150
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   197   1e-63
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   149   9e-45
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   143   4e-42
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   139   5e-41
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   137   8e-40
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   137   8e-40
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   129   9e-37
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   129   9e-37
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   129   9e-37
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   129   1e-36
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   125   2e-35
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   125   2e-35
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   112   9e-31
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       110   7e-30
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         110   7e-30
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   108   9e-30
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   108   9e-30
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   108   9e-30
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   108   9e-30
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...   110   1e-29
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   110   2e-29
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...   100   3e-25
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    97   2e-24
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    92   3e-22
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    92   3e-22
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    90   2e-21
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    86   5e-20
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    51   6e-08
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    51   4e-07
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    50   5e-07
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    48   8e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    48   8e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    48   8e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    48   8e-07
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    50   9e-07
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    49   1e-06
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    49   1e-06
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    49   2e-06
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    49   2e-06
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    49   3e-06
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    47   5e-06
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    48   5e-06
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    48   5e-06
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    47   6e-06
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    47   9e-06
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    47   9e-06
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    47   9e-06
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    46   2e-05
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    46   2e-05
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    46   3e-05
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    45   4e-05
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    45   4e-05
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    44   4e-05
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    45   5e-05
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    45   5e-05
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    45   5e-05
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    44   6e-05
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    44   9e-05
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    44   1e-04
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    44   1e-04
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    42   5e-04
Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C ...    32   0.11 
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         32   0.11 
TBLA0H02730 Chr8 complement(644533..645036) [504 bp, 167 aa] {ON...    33   0.19 
TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa] ...    31   2.0  
SAKL0H02266g Chr8 (218732..226012) [7281 bp, 2426 aa] {ON} highl...    30   7.5  
ACR027C Chr3 complement(405111..408083) [2973 bp, 990 aa] {ON} N...    29   8.4  
KAFR0E02230 Chr5 complement(444357..451634) [7278 bp, 2425 aa] {...    29   9.5  
TDEL0B05360 Chr2 (947205..950486) [3282 bp, 1093 aa] {ON} Anc_1....    29   9.6  

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  417 bits (1072), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120
           LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT
Sbjct: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120

Query: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180
           KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW
Sbjct: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180

Query: 181 VSNRRRKEKSLSIAPEIVDILNKQK 205
           VSNRRRKEKSLSIAPEIVDILNKQK
Sbjct: 181 VSNRRRKEKSLSIAPEIVDILNKQK 205

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  197 bits (502), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 145/209 (69%), Gaps = 6/209 (2%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTT-ENLDFKTYQEQLRNIAVTLS 59
           MNKIAI DLLNPP        L+SIN QL TICS FPT  EN+D  +YQ QL NI   LS
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVD-GSYQIQLHNIVSFLS 59

Query: 60  SLTNQNELSSENKNVLRVTYQISSVLLKLLGE----NAHNKDQPKTPTSGSESERNPKLV 115
           +LT    L+S++ + +++TY++SS+L K+L +    N   + + K      E E N K V
Sbjct: 60  TLTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKYV 119

Query: 116 FNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKM 175
           FN++T+  M P  N+P RGHRL KEKV+ LEHWY+ H+  PYL+  +L++LM+ET LSK+
Sbjct: 120 FNVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKV 179

Query: 176 QIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           QIKNW+SNRRRKEK LSI+P+IV+I+N Q
Sbjct: 180 QIKNWISNRRRKEKLLSISPDIVEIINTQ 208

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  149 bits (376), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 127/205 (61%), Gaps = 1/205 (0%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I DLLN P    T ++L  IN +L  +CS  P++E L    +  +LR+I + LS 
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120
           L + + + SE K++    +Q++  ++ L+    +         S S+SE + K VFN++T
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGHSYSSSKSESDDKTVFNVVT 120

Query: 121 KKRMSPT-SNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKN 179
           +  M+   +    RGHR +KE V +LE WY  H+D PYLN+ S + L+ +T LS++QIKN
Sbjct: 121 QDMMNLNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQIKN 180

Query: 180 WVSNRRRKEKSLSIAPEIVDILNKQ 204
           WVSNRRRKEKS+ ++PE++ +L K+
Sbjct: 181 WVSNRRRKEKSVHVSPELIQLLQKK 205

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  143 bits (360), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/224 (40%), Positives = 143/224 (63%), Gaps = 24/224 (10%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPT-TENLDFKTYQEQLRNIAVTLS 59
           MNKI I+ LLNP +     ++L+ IN +L ++CS  P  T  L+ + + E L+ I + L+
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLE-LQRILLFLT 59

Query: 60  SLTNQNELSSENKNVLRVTYQISSVL------LKLLGEN-------AHNKDQPKTPTSGS 106
           ++    +L ++   ++R TYQ+S+ L      L++  EN        +++++  +P+S  
Sbjct: 60  TVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSD 119

Query: 107 ESERNPKLVFNILT-----KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKA 161
            ++RN + VFNI+T     KK+M+  S    RGHRL K+ V LLE WYIQ+++NPYL+  
Sbjct: 120 SNDRN-EFVFNIVTQDMMNKKKMNIKS---YRGHRLPKQNVKLLERWYIQNVENPYLDDK 175

Query: 162 SLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205
           S+  LM+ TSLSK+QIKNWVSNRRRKEKS++I+PE+  +L + K
Sbjct: 176 SISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELK 219

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  139 bits (351), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 121/205 (59%), Gaps = 8/205 (3%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MN+I I DLLN  + +   +  ++IN+QL  ICS FP     +    Q QL+ I + L+ 
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLG--ENAHNKDQPKTPTSGSESERNPKLVFNI 118
           L  +N+LS   KN  R+TYQ S ++  LL   E+   + +     + SE+E     VF++
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENE----FVFSV 116

Query: 119 LTKKRMSP--TSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQ 176
           +T+  M+    S  P RGHR +    + LE WY +H + PYL+K SL  L  +T LSKMQ
Sbjct: 117 VTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQ 176

Query: 177 IKNWVSNRRRKEKSLSIAPEIVDIL 201
           I+NWVSNRRRKEKS+ ++P I D+L
Sbjct: 177 IRNWVSNRRRKEKSIHVSPVIQDLL 201

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  137 bits (345), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/227 (36%), Positives = 131/227 (57%), Gaps = 22/227 (9%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I+ LLNP       E+L+ IN  L+ +C+  P T     +    +L++I + L++
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLG--------ENAHNK---------DQPKTPT 103
           +  Q EL  E   +++ TYQ+ + L  ++         EN  N+         D  +T +
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 104 SGSESE---RNPKLVFNILTKKRMSPTSNE--PRRGHRLAKEKVDLLEHWYIQHMDNPYL 158
           S + S+   +N  LVFN++T+  M+         RGHRL K+ V  LE WY+ H  NPYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 159 NKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205
           N+ ++++LM +TSLS++Q+KNW+SNRRRKEKS++I+PE+  +L   K
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNK 227

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  137 bits (345), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/227 (36%), Positives = 131/227 (57%), Gaps = 22/227 (9%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I+ LLNP       E+L+ IN  L+ +C+  P T     +    +L++I + L++
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLG--------ENAHNK---------DQPKTPT 103
           +  Q EL  E   +++ TYQ+ + L  ++         EN  N+         D  +T +
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 104 SGSESE---RNPKLVFNILTKKRMSPTSNE--PRRGHRLAKEKVDLLEHWYIQHMDNPYL 158
           S + S+   +N  LVFN++T+  M+         RGHRL K+ V  LE WY+ H  NPYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 159 NKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205
           N+ ++++LM +TSLS++Q+KNW+SNRRRKEKS++I+PE+  +L   K
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNK 227

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  129 bits (323), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 122/204 (59%), Gaps = 1/204 (0%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I DLLNP  T +    +  IN +L +IC   P          + +LR+I   LS 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120
                ++S E K +L+ T Q+++ +  LL E    ++         +++    LVFN++T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180
           +  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS++QIKNW
Sbjct: 121 QD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNW 179

Query: 181 VSNRRRKEKSLSIAPEIVDILNKQ 204
           VSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 180 VSNRRRKEKTITIAPELADLLSGE 203

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  129 bits (323), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 122/204 (59%), Gaps = 1/204 (0%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I DLLNP  T +    +  IN +L +IC   P          + +LR+I   LS 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120
                ++S E K +L+ T Q+++ +  LL E    ++         +++    LVFN++T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180
           +  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS++QIKNW
Sbjct: 121 QD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNW 179

Query: 181 VSNRRRKEKSLSIAPEIVDILNKQ 204
           VSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 180 VSNRRRKEKTITIAPELADLLSGE 203

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  129 bits (323), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 122/204 (59%), Gaps = 1/204 (0%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I DLLNP  T +    +  IN +L +IC   P          + +LR+I   LS 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120
                ++S E K +L+ T Q+++ +  LL E    ++         +++    LVFN++T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180
           +  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS++QIKNW
Sbjct: 121 QD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNW 179

Query: 181 VSNRRRKEKSLSIAPEIVDILNKQ 204
           VSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 180 VSNRRRKEKTITIAPELADLLSGE 203

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  129 bits (323), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 122/204 (59%), Gaps = 1/204 (0%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I DLLNP  T +    +  IN +L +IC   P          + +LR+I   LS 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120
                ++S E K +L+ T Q+++ +  LL E    ++         +++    LVFN++T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180
           +  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS++QIKNW
Sbjct: 121 QD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNW 179

Query: 181 VSNRRRKEKSLSIAPEIVDILNKQ 204
           VSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 180 VSNRRRKEKTITIAPELADLLSGE 203

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  125 bits (315), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 128/220 (58%), Gaps = 18/220 (8%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I  LLNP +    HE+L++IN +L  +CS  P+ EN  F+  + +L  I  +L+ 
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPS-ENEQFEKDKAELEKILPSLNI 59

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQ-------------PKTPTSGSE 107
           L  +   S E++ ++   +Q+SSV   LL E +  K +             P     G+ 
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119

Query: 108 SERNPKLVFNILTKKRMSPT--SNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQM 165
            +    +VFNI+T+  ++    SN+  RGHRL K    LLE W+ +++++PYL  +S++ 
Sbjct: 120 GKEG--MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177

Query: 166 LMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205
           LM ET LS  QIKNWVSNRRRKEKSL+I+ E+ +++ + K
Sbjct: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESK 217

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  125 bits (315), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 128/220 (58%), Gaps = 18/220 (8%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I  LLNP +    HE+L++IN +L  +CS  P+ EN  F+  + +L  I  +L+ 
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPS-ENEQFEKDKAELEKILPSLNI 59

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQ-------------PKTPTSGSE 107
           L  +   S E++ ++   +Q+SSV   LL E +  K +             P     G+ 
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119

Query: 108 SERNPKLVFNILTKKRMSPT--SNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQM 165
            +    +VFNI+T+  ++    SN+  RGHRL K    LLE W+ +++++PYL  +S++ 
Sbjct: 120 GKEG--MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177

Query: 166 LMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205
           LM ET LS  QIKNWVSNRRRKEKSL+I+ E+ +++ + K
Sbjct: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESK 217

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  112 bits (281), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 110/198 (55%), Gaps = 35/198 (17%)

Query: 3   KIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSSLT 62
           +I+I  LLNP       E+L+ IN QL ++CS  P  ++L   +  + LR ++       
Sbjct: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLS------- 57

Query: 63  NQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTK- 121
            +N L  +   +++ TY++S++L KL                     R  ++VFN++TK 
Sbjct: 58  -RNNLDPQEIGLIKTTYRLSTLLSKL---------------------REHEIVFNVVTKD 95

Query: 122 ---KRMSPTSNEPR-RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQI 177
              K+  P       RGHR  +E V +LE WY  H+DNPYL+  S Q L Q+T+LSK+QI
Sbjct: 96  HLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQI 155

Query: 178 KNWVSNRRRKEKSLSIAP 195
           KNWV+NRRRK+KS+ I+P
Sbjct: 156 KNWVANRRRKQKSIYISP 173

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  110 bits (275), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 26  NTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQISSVL 85
           N +L +IC   P          + +LR+I   LS      ++S E K +L+ T Q+++ +
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  LKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTKKRMSPTSNEPRRGHRLAKEKVDLL 145
             LL E    ++         +++    LVFN++T+  M   S +P RGHR  KE V +L
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQD-MINKSTKPYRGHRFTKENVRIL 119

Query: 146 EHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           E W+ ++++NPYL+   L+ LM+ TSLS++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 120 ESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGE 178

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  110 bits (275), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 26  NTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQISSVL 85
           N +L +IC   P          + +LR+I   LS      ++S E K +L+ T Q+++ +
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  LKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTKKRMSPTSNEPRRGHRLAKEKVDLL 145
             LL E    ++         +++    LVFN++T+  M   S +P RGHR  KE V +L
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQD-MINKSTKPYRGHRFTKENVRIL 119

Query: 146 EHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           E W+ ++++NPYL+   L+ LM+ TSLS++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 120 ESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGE 178

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  108 bits (269), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 71/91 (78%), Gaps = 1/91 (1%)

Query: 114 LVFNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLS 173
           LVFN++T+  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS
Sbjct: 23  LVFNVVTQD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 81

Query: 174 KMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           ++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 82  RIQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  108 bits (269), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 71/91 (78%), Gaps = 1/91 (1%)

Query: 114 LVFNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLS 173
           LVFN++T+  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS
Sbjct: 23  LVFNVVTQD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 81

Query: 174 KMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           ++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 82  RIQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  108 bits (269), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 71/91 (78%), Gaps = 1/91 (1%)

Query: 114 LVFNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLS 173
           LVFN++T+  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS
Sbjct: 23  LVFNVVTQD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 81

Query: 174 KMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           ++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 82  RIQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  108 bits (269), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 71/91 (78%), Gaps = 1/91 (1%)

Query: 114 LVFNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLS 173
           LVFN++T+  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS
Sbjct: 23  LVFNVVTQD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 81

Query: 174 KMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           ++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 82  RIQIKNWVSNRRRKEKTITIAPELADLLSGE 112

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score =  110 bits (275), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 114/206 (55%), Gaps = 37/206 (17%)

Query: 2   NKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSSL 61
           ++I+I  LLNP       E+L+ IN QL ++CS  P  ++L   +  + LR ++      
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLS------ 57

Query: 62  TNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTK 121
             +N L  +   +++ TY++S++L KL                     R  ++VFN++TK
Sbjct: 58  --RNNLDPQEIGLIKTTYRLSTLLSKL---------------------REHEIVFNVVTK 94

Query: 122 ----KRMSPTSNEP-RRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQ 176
               K+  P       RGHR  +E V +LE WY  H+DNPYL+  S Q L Q+T+LSK+Q
Sbjct: 95  DHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQ 154

Query: 177 IKNWVSNRRRKEKSLSIAPEIVDILN 202
           IKNWV+NRRRK+KS+ I+  + DI N
Sbjct: 155 IKNWVANRRRKQKSIYIS--LFDIHN 178

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  110 bits (275), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 26  NTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQISSVL 85
           N +L +IC   P          + +LR+I   LS      ++S E K +L+ T Q+++ +
Sbjct: 44  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 103

Query: 86  LKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTKKRMSPTSNEPRRGHRLAKEKVDLL 145
             LL E    ++         +++    LVFN++T+  M   S +P RGHR  KE V +L
Sbjct: 104 TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQD-MINKSTKPYRGHRFTKENVRIL 162

Query: 146 EHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQ 204
           E W+ ++++NPYL+   L+ LM+ TSLS++QIKNWVSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 163 ESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGE 221

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score =  100 bits (249), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 118/251 (47%), Gaps = 62/251 (24%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I  LLNP N+    EQL+++N +L ++CS  P+ ++++    + QL  I   L+ 
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSME----ETQLSEILKFLTK 56

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGE--NAHNKDQPKTPTSGSESERNPKLVFNI 118
                 L  E   ++  T Q+S+VL  L+ E    H           S+S  NP+ VFN+
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHH-------SQSTHNPR-VFNV 108

Query: 119 LT-------------------------KKRMSPTSNE----------------------P 131
           LT                         KK  +P +N                        
Sbjct: 109 LTQHMMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPS 168

Query: 132 RRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK-S 190
            RGHRL K  +  LE W++ +  +PYL+ + LQ L  ++SLSK Q+KNW+SNRRRKE+ S
Sbjct: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHS 228

Query: 191 LSIAPEIVDIL 201
           L I+  I  +L
Sbjct: 229 LKISNNIASLL 239

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 97.4 bits (241), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 111/238 (46%), Gaps = 61/238 (25%)

Query: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60
           MNKI I  LLNP N+    EQL+++N +L ++CS  P+ ++++    + QL  I   L+ 
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSME----ETQLSEILKFLTK 56

Query: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGE--NAHNKDQPKTPTSGSESERNPKLVFNI 118
                 L  E   ++  T Q+S+VL  L+ E    H           S+S  NP+ VFN+
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHH-------SQSTHNPR-VFNV 108

Query: 119 LT-------------------------KKRMSPTSNE----------------------P 131
           LT                         KK  +P +N                        
Sbjct: 109 LTQHMMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPS 168

Query: 132 RRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189
            RGHRL K  +  LE W++ +  +PYL+ + LQ L  ++SLSK Q+KNW+SNRRRKE+
Sbjct: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 91.7 bits (226), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 90/152 (59%), Gaps = 8/152 (5%)

Query: 58  LSSLTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSE-----SERNP 112
           L  L++    S  ++ V++   Q+++++++L+ +     +  K      E     S+   
Sbjct: 77  LKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKC 136

Query: 113 KLVFNILTKKRMS---PTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQE 169
            ++FN++T+  M       +   +GHRL K+ V LLE WY  +++NPYLN   +++LM+E
Sbjct: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196

Query: 170 TSLSKMQIKNWVSNRRRKEKSLSIAPEIVDIL 201
           T  S+ Q+KNWV+N+RRK+K  +I+PE+ D+L
Sbjct: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 91.7 bits (226), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 90/152 (59%), Gaps = 8/152 (5%)

Query: 58  LSSLTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSE-----SERNP 112
           L  L++    S  ++ V++   Q+++++++L+ +     +  K      E     S+   
Sbjct: 77  LKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKC 136

Query: 113 KLVFNILTKKRMS---PTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQE 169
            ++FN++T+  M       +   +GHRL K+ V LLE WY  +++NPYLN   +++LM+E
Sbjct: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196

Query: 170 TSLSKMQIKNWVSNRRRKEKSLSIAPEIVDIL 201
           T  S+ Q+KNWV+N+RRK+K  +I+PE+ D+L
Sbjct: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 89.7 bits (221), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 95/167 (56%), Gaps = 13/167 (7%)

Query: 50  QLRNIAVTLSSLTNQNELSSENKNVLRVTYQISSVLLKLLGE----NAHNKDQPKTPTSG 105
           +L+ +  +L  +T   +L    + +LR T+Q+S  L  +L E       N    K+    
Sbjct: 65  ELKKVLSSLKVVTTNGKLEENGELLLRTTFQLSKTLSVVLSEFKKVEESNIQFHKSRDWD 124

Query: 106 SE-SERNPKLV---FNIL---TKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYL 158
           SE  E N +     F I+   TK+  S  + +  RGHRL  EKV+ LE W+ Q++  PYL
Sbjct: 125 SERKETNLRCKVPNFEIVPLNTKQDYS--TGKRHRGHRLPSEKVEKLELWFNQNISKPYL 182

Query: 159 NKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205
           N+ +L+ L+ ETSLS +QIKNW+SNRRRK+KS  IA  I D+L  +K
Sbjct: 183 NQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKK 229

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 85.9 bits (211), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 109/223 (48%), Gaps = 21/223 (9%)

Query: 1   MNKIAIHDLLNPPNTTKT-------HEQLESINTQLNTICSVFPTT------ENLDFKTY 47
           M++I IH LLNP  + K+       +  L + N +   + + F          N D+   
Sbjct: 1   MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKI 60

Query: 48  QEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQISS----VLLKLLG---ENAHNKDQPK 100
           +  +RN    L+       L+ + K  L    Q S     VLLK  G   E   ++ + +
Sbjct: 61  ESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVR 120

Query: 101 TPTSGSESERNPKLV-FNILTKKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLN 159
                 +S +N + V   ILT+  M   +NE ++G R  K  + LLE+WY  +  NPYL 
Sbjct: 121 KINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLA 180

Query: 160 KASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILN 202
           +  L  + + T+L+K QIKNW++NRRRK+K   ++ +I +ILN
Sbjct: 181 ENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN 223

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 127 TSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRR 186
            S + R+ +  AK++   LE W+  ++  PY NK  +  L + T+LS  QI+NW+SNRRR
Sbjct: 35  ASGKQRKFNATAKKR---LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91

Query: 187 KEKSLSIAPEIVDILN 202
           K +  SI   +  ILN
Sbjct: 92  KSRKESIDSLLEPILN 107

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 5/110 (4%)

Query: 79  YQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTKKRMSPTSNEPRRGHRLA 138
           + IS  L  + G  A    +P T   G + ++ P       TK ++  T  + RR + L 
Sbjct: 85  HSISHFLSPVEGAPAAPATEPFT-VYGRDDQQEPA---PDGTKGKLKETKKQHRRSN-LP 139

Query: 139 KEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           KE VD+L  W   H DNPY +    + L+++T L+ +Q+ NW  N RR++
Sbjct: 140 KETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 189

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 126 PTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRR 185
           PTS +PRR + L KE VD+L +W + H++ PY +    + L+ +T LSK+Q+ NW  N R
Sbjct: 116 PTS-KPRRTN-LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVR 173

Query: 186 RKE 188
           R++
Sbjct: 174 RRK 176

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 145 LEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189
           LE+W+  +  +PYL +  + +L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 145 LEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189
           LE+W+  +  +PYL +  + +L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 145 LEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189
           LE+W+  +  +PYL +  + +L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 145 LEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189
           LE+W+  +  +PYL +  + +L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 134 GHR--LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           G R  L K+ VD+L  W + H+ NPY      + L++ T LSK+Q+ NW  N RR++
Sbjct: 155 GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRK 211

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 132 RRGHR---LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           ++ HR   L KE VD+L  W   H DNPY +    + L+++T L+ +Q+ NW  N RR++
Sbjct: 222 KKQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 281

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 119 LTKKRMSPTSNEPRRGHR--LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQ 176
           ++KK M         G R  L K  V +L  W + H+ NPY      + L+++T L+K+Q
Sbjct: 143 VSKKSMKKCHGIIGAGKRSNLPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQ 202

Query: 177 IKNWVSNRRRKEKSLSIAPEIVDILNK 203
           + NW  N RR++    I  +  DI+NK
Sbjct: 203 LSNWFINVRRRK----IFSDYYDIVNK 225

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L KE V +L +W + H+ NPY        L+++T L+K+Q+ NW  N RR++
Sbjct: 275 LPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRK 326

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L +  V++L  W ++H++NPY N    ++L++ T L+K+Q+ NW  N RR++
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L K  V +L  W ++H++NPY      + L+ +T L+K+QI NW  N RR++
Sbjct: 199 LPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 250

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L KE V++L  W   H++NPY +    + L+ +T LSK+Q+ NW  N RR++
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRK 160

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 129 NEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           N  RR + L KE V +L  W + H++NPY  +   + L+ +T L+K+Q+ NW  N RR++
Sbjct: 151 NSGRRSN-LPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 209

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 11/85 (12%)

Query: 115 VFNILTKKRMSPTSN------EPR-RGHR----LAKEKVDLLEHWYIQHMDNPYLNKASL 163
           VF+  T ++ +P  N      E R +GH     L    V +L  W ++H++NPY      
Sbjct: 168 VFSSSTSRKTAPRPNTKSSVKEKRNKGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEK 227

Query: 164 QMLMQETSLSKMQIKNWVSNRRRKE 188
           + L+ +T L+K+QI NW  N RR++
Sbjct: 228 RELLAQTGLTKLQISNWFINARRRK 252

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 129 NEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           N  RR + L KE V +L  W + H++NPY  +   + L+ +T L+K+Q+ NW  N RR++
Sbjct: 148 NSGRRSN-LPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 206

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 133 RGHR----LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           +GH     L K  V +L  W ++H+ NPY      + L+ +T L+K+QI NW  N RR++
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRRK 250

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 133 RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           R   L KE V +L  W + H++NPY  +   + L+ +T L+K+Q+ NW  N RR++
Sbjct: 153 RRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 208

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 129 NEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           N  RR + L KE V +L  W + H++NPY  +   + L+ +T L+K+Q+ NW  N RR++
Sbjct: 162 NSGRRSN-LPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 220

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 132 RRGHR--LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRK 187
           R G R  L KE V +L  W + H+ NPY      + L+ +T L+K+Q+ NW  N RR+
Sbjct: 77  RSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINVRRR 134

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L K  V +L  W  +H++NPY      + L+ +T L+K+QI NW  N RR++
Sbjct: 201 LPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 252

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 133 RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           R   L KE + +L  W + H+ NPY      + L+ +T L+K+Q+ NW  N RR++
Sbjct: 266 RRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRK 321

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%)

Query: 132 RRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           +R   L K+ + +L  W + H+ NPY  +   + L+ +T L+K+Q+ NW  N RR++
Sbjct: 77  KRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRRK 133

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 133 RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           R   L KE V +L  W + H+ NPY      + L+ +T L+K+Q+ NW  N RR++
Sbjct: 132 RRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRRK 187

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L KE + +L  W + H+ NPY      + L+ +T L+K+Q+ NW  N RR++
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRK 127

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180
           +KR SP++    +   L KE V +L +W + H+ NPY +    + L+ +T L+ +Q+ NW
Sbjct: 201 QKRSSPSN----KRTNLPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNW 256

Query: 181 VSNRRRKE 188
             N RR++
Sbjct: 257 FINVRRRK 264

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPE 196
           L KE V +L  W   H++NPY        L  +T L+K+Q+ NW  N RR++    +  +
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK----VFAD 223

Query: 197 IVDILNKQK 205
             DI N+++
Sbjct: 224 YYDITNQKR 232

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L K+ V +L  W + H+ NPY      + L+ +T LSK+Q+ NW  N RR++
Sbjct: 183 LPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 133 RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           R   L KE V +L  W + H+ NPY      + L+ +T L+K+Q+ NW  N RR++
Sbjct: 129 RRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L +E V +L +W + H+ +PY        L+++T L+K+Q+ NW  N RR++
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L KE V +L  W + H+ NPY        L+  T L+K+Q+ NW  N RR++
Sbjct: 182 LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRK 233

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 142 VDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           V +L  W + H+ NPY      + L+++T L+K+Q+ NW  N RR++
Sbjct: 317 VQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRK 363

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 33/52 (63%)

Query: 137 LAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKE 188
           L KE +++L  W ++++ NPY      + L+++T L+ +Q+ NW  N RR++
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C
          (REAL)
          Length = 34

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 1  MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICS 34
          MNKI I DLLNP  T +    +  IN +L +IC 
Sbjct: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 32.0 bits (71), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 1  MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFP 37
          MNKI I DLLNP  T +    +  IN +L +IC   P
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLP 37

>TBLA0H02730 Chr8 complement(644533..645036) [504 bp, 167 aa] {ON}
           Anc_2.584 YKL056C
          Length = 167

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 29/61 (47%)

Query: 72  KNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTKKRMSPTSNEP 131
           K V  V Y+    ++K+ G+N      P     G + E   ++V N++   R+ PT+ + 
Sbjct: 21  KEVDGVIYEADCAMIKVGGDNIDIGANPSAEDGGEDLEDGAEIVNNVVNSFRLQPTAFDK 80

Query: 132 R 132
           +
Sbjct: 81  K 81

>TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa]
           {ON} Anc_2.337 YDL106C
          Length = 645

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 20/112 (17%)

Query: 96  KDQPKTPTS--------GSESERNPKLVFNILTKKRMSPTSNEPRRGH-RLAKEKVDLLE 146
           +DQ  TPTS        G  +  NP       + +  S  +N  R+   R   E +DLL+
Sbjct: 87  QDQNNTPTSTTQVSGGGGPSTTSNPGAS----SSQDQSVNTNTHRQKRTRATGEALDLLK 142

Query: 147 HWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRK----EKSLSIA 194
             +     NP  N    +ML + T L +  ++ W  NRR K    E+S+ I+
Sbjct: 143 QEFKL---NPNPNSKRRKMLSESTGLPEKNVRIWFQNRRAKVRKSEQSIGIS 191

>SAKL0H02266g Chr8 (218732..226012) [7281 bp, 2426 aa] {ON} highly
           similar to uniprot|P33334 Saccharomyces cerevisiae
           YHR165C PRP8 Component of the U4/U6-U5 snRNP complex
           involved in the second catalytic step of splicing
          Length = 2426

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 125 SPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKA--SLQMLMQETSLSKMQ 176
           SP     R G  L  + V L++ WY+QH D  Y  K   S Q L++   L++++
Sbjct: 497 SPYPFNRRSGKMLRAQDVALVKKWYLQHPDEEYPIKVRISYQKLLKNYVLNELK 550

>ACR027C Chr3 complement(405111..408083) [2973 bp, 990 aa] {ON}
           NOHBY318; No homolog in Saccharomyces cerevisiae
          Length = 990

 Score = 29.3 bits (64), Expect = 8.4,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 34/66 (51%)

Query: 45  KTYQEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTS 104
           KT+ E +  I V + S    + L   +K +    YQ+++ +   LG+ + +K + +T   
Sbjct: 431 KTFSEPIPVIMVGVGSFIAPDSLDGASKVIRPPYYQVANAIGAALGKISSSKQEFRTMLK 490

Query: 105 GSESER 110
           G++ E+
Sbjct: 491 GTDEEK 496

>KAFR0E02230 Chr5 complement(444357..451634) [7278 bp, 2425 aa] {ON}
           Anc_5.73 YHR165C
          Length = 2425

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 8/59 (13%)

Query: 132 RRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKS 190
           R G  +  + V L++ WY+QH D  Y  K  +       S  K+ +KN+V+N  +K  S
Sbjct: 500 RNGRTVRAQDVPLVKKWYLQHPDEDYPVKVRV-------SYQKL-LKNYVANELKKTSS 550

>TDEL0B05360 Chr2 (947205..950486) [3282 bp, 1093 aa] {ON} Anc_1.463
           YJR039W
          Length = 1093

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 13/100 (13%)

Query: 16  TKTHEQL---ESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS------LTNQNE 66
           ++ +EQL   E I +    IC ++PTT++L +KT   +L +  V + +      +T+ +E
Sbjct: 429 SEGYEQLLNDEIIFSSDEEICDIWPTTQSLWWKTKDGKLISDGVAVKTEHDIIHVTSNDE 488

Query: 67  LSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGS 106
           L ++N ++  V    + +   + G   +  D  +   SGS
Sbjct: 489 LLAKNPSIATV----ADIWEDMHGNYVYLSDDGRVRWSGS 524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.125    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,920,286
Number of extensions: 993650
Number of successful extensions: 3996
Number of sequences better than 10.0: 174
Number of HSP's gapped: 3970
Number of HSP's successfully gapped: 174
Length of query: 205
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 101
Effective length of database: 41,556,135
Effective search space: 4197169635
Effective search space used: 4197169635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)