Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B091301.3ON36736717880.0
NDAI0A001201.3ON37737313320.0
KAFR0D001101.3ON36535413090.0
Suva_3.1501.3ON36134312931e-179
Skud_3.11.3ON36035412891e-178
YCL064C (CHA1)1.3ON36034212891e-178
KNAG0C001801.3ON35934312861e-178
Smik_3.121.3ON36034312701e-175
TPHA0E040401.3ON35734711771e-161
Kpol_2002.61.3ON35035511521e-157
TBLA0A049201.3ON36034111521e-157
KAFR0F04430singletonON34334210931e-149
CAGL0B00286g1.3ON36033910921e-148
KAFR0I00130singletonON34434410901e-148
NCAS0A15330singletonON34734910841e-147
ZYRO0F15774gsingletonON41034110561e-142
SAKL0C00418g1.3ON3643399971e-134
NDAI0K02950singletonON3343339531e-127
ZYRO0F18524g1.3ON3353348871e-118
KLTH0F00440g1.3ON3413328821e-117
KNAG0D05380singletonON3343398591e-113
SAKL0C13904gsingletonON3393298481e-112
Ecym_10061.3ON3643418481e-111
AFR747W1.3ON4263448451e-110
KLLA0C00440g1.3ON3773328331e-109
Smik_9.2na 1ON3383288121e-106
Scer_YGOB_SDL1 (SDL1)na 1ON3373287831e-102
Skud_9.2na 1ON3393357831e-102
TDEL0D06540singletonON3373287444e-96
KLLA0E01805gsingletonON3223276992e-89
KNAG0A01150singletonON2312305921e-74
YIL167W (SDL1)singletonOFF2101925292e-65
YIL168WsingletonOFF1271252661e-27
SAKL0F11858g7.367ON5622641818e-14
KAFR0K017007.367ON5792811692e-12
KLLA0E19779g7.367ON5672871532e-10
Kpol_530.167.367ON5662781533e-10
Ecym_47087.367ON5702871515e-10
ACR232C7.367ON5602591499e-10
TBLA0C050707.367ON5752911471e-09
NDAI0A018107.367ON5702641471e-09
TDEL0C018007.367ON5692591453e-09
NCAS0A142307.367ON5692591426e-09
ZYRO0B02772g7.367ON5692641418e-09
Suva_5.1997.367ON5762911401e-08
CAGL0I05126g7.367ON5712591391e-08
YER086W (ILV1)7.367ON5762911382e-08
TPHA0F031307.367ON5682721382e-08
Skud_5.2057.367ON5762911372e-08
Smik_5.2257.367ON5762911373e-08
KNAG0C036907.367ON5772591354e-08
SAKL0A10626gsingletonON3202831335e-08
Kwal_33.148227.367ON5622861311e-07
KLTH0B04884g7.367ON5732861266e-07
Skud_11.2na 2ON326286999e-04
YKL218C (SRY1)na 2ON326266920.007
NCAS0I011203.357ON159108711.5
KAFR0A081803.83ON28793684.5
NDAI0J017604.131ON448100677.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09130
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    693   0.0  
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   517   0.0  
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   508   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   502   e-179
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   501   e-178
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   501   e-178
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   499   e-178
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   493   e-175
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   457   e-161
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   448   e-157
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   448   e-157
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              425   e-149
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   425   e-148
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   424   e-148
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            422   e-147
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   411   e-142
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   388   e-134
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             371   e-127
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   346   e-118
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   344   e-117
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   335   e-113
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   331   e-112
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   331   e-111
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   330   e-110
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   325   e-109
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      317   e-106
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   306   e-102
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      306   e-102
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            291   4e-96
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   273   2e-89
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   232   1e-74
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   208   2e-65
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   107   1e-27
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    74   8e-14
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    70   2e-12
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    64   2e-10
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    64   3e-10
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    63   5e-10
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    62   9e-10
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    61   1e-09
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    61   1e-09
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    60   3e-09
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    59   6e-09
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    59   8e-09
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    59   1e-08
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    58   1e-08
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    58   2e-08
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    58   2e-08
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    57   2e-08
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    57   3e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    57   4e-08
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    56   5e-08
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    55   1e-07
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    53   6e-07
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    43   9e-04
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    40   0.007
NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON...    32   1.5  
KAFR0A08180 Chr1 complement(1645769..1646632) [864 bp, 287 aa] {...    31   4.5  
NDAI0J01760 Chr10 complement(432212..433558) [1347 bp, 448 aa] {...    30   7.3  

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/367 (92%), Positives = 339/367 (92%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
           SGNKSPQVF               QRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             EKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFINDPIQP 360
           NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFINDPIQP
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFINDPIQP 360

Query: 361 VPILGRA 367
           VPILGRA
Sbjct: 361 VPILGRA 367

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/373 (68%), Positives = 292/373 (78%), Gaps = 10/373 (2%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPS-----TSIPQFFLKYECLQPSGSFKSRGIGNLIMKNA 55
           MS+VYNKTPLLRQFF     K S     T+ PQFF+KYECLQPSGSFKSRGIGNLI+K+A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 56  IRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVI 115
           + I K G K+PQVF               QRLSLPCTVVVPTATKQRMVEKI++TGANVI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 116 INGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIA 175
           INGAHWKEAD +LK+S+MN ID N  EPIYVHPFDNP IWEGH+TMVDEI+D+LN+QNI 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 176 LNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSK 235
           +NK+KGIVCSV             +K+ LADKIPIVGVETKGCHVFNTSLKL KQIEFSK
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 236 ITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLH 295
           ITSIATSLGTA+IS +TFEYA+KY TRSVV+ED +VIETCLKYTQD+NMV EPACGAS+H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 296 LAYNTNILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKH----ERITPP 351
           LAY+T+ILE +LGHKL+SDDIILVIACGGSSNT  DLE  L+ ++   K        T P
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360

Query: 352 TFIN-DPIQPVPI 363
            FI+ +  Q  PI
Sbjct: 361 NFIDTENTQHFPI 373

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 280/354 (79%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MS+VYNKTPLLRQFFP   ++ S S+PQFFLKYECLQPSGSFKSRGIGNLI+K A++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G K P+VF               QRLSLPCTVVVPTATKQRM+EKI+ TGANVII+GA 
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD YLK SVMN I+ N  +PIYVHPFDNP IWEGHS++VDEI+DTL EQ +  + IK
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             E+HKL DKIP+VGVET+GCHVFNTSLKLGKQ+EF KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSL TASIS++TFE A KY TRSV+V+D DVIETCLKYT+D+NMV EPACGAS+HLAYN 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFI 354
           +ILENALG KL+ DD ++VIACGGSSNT+QD+EETL+RLR +       P  F+
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFL 354

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  502 bits (1293), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 239/343 (69%), Positives = 276/343 (80%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MSIVYNKTPLLRQFFP        S+ QF+LKYECLQPSGSFKSRGIGNLI+KNAIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPG------KSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
           +G +SPQVF               QRLSLPCTVVVPTATK+RMVEKIR TGA VI+NGA 
Sbjct: 55  NGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEADTYLK++VMN ID    EPIYVHPFDNPDIWEGHS+MVDEIV  L  Q + + K+K
Sbjct: 115 WKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             E+H LADKIPIVGVETKGCHVFNTSL++G+ ++F KITSIA
Sbjct: 175 GIVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA+IS+QTFEYA+KY+T+SVVVED DVIETCLKY+  FNMV EPACGA+LHL Y+T
Sbjct: 235 TSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHT 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343
           +ILE AL  KL++DDI+L+IACGGSSNTVQDLEETL  ++++ 
Sbjct: 295 DILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEG 337

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  501 bits (1289), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 278/354 (78%), Gaps = 6/354 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MSIVYNKTPLLRQFFP      S S  QFFLKYECLQPSGSFKSRGIGNLI+KNAIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G +SPQVF               QRLSLPCTVVVPTATK+RMVEKIR TGA VI+NGA+
Sbjct: 55  DGRRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEADT+LK+++MN ID    EPIYVHPFDNPDIWEGHS+MVDEIV  L  Q I++NK+K
Sbjct: 115 WKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             E++ LADKIPIVGVET GCHVFNTSL++G+ ++F KITSIA
Sbjct: 175 GIVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA IS+QTFEYA KY+T+SVV+ED DVIETCLKYT   NMVAEPACGA+LHL Y+T
Sbjct: 235 TSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHT 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFI 354
            ILE ALG KL++DDI+++IACGGSSNTVQDLEETL  L+++      T   FI
Sbjct: 295 EILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFI 348

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  501 bits (1289), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 237/342 (69%), Positives = 277/342 (80%), Gaps = 6/342 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MSIVYNKTPLLRQFFP  ++       QFFLKYECLQPSGSFKSRGIGNLIMK+AIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPGKAS------AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G +SPQVF               QRLSLPCTVVVPTATK+RMV+KIR TGA VI++GA+
Sbjct: 55  DGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEADT+LK++VMN ID    EPIYVHPFDNPDIWEGHS+M+DEIV  L  Q+I++NK+K
Sbjct: 115 WKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             E++ LAD+IPIVGVET GCHVFNTSLK+G+ ++F KITSIA
Sbjct: 175 GIVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA IS+QTFEYA+KY+TRSVV+ED DVIETCLKYT  FNMV EPACGA+LHL YNT
Sbjct: 235 TSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNT 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREK 342
            ILENALG KL++DDI+++IACGGSSNT++DLEE L  +R+K
Sbjct: 295 KILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  499 bits (1286), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/343 (70%), Positives = 273/343 (79%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MS+VYNKTPLLRQFFP        ++PQ FLKYECLQPSGSFKSRGIGNLI+KNA+RI+K
Sbjct: 1   MSLVYNKTPLLRQFFPG------KNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G +   VF               QRLSLPCTVVVPTATK RMVEKIR TGA VI+NGAH
Sbjct: 55  IGERRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAH 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD +LK +VM+ IDL TTEPIYVHPFDNPDIWEGH+T+VDEI++TLN Q I    +K
Sbjct: 115 WKEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             EKH LA+KIPIVGVET+GCHV NTSL L KQIEF KITSIA
Sbjct: 175 GIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTASIS QTFE AKKY+TRSVVV+D+ VIETCLKYT+DFNMVAEPACGA+LHLAYN 
Sbjct: 235 TSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNV 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343
           +ILE ALGH L+ +D+ILVIACGGSSNT++DLE+TLV L  K+
Sbjct: 295 DILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  493 bits (1270), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/343 (68%), Positives = 273/343 (79%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MSIVYNKTPLLRQFFP  S  P+    QFFLKYECLQPSGSFKSRGIGNLIMK+AIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPGKS--PA----QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G KSPQ+F               QRLSLPCTVVVPTATK+RMVEKIR TGA VI++GA+
Sbjct: 55  DGKKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEADT+LK+ VM  ID    EPIYVHPFDNPDIWEGHS+MVDE+V  L  Q I++NK+K
Sbjct: 115 WKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             E++ LADKIPIVGVET GCHVFNTSL++G+ ++F KITSIA
Sbjct: 175 GIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA IS+QTF+YA+KY+TRSVV+ED DVI+TCLKYT  FNMV EPACGA+LHL YNT
Sbjct: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343
            ILE ALG KL++DDI+++IACGGSSNT+QDLEE L    +++
Sbjct: 295 EILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRS 337

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  457 bits (1177), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/347 (62%), Positives = 265/347 (76%), Gaps = 6/347 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MS VYNKTPLLR  FP        ++PQ FLKYEC QPSGSFKSRGIGNLI   ++ I+K
Sbjct: 1   MSQVYNKTPLLRHLFPG------KNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
           +  KSP+VF               + LSLPCTVVVPTATK RMVEKI+ATGANVI+ G H
Sbjct: 55  NSKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNH 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEADTYLK++V+++ID    EPIYVHPFDN  IWEGH+TM+DEIV+T  +Q+I + K+K
Sbjct: 115 WKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
            IVCSV             EKH LA KIP+VGVET GCHVFNTSLK+GK I+F KI +IA
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA+IS+QTFEYAKKY+T+S+VV+D  V+ETCLK+T+D NMVAEPACGA+LH+ YN 
Sbjct: 235 TSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNM 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHER 347
           +ILE +LG KL++DDI+L+IACGGSSNTVQ+LE +L  L+ K+  + 
Sbjct: 295 DILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKE 341

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  448 bits (1152), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 224/355 (63%), Positives = 273/355 (76%), Gaps = 6/355 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MS+VYNKTPLL+ FFP        ++PQF+LKYE LQPSGSFKSRGIGNLI+KNAIRIKK
Sbjct: 1   MSLVYNKTPLLKHFFPG------KNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKK 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
              K P VF               QRLSLPCTVVVPTATK+RMV+KIRATGANVII G H
Sbjct: 55  INVKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNH 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD +LK ++MN I+ +  EPIYVHPFDNP IWEGHSTMVDEI++T ++Q   +  +K
Sbjct: 115 WKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
            IVCSV             EK+ LADKIP+VGVET+GCHVFNTSLKL K +EF+KI++IA
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA+IS+Q F+YAKKY+T+SVVVED DV+ETCLK+T D NMV EPACGA++HL Y+T
Sbjct: 235 TSLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHT 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFIN 355
           ++LE ALG KL+ DD +L++ACGGSSNTV++LE  L+ L  K++    T P+FI+
Sbjct: 295 DLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFID 349

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  448 bits (1152), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/341 (63%), Positives = 261/341 (76%), Gaps = 7/341 (2%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MSIVYNKTPLLRQFF        + IPQFFLKYEC+QPSGSFKSRGIGNLI+K+  +I  
Sbjct: 1   MSIVYNKTPLLRQFFRG------SPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54

Query: 61  SG-NKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGA 119
           S  NK PQVF               +RLS+PCTVVVPTATK+RMV KI+ TGA VI+NG 
Sbjct: 55  SNLNKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114

Query: 120 HWKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKI 179
           HW EAD YL++ V+N IDLN  EPIYVHPFDNP IWEGHSTM+DEI+++LNEQNI +  +
Sbjct: 115 HWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNV 174

Query: 180 KGIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSI 239
           K I CS+             EK+ LA KIPI+GVET GC VFNTSLKL K ++F KI +I
Sbjct: 175 KAITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTI 234

Query: 240 ATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYN 299
           ATSLGT++IS++TFE A KY+T+SVVV++ DVI+TCL+YT DFN VAEPACGA+LHLAYN
Sbjct: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294

Query: 300 TNILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLR 340
           T ++ENAL   L+ DDII+VIACGGSSNTVQ+LEE L++ +
Sbjct: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 194/342 (56%), Positives = 261/342 (76%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M  VYNKTPLLR +F   +   S S PQ F KYE  QP  SFKSRGIGNLI+KNA ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G K+ +VF               + LS+PCTVVVP++TK RMVEKIR+TGA VI++G  
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD YL++SV+N +D +  EP+YVHPFD+P IWEGHST++DEIV++LN++N+  +K+K
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           G+VCS+             E+H LADKIP++ VET+GCHVFNT L+LGK +EF KI+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLG+ SIS++TFEYA+KYH++ VV++D DV+ETCL+Y++D NM+ EPAC AS+HLAYN 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREK 342
           +ILE AL  KLS DD+I++IACGGS+ T+QD++++L +L+ K
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIK 342

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  425 bits (1092), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/339 (61%), Positives = 252/339 (74%), Gaps = 11/339 (3%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSG- 62
           VYNKTPL+RQ FP        SIPQ +LK+EC QPSGSFKSRGIG+LI K + RI  +G 
Sbjct: 3   VYNKTPLIRQIFP--------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54

Query: 63  NKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWK 122
            K P VF               + L+LPCTVV+PTATKQRM +KIRATGANVI++G  WK
Sbjct: 55  GKKPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114

Query: 123 EADTYLKSSVMNSID--LNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           EAD YLK ++++ ++      EPIYVHPFDNPDIWEGH++MVDEIV+    + I LNKIK
Sbjct: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
            IVCSV             EK+ LADKIPIVGVETKGCHVFNTSL++ K + F KITSIA
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA IS++ F+YAK+Y T+SVV+ D DV++TCL+YT DFNMV EPACGA++HLAY+T
Sbjct: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRL 339
            ILE  LG KL++DDI+LV+ACGGSSNTV+D+E  L RL
Sbjct: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRL 333

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  424 bits (1090), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 196/344 (56%), Positives = 258/344 (75%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M IVYNKTPL+ Q FP    + S S+PQ  +KYE LQPSGSFKSRGIGNL+ + A++I+K
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
           +  K+P+VF               Q+LSLPCTVVVP ATKQRM+EKIR+TGA V I+G  
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WK AD Y+K+SV+N I+    EPIYVHP D+P IWEG+S +VDE++++L EQ I  +K+K
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
            IVCSV             E++KLADKIPIVGVET G HVFNT LK GK IEF KI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLG+ASI+ +TFEYA KY  R V+V+D +V+ETCL+YTQD+NM+ EPACGA++HLAY+ 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAK 344
           +ILE AL  +L  DD++++IACGGSSN++ D+EETL +++ +++
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSESQ 344

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  422 bits (1084), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 254/349 (72%), Gaps = 3/349 (0%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MS+VYNKTPLLR+ FP     PS   PQ ++KYE LQPSGSFKSRGIG+LIMKNA+R+++
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSA--PQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQ 58

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G KS  VF               Q L LPCTVVVPT+TK RMVEKIR  G  VI+ G+H
Sbjct: 59  LGGKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSH 118

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD++LK+SV+ S+D    EPIYVHPFD+PD+WEGHSTMVDEIVDT   QN++LNK+K
Sbjct: 119 WKEADSFLKNSVIPSVD-RIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVK 177

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
            IVCSV             EK+ LADKIP++ +ET GC+ FN  LK  KQ+E  KITS+A
Sbjct: 178 AIVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVA 237

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLG   ++++ FE  ++Y + SVV++D DV+ TCLKY  DFN++ EPACGASLH+AYNT
Sbjct: 238 TSLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNT 297

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERIT 349
            ++E ALG KL SDDII++IACGGS+NT++DL+ +  +L  +A  ++ T
Sbjct: 298 KLIEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEANTKKNT 346

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  411 bits (1056), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/341 (55%), Positives = 251/341 (73%), Gaps = 6/341 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M  +YNKTPLL+Q F   ++       Q F+KYECLQPSGSFKSRGIG+LI K A  I+ 
Sbjct: 47  MPSIYNKTPLLKQIFNHATS------AQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQG 100

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G KSP VF               Q+L+LPCTVV+PT TKQRM +KIR  GANV++ G+H
Sbjct: 101 DGRKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSH 160

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD++LK+ + N +++   EPIYVHPFDNP IWEGH+++VDEI+ +L  +N ALN++K
Sbjct: 161 WKEADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVK 220

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             EK+ LA+KIP++ VETKGCHV NTSL++G+ +EF+K+ S+A
Sbjct: 221 GIVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVA 280

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSL T+ ISS+T +Y +KY ++S+V+ED +V++TCLKY ++FNM+ EPACGASLHL Y+ 
Sbjct: 281 TSLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHP 340

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLRE 341
            ++E ALG  L  DD+I+VIACGGSSNT+ DLEE+L +L E
Sbjct: 341 QLIERALGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEE 381

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 234/339 (69%), Gaps = 3/339 (0%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M+  Y+KTPLLR+ FP+      ++ PQF +KYE  QPSGSFKSRGIG+LI ++A RI+ 
Sbjct: 1   MTSFYSKTPLLRRIFPSSVL---SATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIES 57

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            GNK+  VF               +  SLPCTVVVPT T  RMV KIR TGA+VI++G H
Sbjct: 58  EGNKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNH 117

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           W +AD YL  SVM  ID    EP+Y HPFDNP IWEGHST+VDEIV++L  Q I  +++K
Sbjct: 118 WGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCS+             EKH LA  IPI+GVETKGC VF+ SLK GK + F KITS+A
Sbjct: 178 GIVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLGTA+I  +T E A KY+T+SVV+ D DV+ TCL +  D N+V EPACGASLH  YN 
Sbjct: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRL 339
           ++LE+ LG  L  +DII+VIACGGSS TVQDL++  VRL
Sbjct: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  371 bits (953), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 230/333 (69%), Gaps = 6/333 (1%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           MS +YNKTPLLRQ F +    P     + FLKYE LQPSGSFKSRGIG LI+++  ++K+
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGP-----RIFLKYENLQPSGSFKSRGIGCLILQHINKLKQ 55

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            GNK+  VF               + L +PCTVVVP +TK+RMV KIR TGA+V+I G H
Sbjct: 56  DGNKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDH 115

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD +L+ S M  +D    +PIYVHPFD+P IWEGHST++DEIV TL  + I++ K+K
Sbjct: 116 WKEADDFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVK 174

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GI+CSV             E+H LA  IP++ VETKGC V N SLK G  ++  KITS+A
Sbjct: 175 GIICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVA 234

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLG+  ISS  FE A KY++RS+ + D DV+ETCLKY  DF+M  EPACGAS+HLAYN 
Sbjct: 235 TSLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNP 294

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLE 333
            I+E+ALG  LS+ DI++V+ CGGSS T+ DLE
Sbjct: 295 GIVESALGTALSNHDIVIVVLCGGSSCTLHDLE 327

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLI-MKNAIRIK 59
           M+  Y KTPLLRQ    ++ K +T +PQ F+KYE LQP GSFKSRGIGNLI +K+   + 
Sbjct: 1   MNNWYYKTPLLRQI---LNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV 57

Query: 60  KSGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGA 119
           KS      V                +++ LPCTVVVPT+TKQRMV+KI+ +GA VII G+
Sbjct: 58  KS-----HVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGS 112

Query: 120 HWKEADTYLKSSVMNSI-DLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNK 178
           HWKEAD YL+ + + S  +  T++P+YVHPFD+P +WEGHSTMV EI+D L EQNI++  
Sbjct: 113 HWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVEN 172

Query: 179 IKGIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITS 238
           ++GIVCSV             E H LADKIP++ VET GC+V N SL  G+ +   KITS
Sbjct: 173 VRGIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITS 232

Query: 239 IATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAY 298
           +ATSLG+  I    FE A +Y  +S+V+ED DVIETCL+Y  DF  + EPACGASLH+ Y
Sbjct: 233 LATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGY 292

Query: 299 NTNILENALGHKLSSDDIILVIACGGSSNTVQDL 332
           +  +LEN LG   S DDII++IACGGS+ T +DL
Sbjct: 293 HPELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  344 bits (882), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 220/332 (66%), Gaps = 1/332 (0%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M   + KTPLL  +F A S +     PQF LK E LQPSGSFKSRGIG +I K AI+I+ 
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQ-PQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRS 59

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            GNK P VF               + LS+PC+VVVP +T  RMV+KI   GA V + G +
Sbjct: 60  EGNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD +LK S+++  + + T+ IY HPFD+P IWEGHS++VDEI+D+L EQ I L  IK
Sbjct: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
            IVCSV              +HKL  KIPI+GVE+KGC VFN+SLKLGK  EF  ITSIA
Sbjct: 180 AIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TS+GT SIS +T E A +YHT+SVV+ D ++I TCL++  + N++ EPACGA+LHL Y  
Sbjct: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDL 332
           +IL  AL    + +D+I++I CGGS+ +  DL
Sbjct: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  335 bits (859), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 169/339 (49%), Positives = 216/339 (63%), Gaps = 8/339 (2%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M  +YNKTPLL +             P F  KYE +QP GSFK RG+ +LI K   +IK 
Sbjct: 1   MPALYNKTPLLPKNLSGGDG------PTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKS 54

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
            G K P VF                 LS+PCTVVVPT TK RMVEKIR   A VI+ G++
Sbjct: 55  EGKKPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSN 114

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
           WKEAD YL+ +V+ S   N  +PIYV+PFD+P +WEGHSTM+DEI++ LN++NI L+ +K
Sbjct: 115 WKEADDYLRGTVIASN--NAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVK 172

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             E H+LA  IP+V VETKGC V   SL   K +  +KI SIA
Sbjct: 173 GIVCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIA 232

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSLG++ +S Q F+ A K+ +RSVV+ D+DV+ TC +Y  DFN + EPACGA++H AY+ 
Sbjct: 233 TSLGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHY 292

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRL 339
            ILE ALG KL+  DII++I CGGS  T+QDLE    +L
Sbjct: 293 KILEKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKL 331

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  331 bits (848), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 216/329 (65%), Gaps = 5/329 (1%)

Query: 5   YNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNK 64
           YNKTPLL    P V T  +   P+FFLKYE LQP GSFKSRGIG L+ K+  + ++ G K
Sbjct: 8   YNKTPLL----PRVLTT-TDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGK 62

Query: 65  SPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEA 124
           S  VF               Q  S+ CTVVVP  TK RMVEKIR TGA V++ G HW  A
Sbjct: 63  SLAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMA 122

Query: 125 DTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVC 184
           D YL+  VM  +D++   P+YVHPFDNP IW+GHST+VDE+V  L E+N++++K+K IVC
Sbjct: 123 DEYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVC 182

Query: 185 SVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLG 244
           SV             E H+LAD+IPI+ +ETKGC V N SL  G  +    +TS+A+SL 
Sbjct: 183 SVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLA 242

Query: 245 TASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILE 304
           +  IS + FE A+KY ++S++++D+ VIETCL +  D  +V EPACGASL+  Y+  +L 
Sbjct: 243 SPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLP 302

Query: 305 NALGHKLSSDDIILVIACGGSSNTVQDLE 333
             +G +L+ DD+I+VIACGGS+ T +DLE
Sbjct: 303 LYIGKELTEDDVIVVIACGGSAVTYKDLE 331

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 227/341 (66%), Gaps = 12/341 (3%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPS---TSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIR 57
           MS +Y KTPLLR+ F     KP+   + +PQF +KYE  QPSGSFKSRGIGNLI      
Sbjct: 1   MSSLYVKTPLLRRAF----GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSE 56

Query: 58  IKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIIN 117
           I++   K P VF               QR+ +PCTVVVPT+T+QR++EKI ATGA +I  
Sbjct: 57  IRRDPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICR 116

Query: 118 GAHWKEADTYLKSSVMNSIDLNTTE----PIYVHPFDNPDIWEGHSTMVDEIVDTLNEQN 173
           G ++ EAD+YLK  +  + + NT +    PIYVHPF++P IW GHS +V+EI+++L  +N
Sbjct: 117 GDYFAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNEN 176

Query: 174 IALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEF 233
           I  +++KGIVCSV             E+H LA+ IPI+GVET+GC V + SL  GK I F
Sbjct: 177 IPYSRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITF 236

Query: 234 SKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGAS 293
            K  S+ATSL   +I+ +T  YA+KY T+S+V+ + +V++TCL++T + N+V EPACGA+
Sbjct: 237 KKALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGAT 296

Query: 294 LHLAYNTNILENALGHKLSSDDIILVIACGGSSNTVQDLEE 334
           LHL Y+  IL   LG  LSS+DI+++IACGGS+ T+ DL E
Sbjct: 297 LHLGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRE 336

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  330 bits (845), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 227/344 (65%), Gaps = 3/344 (0%)

Query: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60
           M+  Y KTPL+R  F   + +  T+ P+  LKYE  QPSGSFKSRGIGNLI K   +I++
Sbjct: 69  MASFYCKTPLMRHVFARQNVR-YTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ 127

Query: 61  SGNKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120
           + +  P VF               ++L LPCTVVVP  T++RMVE+IR+TGA+VI  G+ 
Sbjct: 128 NSSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187

Query: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
            KE+D YL+S +M +++L    PIY HPFDNP IWEGH+TMVDE+V+ L+ Q + L  +K
Sbjct: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247

Query: 181 GIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240
           GIVCSV             EKH LAD IP+V VET+GC V + SL LG+ +  +   S+A
Sbjct: 248 GIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306

Query: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300
           TSL T+ ++  T  YA+KY T+SVV++   V++TCL + ++ N+V EPACGA+LHL Y+ 
Sbjct: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366

Query: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAK 344
            ILE  LG  L+  D+++VIACGGS+  + DL+E+  +L+ K K
Sbjct: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIK 409

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  325 bits (833), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 218/332 (65%), Gaps = 7/332 (2%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSG- 62
           +++KTPLL+  F        +  PQ  LKYE LQPSGSFKSRGIG+LI      IKKS  
Sbjct: 24  LFSKTPLLKHQFK------RSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSP 77

Query: 63  NKSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWK 122
            K   VF                 L++PCTVVV  AT+ R++EKIR+ GA+V+++G HWK
Sbjct: 78  EKIGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWK 137

Query: 123 EADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGI 182
           EAD+++K  +M  +D    EPIY HPFDNP IWEGHS MVDEI+D L    I + KIKGI
Sbjct: 138 EADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGI 197

Query: 183 VCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATS 242
           VCS              +++ LADKIPIV VETKG  V + SL++G  +EF KI+S ATS
Sbjct: 198 VCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATS 257

Query: 243 LGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNI 302
           LGTA+IS+  ++  K++ ++S V+ DT+VI TCL+++ D N+VAEP CGA+L+  YN + 
Sbjct: 258 LGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDK 317

Query: 303 LENALGHKLSSDDIILVIACGGSSNTVQDLEE 334
           L+N LG  +  DD +++I CGGSS +++DL+E
Sbjct: 318 LQNILGSDIKDDDYVILIGCGGSSTSLEDLKE 349

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  317 bits (812), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 208/328 (63%), Gaps = 5/328 (1%)

Query: 5   YNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNK 64
           Y KTPL+RQ F    T P      F++K++ LQP GSFKSRGIG+LI K        G+ 
Sbjct: 6   YEKTPLIRQVFDNGKTNP-----LFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSG 60

Query: 65  SPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEA 124
              VF               + ++L CTVVVP  TK RMV+KI++ GA VII+G HW EA
Sbjct: 61  KLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEA 120

Query: 125 DTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVC 184
           D YLK  VM     + ++ +YVHPFD+  IWEGHST+VDEI+  L E++I+  ++KG+VC
Sbjct: 121 DEYLKQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVC 180

Query: 185 SVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLG 244
           SV             E+++LA KIPIV VET GC V N SLK G  +   ++TS+ATSLG
Sbjct: 181 SVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLG 240

Query: 245 TASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILE 304
           +  I+   FE    Y  +SVV+ D DV++TCL+Y  D+N + EPACGASLHL Y+  ILE
Sbjct: 241 SPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILE 300

Query: 305 NALGHKLSSDDIILVIACGGSSNTVQDL 332
            ALG KLS DD++++IACGGS  T +DL
Sbjct: 301 KALGQKLSEDDVVIIIACGGSCMTYEDL 328

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  306 bits (783), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/328 (46%), Positives = 206/328 (62%), Gaps = 6/328 (1%)

Query: 5   YNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNK 64
           Y KTPL+RQF     T        F++K+E LQP GSFKSRGIG+LI K+       G+ 
Sbjct: 6   YEKTPLIRQFLNNGKTNS-----WFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG 60

Query: 65  SPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEA 124
              VF               + ++L C+VVVP  TK RMV+KI++ GA VII+G HW EA
Sbjct: 61  KLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEA 120

Query: 125 DTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVC 184
           D YL+   M     + ++ +YVHPFDN  IWEGHST+VDEI++ L E +I+L ++K +VC
Sbjct: 121 DEYLRHE-MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVC 179

Query: 185 SVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLG 244
           SV             ++++LA+KIP+V VET GC V N SLK G  +   K+TS+ATSL 
Sbjct: 180 SVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLA 239

Query: 245 TASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILE 304
           +  I+S  FE   KY  +SVV+ D DV+ TCL+Y  D+N + EPACGASLHL Y+  ILE
Sbjct: 240 SPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILE 299

Query: 305 NALGHKLSSDDIILVIACGGSSNTVQDL 332
           + L  K+  DDI+++IACGGS  T +DL
Sbjct: 300 DILEQKIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  306 bits (783), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 206/335 (61%), Gaps = 5/335 (1%)

Query: 5   YNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNK 64
           Y +TPL+ Q F    T P     + ++K+E LQP GSFKSRGIG+LI ++       G+ 
Sbjct: 6   YERTPLIHQVFNNGQTGP-----RLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSG 60

Query: 65  SPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEA 124
              VF                 ++L CTVVVP  TK RM++KI+  GA VII+G+HW EA
Sbjct: 61  KLAVFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEA 120

Query: 125 DTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVC 184
           D YL+  +M       ++ +YVHPFD+  IWEGHST+VDE++  L E+NI+L +IK +VC
Sbjct: 121 DEYLRQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVC 180

Query: 185 SVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLG 244
           SV             E++ LA KI ++ VET GC V N SL  G  I   +++SIATSLG
Sbjct: 181 SVGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLG 240

Query: 245 TASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILE 304
           +  I+   FE    Y  +SVV+ D DV+ TCL+Y  D+N + EPACGASLHL Y+  ILE
Sbjct: 241 SPYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILE 300

Query: 305 NALGHKLSSDDIILVIACGGSSNTVQDLEETLVRL 339
           NAL  KLS DDI+++IACGGS  T +DL ET  R+
Sbjct: 301 NALEQKLSDDDIVIIIACGGSCMTYEDLVETSRRI 335

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  291 bits (744), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 198/328 (60%), Gaps = 5/328 (1%)

Query: 6   NKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKS 65
           +K+PLL + F     +     PQFFLKYE LQPSGSFKSRGIG LI   A   +      
Sbjct: 5   HKSPLLNRRF----KESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSD 60

Query: 66  PQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEAD 125
             VF               + L+L CTVVVP  TK+ M+++I+  G+ VI++G HW  AD
Sbjct: 61  VHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMAD 120

Query: 126 TYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCS 185
           TYLK  VM  +  N  EP+YVHPFD+P +WEGHS M+DEIV+ L EQ  ++  +KGI+CS
Sbjct: 121 TYLKEVVMKKVPSNV-EPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICS 179

Query: 186 VXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGT 245
           V             E+H  A KIPI+ VET G      SL  GK +  +++TSIA+SLG+
Sbjct: 180 VGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGS 239

Query: 246 ASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILEN 305
             I+  +FE A +Y TRS V  D + + T L++ Q+ N++ EPAC AS+ L Y+ + L  
Sbjct: 240 PYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNK 299

Query: 306 ALGHKLSSDDIILVIACGGSSNTVQDLE 333
            L  KLSS DI++VI CGGS+ T+ DLE
Sbjct: 300 LLSCKLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  273 bits (699), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 196/327 (59%), Gaps = 14/327 (4%)

Query: 7   KTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSP 66
           KTPLL         +P    P F LKYE LQP GSFKSRGI +LI      I    N+  
Sbjct: 7   KTPLLP------FREPLNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSISDPENEL- 59

Query: 67  QVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEADT 126
            V+                 L +PCTV+VP +TK RM++KI + GA V+I G HWKEADT
Sbjct: 60  AVYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADT 119

Query: 127 YLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSV 186
           YL+  VM     + T  +YVHPFDNP IW+GHSTM+DEI++ L E +  +N +KGIVCSV
Sbjct: 120 YLREYVMRQSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSV 177

Query: 187 XXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTA 246
                        E+H LA  IP+  +ET GC V + SL  G+ +   +I+SIATSLG+ 
Sbjct: 178 GGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGST 237

Query: 247 SISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILENA 306
            I + +F+ A K+ ++S+V++D +V++TCL++  + +++ EPACGASLH  Y   +L   
Sbjct: 238 EICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL--- 294

Query: 307 LGHKLSSDDIILVIACGGSSNTVQDLE 333
               L  DDI++VI CGGS NT  DL+
Sbjct: 295 --GPLGPDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  232 bits (592), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 155/230 (67%), Gaps = 4/230 (1%)

Query: 114 VIINGAHWKEADTYLKSSVMNSIDL-NTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQ 172
           V ++ A+ KEAD YL++ V   IDL    +PIYV+PFD+P IWEGHST++DEI++TL ++
Sbjct: 5   VFVHVANLKEADYYLQNVV---IDLYKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 173 NIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIE 232
           NI +  +KGI+CS              EK+ LA  IP+V VETKGC V N SL   K ++
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 233 FSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGA 292
              ITSIA SLG++ +S + F+   KYH++S+V+ D+D ++TC KY  DF  V EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 293 SLHLAYNTNILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREK 342
           S+H AY+ N+LE AL  KL  DD+I++IACGGS  T QDLE   V+L  K
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQLGNK 231

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  208 bits (529), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 97/192 (50%), Positives = 132/192 (68%)

Query: 141 TEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXE 200
           ++ +YVHPFDN  IWEGHST+VDEI++ L E +I+L ++K +VCSV             +
Sbjct: 9   SKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLD 68

Query: 201 KHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYH 260
           +++LA+KIP+V VET GC V N SLK G  +   K+TS+ATSL +  I+S  FE   KY 
Sbjct: 69  RNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYG 128

Query: 261 TRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNTNILENALGHKLSSDDIILVI 320
            +SVV+ D DV+ TCL+Y  D+N + EPACGASLHL Y+  ILE+ L  K+  DDI+++I
Sbjct: 129 CKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIII 188

Query: 321 ACGGSSNTVQDL 332
           ACGGS  T +DL
Sbjct: 189 ACGGSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  107 bits (266), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 72/125 (57%), Gaps = 5/125 (4%)

Query: 5   YNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNK 64
           Y KTPL+RQF     T        F++K+E LQP GSFKSRGIG+LI K+       G+ 
Sbjct: 6   YEKTPLIRQFLNNGKTNS-----WFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG 60

Query: 65  SPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEA 124
              VF               + ++L C+VVVP  TK RMV+KI++ GA VII+G HW EA
Sbjct: 61  KLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEA 120

Query: 125 DTYLK 129
           D YL+
Sbjct: 121 DEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 109/264 (41%), Gaps = 17/264 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I K          K+  V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA    + + +      T  P    PFD
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKA--ECTKLTEERGLTNIP----PFD 191

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+  ++  +    KIK + C+V             ++  +A  I +
Sbjct: 192 HPYVIAGQGTIAMEILRQVHNAS----KIKAVFCAVGGGGLITGVGAYLKR--IAPHIKV 245

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET      +TSLK GK++    + + A       I  +TF  AK      V+V   +
Sbjct: 246 IGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVLVNTDE 305

Query: 271 VIETCLKYTQDFNMVAEPACGASL 294
           +        +D   + EP+   S+
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALSV 329

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 121/281 (43%), Gaps = 22/281 (7%)

Query: 16  PAV--STKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXX 73
           PAV  S+K +T++    LK E L P  SFK RG  N+I K    ++  G     V     
Sbjct: 86  PAVGLSSKLNTNVQ---LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSA 137

Query: 74  XXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVM 133
                      ++L +P T+V+P +T     + +   G+ V++ G  + EA    + + +
Sbjct: 138 GNHAQGVAYAAKKLGIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKA--ECAKL 195

Query: 134 NSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXX 193
           +     T  P    PFD+P +  G  T+  EI+  ++  N    KI  +   V       
Sbjct: 196 SEERGLTNIP----PFDHPYVIAGQGTVAMEILRQVHNAN----KINAVFVPVGGGGLIA 247

Query: 194 XXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTF 253
                 ++  +A  I ++GVET      +TSL+ GK+ E +K+ + A       I  +TF
Sbjct: 248 GVGAYLKR--IAPHIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETF 305

Query: 254 EYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
             A++     V+V   ++        +D   + EP+   S+
Sbjct: 306 RVAQEVVDEIVLVNTDELCAAIKDVFEDTRSILEPSGALSV 346

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 118/287 (41%), Gaps = 24/287 (8%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V  +TP+ R    ++S++ +T++    LK E L P  SFK RG  N+I K     K +G 
Sbjct: 66  VIEETPISRAV--SLSSRLNTNVK---LKREDLLPVFSFKLRGAYNMIAKLDETQKNAG- 119

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                  +++P T+V+P +T     + +   GA V++ G  + E
Sbjct: 120 ----VIACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDE 175

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTL-NEQNIALNKIKGI 182
           A   L+ + +      T  P    PFD+P +  G  T+  EI+  + N  NI       +
Sbjct: 176 AK--LECARLAEERGMTDIP----PFDHPYVIAGQGTIAMEILRQVQNGSNIG-----AV 224

Query: 183 VCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATS 242
            C+V             ++  +A  I ++GVET      + SLK GK+     + + A  
Sbjct: 225 FCAVGGGGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADG 282

Query: 243 LGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPA 289
                I  +TF   +      ++V   ++        +D   + EP+
Sbjct: 283 TSVRLIGEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEPS 329

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 113/278 (40%), Gaps = 20/278 (7%)

Query: 17  AVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXX 76
            +S+K +T++    LK E L P  SFK RG  N++ K     K  G     V        
Sbjct: 76  GLSSKLNTNVQ---LKREDLLPVFSFKLRGAYNMMAKLDDSQKNQG-----VIACSAGNH 127

Query: 77  XXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSI 136
                   + L++P T+V+P +T     + +   G+ V++ G  + EA            
Sbjct: 128 AQGIAYAAKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERG 187

Query: 137 DLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXX 196
             N      + PFD+P +  G  T+  EI+  +++ N    KI  +   V          
Sbjct: 188 LTN------IPPFDHPYVIAGQGTVAMEILRQVHKAN----KIGAVFVPVGGGGLIAGVG 237

Query: 197 XXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYA 256
              ++  +A  I I+GVET   +   TSL+ GK++  S + + A       I  +TF   
Sbjct: 238 AYLKR--IAPHIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVC 295

Query: 257 KKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
           ++     V+V   ++        +D   + EP+   S+
Sbjct: 296 QEVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 333

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 119/287 (41%), Gaps = 24/287 (8%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           + N++P+ R  F  +S++ +T +    LK E L P  SFK RG  N+I       KK G 
Sbjct: 69  IINESPISRSEF--LSSRLNTDVQ---LKREDLLPVFSFKLRGAYNMISHLDDVQKKCG- 122

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                + L +P T+V+P +T     + +   GA V++ G ++  
Sbjct: 123 ----VIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDA 178

Query: 124 ADTYLKSSVMNSIDLNTTEPIY-VHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGI 182
           A        +    L+  + +Y + PFD+P +  G  T+  EI+  +   +    KI  +
Sbjct: 179 AK-------VECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNSS----KIGAV 227

Query: 183 VCSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATS 242
            C+V             ++   A  I ++GVET      +TS++   +   S++   A  
Sbjct: 228 FCAVGGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADG 285

Query: 243 LGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPA 289
                I  ++F  A++     ++V   ++        +D   V EP+
Sbjct: 286 TSVRLIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPS 332

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 102/259 (39%), Gaps = 17/259 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I  N    +KS      V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI-SNLDEYQKSAG----VIACSAGNHAQGVAFSARELGIR 136

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
             +V+PT+T       + A GA V++ G  + EA    K+       L+    I   PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----KAECARLAQLHKLTDI--PPFD 190

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+  ++  +    +I  + C V             ++  +A  I I
Sbjct: 191 HPYVIAGQGTIATEILRQVHNAS----QIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET      +T+LK G++     +   A       +  +TF  A+      V+V   +
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTDE 304

Query: 271 VIETCLKYTQDFNMVAEPA 289
           +        +D   + EP+
Sbjct: 305 LCAAIKDIFEDTRAIVEPS 323

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 113/291 (38%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V N++P+ +     +S+K ++ I    LK E L P  SFK RG  N++ K     +K G 
Sbjct: 69  VINESPMTKGI--GLSSKLNSQIQ---LKREDLLPVFSFKMRGAYNMVAKLDETQRKQG- 122

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                + L +P T+V+P +T     E +   G+ V++ G  +  
Sbjct: 123 ----VIACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDS 178

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           +    +        +N      + PFD+P +  G  T+  EI+  +       N  K   
Sbjct: 179 SKGECERLCEERGLVN------IPPFDHPYVIAGQGTVAMEILRQVK------NSAKIGA 226

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V                ++A  I IVGVET       TSL  GK+ E + + + A   
Sbjct: 227 VFVPVGGGGLVAGIGAYLKRIAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGT 286

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
               I  +TF  +K      V+V   ++        +D   + EP+   S+
Sbjct: 287 AVKMIGEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPSGALSV 337

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I K     +  G     V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLNIP 145

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA              N      + PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 199

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+  ++  N    KI  +   V             ++  +A  I I
Sbjct: 200 HPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET       TSLK G++   S +   A       I  +TF  A++     V+V   +
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 271 VIETCLKYTQDFNMVAEPACGASL 294
           +        +D   + EP+   S+
Sbjct: 314 ICAAVKDVFEDTRSIVEPSGALSV 337

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 105/259 (40%), Gaps = 17/259 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I K     K  G     V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDSQKNQG-----VIACSAGNHAQGVAFAAKHMSIP 144

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA    + + ++     T  P    PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKA--ECTRLSEERGLTNIP----PFD 198

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+  +  +N A  KI  +                 ++  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQV--RNSA--KIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET      +TSLK GK+   + + + A       I  +TF  A+      V+V   +
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDE 312

Query: 271 VIETCLKYTQDFNMVAEPA 289
           +        +D   + EP+
Sbjct: 313 ICAAIKDIFEDTRGIVEPS 331

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 99/259 (38%), Gaps = 17/259 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I K     +  G     V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAYAAKHLGIP 144

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA              N      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 198

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+  ++  N    KI  +   V             ++  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET      +TSLK  K+     + + A       I  +TF  A++     V+V   +
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 271 VIETCLKYTQDFNMVAEPA 289
           +        +D   + EP+
Sbjct: 313 ICAAVKDIFEDTRSIVEPS 331

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 100/264 (37%), Gaps = 17/264 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I K     K  G     V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDENQKNQG-----VIACSAGNHAQGVAYAARHMNIP 144

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA              N      + PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPFD 198

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+  ++      N +K     V                ++A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVH------NSLKIGAVFVPVGGGGLIAGIGAYLKRIAPHIKI 252

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           VGVET      + S+K GK+     + S A       I  +TF  +++     V+V   +
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDE 312

Query: 271 VIETCLKYTQDFNMVAEPACGASL 294
           +        +D   + EP+   S+
Sbjct: 313 ICAAVKDIFEDTRSIIEPSGALSV 336

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 114/291 (39%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V N++P+ +     +S++ +T++    LK E L P  SFK RG  N+I K          
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAK-----LDDSQ 124

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
           ++  V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 125 RNQGVIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDE 184

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           A              N      + PFD+P +  G  T+  EI+     Q   +NKI  + 
Sbjct: 185 AKAECTKLAEERGLTN------IPPFDHPYVIAGQGTVAMEIL----RQVRTVNKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V             ++  +A  I ++GVET      + SL+  ++     + + A   
Sbjct: 235 VPVGGGGLIAGIGAYLKR--IAPHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGT 292

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
               I  +TF  A++     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 343

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 98/259 (37%), Gaps = 17/259 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N+I K     +  G     V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAKLDDTQRNQG-----VIACSAGNHAQGVAYAARHLDIP 146

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA              N      + PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPFD 200

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI+     Q    NKI  +   V             ++  +   I I
Sbjct: 201 HPYVIAGQGTVAMEIL----RQVYNSNKIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET      +TSL+  K+   + + + A       I  +TF  A++     V+V   +
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 271 VIETCLKYTQDFNMVAEPA 289
           +        +D   + EP+
Sbjct: 315 ICAAVKDVFEDTRSIVEPS 333

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 113/291 (38%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V N++P+ +     +S++ +T++    LK E L P  SFK RG  N+I K     +  G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDE 184

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           A              N      + PFD+P +  G  T+  EI+     Q    NKI  + 
Sbjct: 185 AKAECAKLAEERGLTN------IPPFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V             ++  +A  I I+GVET      + SL+  ++     + + A   
Sbjct: 235 VPVGGGGLIAGIGAYLKR--VAPHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGT 292

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
               I  +TF  A++     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 107/272 (39%), Gaps = 20/272 (7%)

Query: 18  VSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXX 77
           +S+K +T++    LK + L P  SFK RG  N++ K     K  G     V         
Sbjct: 79  LSSKLNTNVQ---LKRDDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHA 130

Query: 78  XXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSID 137
                  + L +P T+V+P +T     + +   G+ V++ G  + EA             
Sbjct: 131 QGVAYAAKHLKIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGL 190

Query: 138 LNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXX 197
            N      + PFD+P +  G  T+  EI+  ++  +    KI  +   V           
Sbjct: 191 TN------IPPFDHPYVIAGQGTVAMEILRQVHMSS----KIGAVFVPVGGGGLIAGVGT 240

Query: 198 XXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAK 257
             ++  +A  I I+GVET       TSL+ GK+     + S A       +  +TF  A+
Sbjct: 241 YLKR--IAPHIKIIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQ 298

Query: 258 KYHTRSVVVEDTDVIETCLKYTQDFNMVAEPA 289
           +     V+V   ++        +D   + EP+
Sbjct: 299 EVVDEVVLVNTDEICAGIKDIFEDTRSIVEPS 330

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 113/291 (38%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V N++P+ +     +S++ +T++    LK E L P  SFK RG  N+I K     +  G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDE 184

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           A              N      + PFD+P +  G  T+  EI+     Q    NKI  + 
Sbjct: 185 AKAECAKLAEERGLTN------IPPFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V             ++  +A  I ++GVET      + SL+  ++     + S A   
Sbjct: 235 VPVGGGGLIAGIGAYLKR--VAPHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGT 292

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
               I  +TF  A++     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 343

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 113/291 (38%), Gaps = 22/291 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V N++P+ +     +S++ +T++    LK E L P  SFK RG  N+I K     +  G 
Sbjct: 75  VINESPISQGV--GLSSRLNTNV---ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG- 128

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                + L +P T+V+P  T     + +   G+ V++ G  + E
Sbjct: 129 ----VIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDE 184

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           A              N      + PFD+P +  G  T+  EI+     Q    NKI  + 
Sbjct: 185 AKAECAKLAEERGLTN------IPPFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVF 234

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V             ++  +A  I ++GVET      + SL+  ++     + + A   
Sbjct: 235 VPVGGGGLIAGIGAYLKR--VAPHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGT 292

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASL 294
               I  +TF  A++     V+V   ++        +D   + EP+   S+
Sbjct: 293 SVRMIGEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 104/259 (40%), Gaps = 17/259 (6%)

Query: 31  LKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRLSLP 90
           LK E L P  SFK RG  N++ K     K  G     V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHAQGVAFAAKHLDIP 152

Query: 91  CTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEPIYVHPFD 150
            T+V+P +T     + +   G+ V++ G  + EA    + + ++     T  P    PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKA--ECTKLSKERGLTNIP----PFD 206

Query: 151 NPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLADKIPI 210
           +P +  G  T+  EI   L + +IA NKI  +   V             ++  +A  I I
Sbjct: 207 HPYVIAGQGTVAMEI---LRQVHIA-NKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 260

Query: 211 VGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVVEDTD 270
           +GVET       TSL+ G++     + + A       I  +TF  ++      V+V   +
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 271 VIETCLKYTQDFNMVAEPA 289
           +        +D   + EP+
Sbjct: 321 ICAAVKDIFEDTRSIVEPS 339

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/283 (20%), Positives = 104/283 (36%), Gaps = 25/283 (8%)

Query: 6   NKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKS 65
           NKTP+L        T  +    + + K E  Q  G+FK RG  N ++K     + +G   
Sbjct: 21  NKTPVLTS-----RTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG--- 72

Query: 66  PQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEAD 125
             V                + L +P T+V+P       V      GAN I+    + E  
Sbjct: 73  --VVAFSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGAN-IVRYDRYTEDR 129

Query: 126 TYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCS 185
             +  ++     L       V P+D+PD+  G  T   E+++ + E ++           
Sbjct: 130 EQIGRALAEEKGLT-----LVPPYDHPDVIAGQGTAAKELIEEVGELDLLF--------- 175

Query: 186 VXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGT 245
           V                +L+ +  I+GVE +  +    SL+ G  +      +IA    T
Sbjct: 176 VPLGGGGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQT 235

Query: 246 ASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEP 288
             +   TFE         +   D +++++   + +   +V EP
Sbjct: 236 QHLGQYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEP 278

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 114/286 (39%), Gaps = 22/286 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V  ++P+ R     +S++ +T++    LK E L P  SFK RG  N++ K A   +  GN
Sbjct: 61  VIEESPITRGV--GLSSRLNTNVQ---LKREDLLPVFSFKLRGAYNMMAKLA---EGQGN 112

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
           K   V                + L++P  +V+P  T     + +   G  V++ G  + E
Sbjct: 113 KG--VIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDE 170

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           A   ++ + ++     T  P    PFD+P +  G  T+  EI+  ++      N  K   
Sbjct: 171 AK--IECARISEERGLTNIP----PFDHPYVIAGQGTVAMEILRQVH------NASKIGA 218

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V                ++A  I IVGVET       TSL  G +   + + + A   
Sbjct: 219 VFVPVGGGGLVAGVAAYLKRIAPHIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGT 278

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPA 289
               I  +TF   + +    V+V   ++        +D   + EP+
Sbjct: 279 SVRMIGEETFRICEDFVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 324

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 110/286 (38%), Gaps = 22/286 (7%)

Query: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGN 63
           V  ++P+ R     +S++ +T++    LK E L P  SFK RG  N++ K +   K  G 
Sbjct: 72  VIEESPITRGV--GLSSRLNTNVQ---LKREDLLPVFSFKLRGAYNMMAKLSEAQKNQG- 125

Query: 64  KSPQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKE 123
               V                + L++P  +V+P  T     + +   G  V++ G  + E
Sbjct: 126 ----VIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDE 181

Query: 124 ADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIV 183
           A T   + +     L       + PFD+P +  G  T+  EI+  ++      N  K   
Sbjct: 182 AKTEC-TRISEERGLTN-----IPPFDHPYVIAGQGTVAMEILRQVH------NAAKIGA 229

Query: 184 CSVXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSL 243
             V                ++A  I I+GVET       TSL+ G +   S + + A   
Sbjct: 230 VFVPVGGGGLVAGVAAYLKRIAPHIKIIGVETYDSATLKTSLEAGTRTPLSTVGTFADGT 289

Query: 244 GTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPA 289
               I  +TF   +      ++V   ++        +D   + EP+
Sbjct: 290 SVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEPS 335

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 101/286 (35%), Gaps = 26/286 (9%)

Query: 6   NKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKS 65
           NKTP+L        T       + + K E  Q  G+FK RG  N + K + + +K G   
Sbjct: 21  NKTPVLTS-----RTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDKERKKG--- 72

Query: 66  PQVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEAD 125
             V                +  ++P T+++P       V      GA+ II    + E  
Sbjct: 73  --VIAFSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAH-IIKYNRYTEDR 129

Query: 126 TYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCS 185
            ++   +           + + P+D+PD+  G  T   E+ + + E +            
Sbjct: 130 EHIGRQLAAKHGY-----VLIPPYDHPDVIAGQGTSAKELFEEVGELDALF--------- 175

Query: 186 VXXXXXXXXXXXXXEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGT 245
           V                 L+    + GVE +  +    S K G  +     ++IA    T
Sbjct: 176 VPLGGGGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQT 235

Query: 246 ASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEP-AC 290
             +   T+   ++     + V D +++E      +   +V EP AC
Sbjct: 236 QHLGEYTYAVIRENVDDILTVSDEELVECMHFLAERMKLVVEPTAC 281

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/266 (19%), Positives = 99/266 (37%), Gaps = 25/266 (9%)

Query: 28  QFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSGNKSPQVFXXXXXXXXXXXXXXXQRL 87
           Q + K E  Q  G+FK RG  N + K +   +  G     V                + L
Sbjct: 38  QIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG-----VIAFSSGNHAQAIALSAKLL 92

Query: 88  SLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKS-SVMNSIDLNTTEPIYV 146
           ++P T+V+P       V      GA++I    + ++ +   +  +  +   L       +
Sbjct: 93  NVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDREQIGRQLAAEHGFAL-------I 145

Query: 147 HPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIKGIVCSVXXXXXXXXXXXXXEKHKLAD 206
            P+D+PD+  G  T   E+++ + + +            V                 L+ 
Sbjct: 146 PPYDHPDVIAGQGTSAKELLEEVGQLDALF---------VPLGGGGLLSGSALAARSLSP 196

Query: 207 KIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKYHTRSVVV 266
              I GVE +  +    S + G  +  +   +IA    T  +   TF   ++     + V
Sbjct: 197 GCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQHLGEYTFAIIRENVDDILTV 256

Query: 267 EDTDVIETCLKY-TQDFNMVAEP-AC 290
            D ++++ C+ +  +   +V EP AC
Sbjct: 257 SDQELVK-CMHFLAERMKVVVEPTAC 281

>NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON}
           Anc_3.357 YPR067W
          Length = 159

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 200 EKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIATSLGTASISSQTFEYAKKY 259
           E +K ++++  +GVE+ GCH F  +L L    +  + T   + +    I+ ++  Y    
Sbjct: 46  EIYKASNEVLKIGVESGGCHGFQYNLDLIPADQSQQETKRTSMMSLLRITIKSVVYVMPP 105

Query: 260 HTRSVVVEDTDVI---ETCLKYT----------QDFNMVAEPACGASL 294
               V++++  +    +T L YT          +D N+ +   CG+S 
Sbjct: 106 DGGKVIIDENSLKILNDTVLNYTTELIGSQFKIEDGNLKSSCGCGSSF 153

>KAFR0A08180 Chr1 complement(1645769..1646632) [864 bp, 287 aa] {ON}
           Anc_3.83 YDR498C
          Length = 287

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 50/93 (53%), Gaps = 14/93 (15%)

Query: 92  TVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTE----PIYVH 147
           T V PT+TK ++++  +    N+I       +++ YL+SS++ S DLN  E     + ++
Sbjct: 126 TTVKPTSTKDKLLKTNKKLTGNLI-------KSNQYLQSSILQS-DLNLDELKQQTLSLN 177

Query: 148 PFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180
             +N   +E   T+VD+    +N+ N + N+ K
Sbjct: 178 IVNNK--YEQFGTIVDKTTSIINQLNKSSNQEK 208

>NDAI0J01760 Chr10 complement(432212..433558) [1347 bp, 448 aa] {ON}
           Anc_4.131 YLR321C
          Length = 448

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 86  RLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWKEADTYLKSSVMNSIDLNTTEP-- 143
           R+S+P   ++P++++Q+ +      G  +I    + + A   +K S   +I+ ++  P  
Sbjct: 168 RISIPTQTLLPSSSEQKSI------GPIIIPIHLNIEHAGHVIKDSFTWNINDHSISPAE 221

Query: 144 ---IYVHPFDNPDIWEGHSTMVDEIVDTLNE-QNIALNKI 179
              IY    D+P     HST+V  I D +NE + IA  KI
Sbjct: 222 FATIYCKDLDSPSNSSLHSTIVQSINDQINEWETIAATKI 261

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,830,075
Number of extensions: 1432264
Number of successful extensions: 4059
Number of sequences better than 10.0: 64
Number of HSP's gapped: 4078
Number of HSP's successfully gapped: 64
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)