Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B091201.4ON43343319780.0
NDAI0A001301.4ON4784986051e-72
TDEL0C069801.4ON4264604702e-53
ZYRO0F18502g1.4ON4503793716e-39
KNAG0C001901.4ON4424853681e-38
Kpol_2002.71.4ON4745083524e-36
Suva_3.1511.4ON4214583494e-36
Skud_3.21.4ON4264723321e-33
YCL063W (VAC17)1.4ON4234623276e-33
SAKL0C00440g1.4ON4625033182e-31
Smik_3.131.4ON4254703073e-30
TPHA0E040201.4ON5405492681e-24
TBLA0A075801.4ON5134812512e-22
CAGL0B00308g1.4ON4304812306e-20
KLLA0C00462g1.4ON4605142281e-19
KAFR0D001201.4ON3994652013e-16
KLTH0F00462g1.4ON4512921356e-08
Kwal_33.130031.4ON4494281232e-06
Ecym_2743na 1ON124457800.37
Kpol_297.22.421ON333165780.42
Kwal_26.81392.552ON48668741.6
KNAG0E025802.476ON1147150732.2
ZYRO0B06512g3.92ON1111113689.2
NOTE: 2 genes in the same pillar as NCAS0B09120 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09120
         (433 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   766   0.0  
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   237   1e-72
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   185   2e-53
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   147   6e-39
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   146   1e-38
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   140   4e-36
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   139   4e-36
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      132   1e-33
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   130   6e-33
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   127   2e-31
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   122   3e-30
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   107   1e-24
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   101   2e-22
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...    93   6e-20
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    92   1e-19
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    82   3e-16
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    57   6e-08
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    52   2e-06
Ecym_2743 Chr2 (1438180..1441914) [3735 bp, 1244 aa] {ON} simila...    35   0.37 
Kpol_297.2 s297 (2732..3733) [1002 bp, 333 aa] {ON} (2732..3733)...    35   0.42 
Kwal_26.8139 s26 complement(662785..664245) [1461 bp, 486 aa] {O...    33   1.6  
KNAG0E02580 Chr5 complement(509587..513030) [3444 bp, 1147 aa] {...    33   2.2  
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    31   9.2  

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/433 (91%), Positives = 397/433 (91%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           MSLLQDISERLLVRSQEAILQLDVWI                    DTNTNMDIRGTLPQ
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
           FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120

Query: 121 ITQKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSF 180
           ITQKLSELSTVRNP                FKPKPLRIISRSNTHSHLHQQTSLDKKVSF
Sbjct: 121 ITQKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKVSF 180

Query: 181 NEDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIF 240
           NEDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIF
Sbjct: 181 NEDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIF 240

Query: 241 DDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNSHESILSFRKPTQSRQ 300
           DDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNSHESILSFRKPTQSRQ
Sbjct: 241 DDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNSHESILSFRKPTQSRQ 300

Query: 301 PNQILPYSSVRQPSMQSVAVNSNPIFSRMRPNATSKDLLSSFINKPQPNRLHQQKPKPNS 360
           PNQILPYSSVRQPSMQSVAVNSNPIFSRMRPNATSKDLLSSFINKPQPNRLHQQKPKPNS
Sbjct: 301 PNQILPYSSVRQPSMQSVAVNSNPIFSRMRPNATSKDLLSSFINKPQPNRLHQQKPKPNS 360

Query: 361 NSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSNKFNPNDIPSSASIREPVFDDSLHL 420
           NSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSNKFNPNDIPSSASIREPVFDDSLHL
Sbjct: 361 NSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSNKFNPNDIPSSASIREPVFDDSLHL 420

Query: 421 EDLNDALNTELLL 433
           EDLNDALNTELLL
Sbjct: 421 EDLNDALNTELLL 433

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  237 bits (605), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 196/498 (39%), Positives = 261/498 (52%), Gaps = 92/498 (18%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           LQDI+ERLL+RSQEAILQLD+WI                    D   N           +
Sbjct: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDN-----------Q 53

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123
           QYN Y+AQLNSL VRV++IRD  ++  N      QL+S  + DEQKYI++LV+EF+ IT 
Sbjct: 54  QYNVYLAQLNSLIVRVQYIRDKFLHNIN------QLDS--TQDEQKYIENLVYEFKQITL 105

Query: 124 KLSELST---VRNPXXXXXXXXXXXXXXXXFKPKPLRIISR-------SNTHSHLHQQTS 173
           KL++LS      +                 F+PKPL+II R       SNT ++ H    
Sbjct: 106 KLNDLSKKNKTTSSSENSSKTASSKSSMESFEPKPLKIIKRTKNDQKVSNTINNDHDLIM 165

Query: 174 LDKKVSFNEDESNSSISHSRSMESLHENSKSLRNTKSMDV-LKRSTFKN----------H 222
            D+ +       +S I  S S  ++ +N ++LR  KS D   K++T +N          +
Sbjct: 166 QDENLQRPNSLPSSPIEKS-SYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFEN 224

Query: 223 SDFSKLLNSRQRLSINIFD--DDLIANED---GNEFYNQY---SDSDQATVISHGTPIRG 274
              ++   S+QRLSI IFD  DD I + +         +Y   ++SDQATVIS GT  R 
Sbjct: 225 DTINQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRN 284

Query: 275 AD--TPLLRRYNSHESILSFRKPTQSRQP----------NQILP-YSSVRQPSMQSVAVN 321
            D  TPL RRYNSHESILS +    S  P          N  LP YSS+R+PSMQS+ V 
Sbjct: 285 DDDFTPL-RRYNSHESILSQKI---SSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVT 340

Query: 322 SNPIFSRMRPNATSKDLLSSFINKPQP---NRLHQQKPK------------------PNS 360
           SNPIF+R     TSKDLLSSF+    P   NR  Q + K                   ++
Sbjct: 341 SNPIFARSSQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTINQTST 400

Query: 361 NSLFGKWNFFNKFNSVTSEIGTTTTQ-----LYPTNSSMSNKFNPNDIPSSASIREPVFD 415
           +S FG WNF N+FN +TSE  TTT +     +   N S ++  + ND   S SI+EPV+D
Sbjct: 401 SSFFGNWNFLNRFNMITSETNTTTNRKRNYNIPLVNQSRAHNIDVNDTMDSISIKEPVYD 460

Query: 416 DSLHLEDLNDALNTELLL 433
           +++ L+DL DALNTELLL
Sbjct: 461 NTISLDDLEDALNTELLL 478

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  185 bits (470), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 153/460 (33%), Positives = 225/460 (48%), Gaps = 70/460 (15%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           L+D+SERLL RSQEAILQL++WI                      ++++D  G       
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELE------------DSSIDKLGN------ 44

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSV-DEQKYIQDLVHEFQDIT 122
           QYN Y+AQLNSL VR E++RD L         N++ E   S+ +++KYI+DLV EFQDIT
Sbjct: 45  QYNVYIAQLNSLCVRSEYVRDKL---------NKERERRMSIINDRKYIEDLVFEFQDIT 95

Query: 123 QKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLD-----KK 177
            KL+EL+  ++                 F+P+PL++  R   +    +++ L      K 
Sbjct: 96  VKLNELAQSQS-IDSTPSSKSTRSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKS 154

Query: 178 VSFN--EDESNSSISHSRSMES----LHENSKSLRNTKSMDV------LKRSTFKNHSDF 225
           V F+   D    ++S   S+      +   ++S+R  KS D        K+S      D 
Sbjct: 155 VKFSGLHDSKEEAVSKCLSLPGSPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDV 214

Query: 226 SKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNS 285
             +    QRLSI +FDD    +ED +      S SDQ TVIS      G   PL RR+NS
Sbjct: 215 PSIFRENQRLSITVFDD---FDEDAD------STSDQDTVISLVPADDGKGLPL-RRFNS 264

Query: 286 HESILSFRKPTQSRQP---NQILPYSSVRQPSMQSVAVNSNPIFSRMRPNATSKDLLSSF 342
           HESILS +    S  P   + +LP S+  +PSM+SV V+S P+FS+    A+S+DLLS+F
Sbjct: 265 HESILSTKVQPISSLPLFSSFLLPSSN--RPSMKSVRVSSAPVFSKTSAPASSRDLLSTF 322

Query: 343 INKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPT---------NSS 393
           + +P          + N    F  WNFF   +S + +I  T  +   +          S 
Sbjct: 323 VTRPGKASNATGIKQENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSK 382

Query: 394 MSNKFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELLL 433
              K  P      + ++ PVFD  +  EDL +AL+TE++L
Sbjct: 383 TLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  147 bits (371), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 184/379 (48%), Gaps = 68/379 (17%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M  L DISERL +RSQEA+LQL++WI                       + ++      +
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHL-----------------SEIEHEHARDK 43

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
             +QYN YMAQLNSL VR E++RD L    N G +N++      V+EQ YI+DLV+EFQD
Sbjct: 44  IADQYNLYMAQLNSLCVRSEYVRDKL----NAGYQNRKPPI---VNEQNYIEDLVYEFQD 96

Query: 121 ITQKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLD----- 175
           IT KL+EL+  +                  F+P+PL+I  R  T     +Q+        
Sbjct: 97  ITVKLNELAQNQK-EQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKL 155

Query: 176 KKVSFNEDE--------SNSSISHS----RSMESLHENSKSLRNTKSMDVL----KRSTF 219
           K V+F E+           +S+  S    RS + L +  + LR  KS D       R+  
Sbjct: 156 KNVNFVEESLPELFCPSKCTSLPGSPLKMRSPDRLPD--RPLRVAKSYDTGLNPNSRAKL 213

Query: 220 KNHSDFSKL--LNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGT-----PI 272
           K   +   L      QRLSI  F DD+    D        S SDQ TVIS        PI
Sbjct: 214 KKQKEEEMLSVFKENQRLSIT-FCDDIDEGSD--------SASDQNTVISTSPIPPSHPI 264

Query: 273 R---GADTPLLRRYNSHESILSFR-KPTQSRQPNQILPYSSVRQPSMQSVAVNSNPIFSR 328
           +    ++ P LRRYNSH+S+LS + +P  S +    L   +  +PSM+SV V+S PI S 
Sbjct: 265 QYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTFLTIPTANRPSMKSVTVSSAPIISS 324

Query: 329 MRPNATSKDLLSSFINKPQ 347
               A+SKDLLSSFI+  Q
Sbjct: 325 TGGKASSKDLLSSFISNTQ 343

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  146 bits (368), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 144/485 (29%), Positives = 230/485 (47%), Gaps = 95/485 (19%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M  L+D+++RLL+RSQ+AILQL++W+                      + ++D R     
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTD------------HASVD-RKKFEA 47

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKN-TGIRNQQLESNNSVDEQKYIQDLVHEFQ 119
             +Q N +++QLNSL +R  +I++ L +++N   IR  +         + YI++LV+EFQ
Sbjct: 48  IAQQRNLHLSQLNSLCLRSRYIKEKLASERNICSIRKGR---------RSYIENLVYEFQ 98

Query: 120 DITQKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNT------------HSH 167
           DI   L+ELS   N                 F+PKPLRI+ R  T            H  
Sbjct: 99  DIAMSLNELSET-NRKNGSPVSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIK 157

Query: 168 LHQQTSLDKKVSFNEDESNSSISH--SRSMESLHENSKSLRNTKSM-DVLKRSTFKNHSD 224
           + ++T   +K  F E+ ++   S   S  +   + + +++R TKS  + L      +HS 
Sbjct: 158 IPRET---EKSDFTENVADCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSP 214

Query: 225 FSKLLNSRQRLSINIFDD----DLIANEDGNEFYNQYSDSDQATVISHGTPI--RGADTP 278
                N++ RLS+ +FD+    +L   +D N        SDQ TV+ + +P+  +GA   
Sbjct: 215 LMNPFNAKNRLSLYLFDNIDEKELTPCDDDN--------SDQETVM-YNSPVVSKGAAFE 265

Query: 279 LLRRYNSHESILSFRKPT---QSRQPNQILPYSSVRQPSMQSVAVNSNPIFSR-MRPNAT 334
            LRRYNSHESILS  K      S Q  Q  P ++    S QSV V+S P++++ +   + 
Sbjct: 266 PLRRYNSHESILSVAKKAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSR 325

Query: 335 SKDLLSSFINKPQPNRLHQQKPK-PNSNSLFGKWNFFNKFN--SVTSEIGTT-------- 383
           SKDLLSS          H +  K   + S+F  WN F K +  ++TSE+GT         
Sbjct: 326 SKDLLSSIA--------HAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKHS 377

Query: 384 ---TTQLYPTNSSMSNKFNPNDIPSSASIRE------------PVFDDSLHLEDLNDALN 428
              T + Y T  ++    +     S +S+R+            P+ D  +   +L++AL 
Sbjct: 378 AIKTNRRYITGDTLVISTSNRPRLSRSSVRQPHGYNRHTSPITPIVDHQVRQNELSEALE 437

Query: 429 TELLL 433
           TELLL
Sbjct: 438 TELLL 442

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  140 bits (352), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 236/508 (46%), Gaps = 118/508 (23%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           + D+SERLLVRSQEAILQLD+WI                    +++ N D    L +  +
Sbjct: 6   IDDLSERLLVRSQEAILQLDLWI-------------QRQQQWAESDDNHD-ENDLEKVTD 51

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSV--DEQKYIQDLVHEFQDI 121
            YN YM+QLNSL +R + +RD L  KK +     +  S + V  + Q  I+DL+ EFQDI
Sbjct: 52  TYNLYMSQLNSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDI 111

Query: 122 TQKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSFN 181
           T+KL+ L++ R                  F+PKPL+I  + N    L +Q    K V+F+
Sbjct: 112 TRKLNVLASSRRRCSSSKSSSSRSSSIGSFQPKPLKISLKRN--KSLKEQNK--KTVTFD 167

Query: 182 EDES-----NSSIS-----------------HSRSMESLHENSKSLRNTK----SMDVLK 215
            +E      NS IS                 H R  +S      S R+ K     +D + 
Sbjct: 168 VEEVTDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVY 227

Query: 216 RSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGA 275
            STFKN           QRLSI++FD D   N+  N        SDQ TVIS  +     
Sbjct: 228 DSTFKN----------TQRLSISLFDIDTNENDITNI-------SDQETVISSSS--LTM 268

Query: 276 DTPL------------LRRYNSHESILSFR-KPTQSRQPNQILPY--------SSVRQPS 314
           D PL            LRRYNSHESILS + +P    +  QI P+        S+    +
Sbjct: 269 DEPLEIIDDQKNNLKPLRRYNSHESILSTKIRPISISKRFQIGPFRSVSTTTTSTNYDTT 328

Query: 315 MQSVAVNSNPIFSRMRPN----ATSKDLLSSFI------NKPQPNRLHQQKPKPNSNSLF 364
             +  V ++  +   +PN     TSKD+LS +       N  + N ++ +K   +S S F
Sbjct: 329 ASNTDVKADDFY---KPNLSNSTTSKDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFF 385

Query: 365 GKWNFFNKFNSVTSEIGT-----TTTQLYPTN-----SSMS-NKFN-------PND-IPS 405
            KWN FN     +SE+G+     TT + + +      SS+S NK N       PN  +  
Sbjct: 386 NKWNIFNFPLIASSEVGSKQENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFC 445

Query: 406 SASIREPVFDDSLHLEDLNDALNTELLL 433
           S +I EP F +++  ++L+DALNTEL L
Sbjct: 446 SPTIYEPTFSNTVSFQELHDALNTELDL 473

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  139 bits (349), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 152/458 (33%), Positives = 210/458 (45%), Gaps = 70/458 (15%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           L+DI+ERLL RS+EAILQLD+WI                            R +L +  +
Sbjct: 6   LEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSD---------------RDSLDKLSQ 50

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123
           QYN YM+QLNSL VR E +RD L        + Q    N   +E K I+DLVHEFQDIT 
Sbjct: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQWRRLNTEENEHKRIEDLVHEFQDITV 103

Query: 124 KLSELSTVRNPXXXXX-XXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182
           +L++L+TV N                  F+P+PL+II R      +       K V FN 
Sbjct: 104 RLNDLATVPNKASNDSPQSQSTRSSLDSFQPRPLKIIERQRL-CVVTPSKPPKKSVVFNP 162

Query: 183 DESNSSISHSRSMESLHE----NSKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236
                  S + S+    +     + +LR  KS D  L +S   + +D +     ++QRLS
Sbjct: 163 INDVECPSKTNSLPCSPKKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLS 222

Query: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI-------SH-GTPIRGADTPLLRRYNSHES 288
           +  FD          E  ++  DSDQ T+I       SH     +GA+   LRRYNSHES
Sbjct: 223 LTFFD----------EMDDEDLDSDQDTIILPNISTPSHMDMATKGAEFEPLRRYNSHES 272

Query: 289 ILSFRKPTQSRQPNQILPYSSVRQP----SMQSVAVNSNP-IFSRMRPN------ATSKD 337
           ILS +            P+     P    S+ +V VN  P + + M P        TSK 
Sbjct: 273 ILSNKPAPAMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKA 332

Query: 338 LLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSN- 396
           LLSSFI   QP+R+  ++   N        +F +KFNS  S I  +        SS  N 
Sbjct: 333 LLSSFIA--QPDRIVVKQKSTN----LKHTSFLDKFNSSLSTISESFQNKKGKKSSDLND 386

Query: 397 -KFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELLL 433
            +  P+ +P   +    + D  + +E+L DALNTELLL
Sbjct: 387 DRIPPHIMPEHNNN---LMDMGVSIEELQDALNTELLL 421

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  132 bits (332), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 149/472 (31%), Positives = 215/472 (45%), Gaps = 93/472 (19%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           L+DI+ERLL+RSQEAILQLD+WI                            + +L +  +
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSD---------------QESLDKLSQ 50

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123
           QYN YM+QLNSL VR E +RD L        + QQ       +E + I+DLVHEFQDIT 
Sbjct: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQQRRLITEDNEHQRIEDLVHEFQDITS 103

Query: 124 KLSELSTV-RNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182
           +L+EL+TV                    F+P+PL+II R      +       K V FN 
Sbjct: 104 RLNELATVPHGVSNDSPQSQSTRSSSGSFQPRPLKIIERQRV-CMVTPSKPPKKSVGFNP 162

Query: 183 ----DESNSSISHSRSMESLHENSKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236
               D  + + S   S +     +++LR  KS D  L +S   + +D +     ++QRLS
Sbjct: 163 INDVDCPSKTNSLPCSPKKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLS 222

Query: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI--SHGTP------IRGADTPLLRRYNSHES 288
           +  FD          E  ++  DSDQ T+I  +  TP       +GA+   LRRYNSHES
Sbjct: 223 LTFFD----------EMDDEDLDSDQDTIILPNISTPPHMNVTAKGAEFEPLRRYNSHES 272

Query: 289 ILSFRKPTQSRQPNQILPYS------SVRQPSMQSVAVNSNPIFSRMRPNAT-------- 334
           IL       S +P  I+  S      S  +PS  +   +++ +     P  T        
Sbjct: 273 IL-------SNKPAPIMSLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRN 325

Query: 335 ------SKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLY 388
                 SK LLSSFI +  P+R+  ++   N        +F +KFNS  S    T ++ +
Sbjct: 326 GCYAPSSKALLSSFIAR--PDRIAAKQDPTN----LKHTSFLDKFNSSLS----TISESF 375

Query: 389 PTNSSMSNK-------FNPNDIPSSASIREPVFDDSLHLEDLNDALNTELLL 433
                  NK        N N I ++   ++ + D S+ +E+L DALNTELL 
Sbjct: 376 QNKKGKKNKDVNDGRISNLNHI-ATQEQKKNIMDMSVSIEELQDALNTELLF 426

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  130 bits (327), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 151/462 (32%), Positives = 217/462 (46%), Gaps = 76/462 (16%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           L+DI+ERLL+RSQEAILQLD+WI                            + +L +  +
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTD---------------QESLDKLSQ 50

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123
           QYN YM+QLNSL VR E +RD L        + QQ       +E + I+DLV EFQDIT 
Sbjct: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQQRRLITEDNEHQRIEDLVREFQDITL 103

Query: 124 KLSELSTVRNPX-XXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182
           +L+EL+TV N                  F+P+PL+II R      +       K V FN 
Sbjct: 104 RLNELATVPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQRL-CMVTPSKPPKKSVGFNP 162

Query: 183 DESNSSISHSRSMESLHEN----SKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236
                  S + S+    +     +++LR  KS D  L +S   + SD +     +RQRLS
Sbjct: 163 INEVDCPSKTNSLPCSPKKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLS 222

Query: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI-------SH-GTPIRGADTPLLRRYNSHES 288
           +             +E  ++  DSDQ T+I        H G   +GA+   LRRYNSHES
Sbjct: 223 LT----------FFDEMDDEDFDSDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHES 272

Query: 289 ILSFRKPTQSRQPNQILPYSSVRQP-------SMQSVAVNSNP-IFSRMRPN------AT 334
           ILS  KP  S+  N     +S  +P       S+ +V VN +P + + M P+      ++
Sbjct: 273 ILS-NKPAPSKSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISS 331

Query: 335 SKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSM 394
           SK LLSSFI +   + + +      +N+     +F +KFNS  S    T ++ + +    
Sbjct: 332 SKALLSSFIARSDTHTVKE------NNTNLKHASFMDKFNSSLS----TISESFQSKRGR 381

Query: 395 SNK-FNPNDIPSSASIREPV--FDDSLHLEDLNDALNTELLL 433
            NK  N   I +    +E     D S+ +E+L DALNTELL 
Sbjct: 382 KNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTELLF 423

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  127 bits (318), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 148/503 (29%), Positives = 219/503 (43%), Gaps = 111/503 (22%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M  L +IS++LLVRSQEAILQLD++I                    D   N    G L +
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYI--------QRQQRLYEYETLDQPDN----GLLTK 48

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
            L++Y T +AQLNSL +R E +RD +    +T  R  Q        +   I  LV EFQ 
Sbjct: 49  -LQEYQTCLAQLNSLHIRSEHLRDRIA---STDHRASQ--------DGDSIGHLVTEFQK 96

Query: 121 ITQKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTH--------------- 165
           IT KL+EL+  ++                 F+PKPL+I+ R+                  
Sbjct: 97  ITTKLNELAATQD-RAYQSPGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKK 155

Query: 166 -SHLHQQTSLDKKVSFNEDESNSSISHSRSMESLH----ENSKSLRNTKSMDVLKRSTFK 220
            + L +    DKKV F+    ++S+  S SM +      +  +  R+ KS D       +
Sbjct: 156 IAPLRKNPPFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQR 215

Query: 221 NHSDFSKLLN---SRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTP----IR 273
              D    LN     QRLSI+ FDD++            YS SD+ TVIS   P     +
Sbjct: 216 RRQDSDNRLNFFKENQRLSISFFDDEI-----------DYS-SDEDTVISVSPPETTSFK 263

Query: 274 G-ADTPLLRRYNSHESILSFRKPTQSRQPNQILPYS------SVRQPSMQSVAVNSNPIF 326
           G      LRRYNSHES+LS ++   +  P +   +S      +  +P  +SV++N  P++
Sbjct: 264 GFPKAEPLRRYNSHESVLSRKEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVY 323

Query: 327 SRM-------RPNATSKDLLSSFINKPQPNRLHQ--------QKPKPNSNSLFGKWNFFN 371
           S         +   TSKDLL+ F++   P +  Q        ++PK    S+F  W  FN
Sbjct: 324 STAALLRSHSKTTETSKDLLAQFVSA-APKQKKQTTSWFGPAEEPK---RSIFSGWKLFN 379

Query: 372 KFNSVTSEIGTTTTQLYPT----NSSMSNKFNP-----NDIPSSASIR------------ 410
               VTSE G   +   P+     ++   K  P       +PSS+ I             
Sbjct: 380 NSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPN 439

Query: 411 EPVFDDSLHLEDLNDALNTELLL 433
           EPV ++ +  + L++AL TE  L
Sbjct: 440 EPVLNNKVSYDALHEALCTEFRL 462

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  122 bits (307), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 150/470 (31%), Positives = 212/470 (45%), Gaps = 90/470 (19%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLE 63
           L+DI+ERLL+RSQEAILQLD+WI                       T+ ++   L +  +
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQ------------TTDQEL---LDKVSK 50

Query: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123
           QYN YM+QLNSL VR E +RD L        + QQ       +E + I+DLV EFQDIT 
Sbjct: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQQRRLITEDNEHQRIEDLVREFQDITL 103

Query: 124 KLSELSTVRNPXXXXX-XXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182
           +L+EL+T  N                  F+P+PL+II R      +       K V FN 
Sbjct: 104 RLNELATAPNEVANDSPQSQSTRSSLESFQPRPLKIIERQRL-CMVTPSKPPKKSVGFNP 162

Query: 183 --DESNSSISHSRSMESLHENSK--SLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236
             D    S ++S       + +K  +LR  KS D  L +S   + +D +     +RQRLS
Sbjct: 163 INDVDCPSKTNSLPCSPKKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLS 222

Query: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI--SHGTP------IRGADTPLLRRYNSHES 288
           +             +E  ++  DSDQ TVI  +  TP       +GA+   LRRYNSHES
Sbjct: 223 LT----------FFDEMDDEDFDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHES 272

Query: 289 ILSFRKPTQSRQPNQILPYSSVRQP-------------SMQSVAVNSNP-IFSRMRPN-- 332
           IL       S +P  ++ +S    P             S+ +V  N +P I + M P   
Sbjct: 273 IL-------SNKPAPLMSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRN 325

Query: 333 ----ATSKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLY 388
                +SK LLSSFI + +   + Q  P           +  +KFNS      TT ++ +
Sbjct: 326 GVHAPSSKALLSSFIGRSERPMVKQNTPN------LKHVSLLDKFNSSL----TTISESF 375

Query: 389 PTNSSMSNKFNPNDIPSSASIRE-----PVFDDSLHLEDLNDALNTELLL 433
            +    +   N   I S   I        + D S+ +E+L DALNTELLL
Sbjct: 376 QSKKKKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDALNTELLL 425

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  107 bits (268), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 150/549 (27%), Positives = 230/549 (41%), Gaps = 137/549 (24%)

Query: 4   LQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDT-NTNMDIRGTLPQFL 62
           L+++SE+LL+RSQEAILQLD+WI                    DT N   D    L    
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWI----LRQQQQHNDHRFGTATDTGNKTKDSNEALNALR 63

Query: 63  EQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDIT 122
             Y+ YM+QLNSL VR EFIRD L ++KN  +    L+  N       I++LV EFQ+I 
Sbjct: 64  STYDLYMSQLNSLYVRSEFIRDKLNSEKN-NVNKFNLDHRN-------IEELVFEFQNIR 115

Query: 123 QKLSEL-STVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSL---DKKV 178
           +KL++L ++ +                     KPL+++++      + ++  L   +K V
Sbjct: 116 EKLNQLAASSKLDKHSPPKTSTRSSSMESMNLKPLKVVAKH--EKRMSKELELKNKEKSV 173

Query: 179 SFNEDESNSSISHS------------RSMESLHENSKSLRNTKSMDVL--------KRST 218
           +F ++   S  ++              S + + +  K LRN  S D          KRS 
Sbjct: 174 TFGKETRISLTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSN 233

Query: 219 F----KNHSDFSKLLNSRQRLSINIFDD--DLIANEDGNEFYNQYSD-----------SD 261
                KN + +  L  ++QR SI++F+D  D   N + NEF N   D           SD
Sbjct: 234 REYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEF-NPTVDASINTELIENNSD 292

Query: 262 QATVISHGTPIRGADTPL--------------------------LRRYNSHESILS---- 291
           Q TVIS        + PL                          LRR NSHESILS    
Sbjct: 293 QETVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLE 352

Query: 292 --FRKPTQSRQPNQILPYSSVRQPSMQSVAVNSN--------------------PIFSRM 329
             F K   S   ++ + +SS  +P++ SV+  S                     P+ S  
Sbjct: 353 NTFYKNVGSNFYDRFI-FSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSST 411

Query: 330 RPNATSKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKF--------------NS 375
           R   TS++LLS F +KP+  +        +S   F  W  F+                N 
Sbjct: 412 R-GVTSRELLSKFADKPEQLKAPTTSNSNSSKYFFENWGLFSSMSSSSTFHRKNTSGSNI 470

Query: 376 VTSEIG------TTTTQLYPTNSSMSNKF-----NPNDIPSSASIREPVFDDSLHLEDLN 424
           ++SE+G      +T  ++   N+  +  F     N +DI +  +I  P+  + +   +L+
Sbjct: 471 ISSEVGKKLCDRSTGIKVTSINTQNAYTFPFIRSNSHDI-TKQNITNPIIKERVSYNELH 529

Query: 425 DALNTELLL 433
           DALNTE+ L
Sbjct: 530 DALNTEIKL 538

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 127/481 (26%), Positives = 202/481 (41%), Gaps = 136/481 (28%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMD-IRGTLP 59
           M+L +++S RLL ++QEA+LQLD+WI                        N D +R +  
Sbjct: 1   MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQ-----------------NRDGLRASTS 43

Query: 60  QFLEQ----YNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLV 115
           + LEQ    YN YM QLNSL +R ++IRD +  +    + +  +  N++ +   Y+Q LV
Sbjct: 44  ESLEQAERDYNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDT-NSHAYVQQLV 102

Query: 116 HEFQDITQKLSELSTVRN---------PXXXXXXXXXXXXXXXXFKPKPLRIISR----- 161
            EF  ++ K++ELS ++                           F+P+PL+I+ R     
Sbjct: 103 TEFYSLSIKMNELSAIQENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNN 162

Query: 162 -SNTHSH--------LHQQTSLDKKVSFNEDES------NSSISHSRSM---------ES 197
             NTH          L  ++S +K +S N+ ES      NS  S +  +         +S
Sbjct: 163 NQNTHPQPDLESPLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQS 222

Query: 198 LHENSKSLRNTK---SMDVLKRSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFY 254
             E + S+ NT+   SMD L  S FK          +  RLSI   D      ++ +E+ 
Sbjct: 223 FEEPTFSVANTRNKNSMDPLHYSLFK----------TNNRLSIQFPD----GYDNDDEYD 268

Query: 255 NQYSDSDQATVISHGTP-----IRGADTPLLRRYNSHESILSFRKPTQSRQPNQILPYSS 309
           +    SDQ T+    TP     I+    P LR++NSHESILS  K         I P  +
Sbjct: 269 DPTCISDQDTIFV-STPKIASSIKNTSEP-LRKFNSHESILSVEKSNMKF----IQPLPA 322

Query: 310 VRQPS------------------MQSVAVNSNPIFSR---------------MRPNATSK 336
           ++ PS                    +V++  NP+ S+               MR N+   
Sbjct: 323 LKPPSSLLNLTLKKNLRSVSSVSSNNVSLTYNPMISKLNTTTIIPSEHTRNQMRVNSV-- 380

Query: 337 DLLSSFINKPQPNRLHQQKPKPN------------SNSLFGKWNFFNKFNSVTSEIGTTT 384
           DLL+ ++ +P P +L  +   PN             +S+F  WN  N  ++    I ++ 
Sbjct: 381 DLLNLYVQQPTPKKLKTESQSPNPPSTDTLPSSNKESSVFSNWNILNLISTPRLSISSSV 440

Query: 385 T 385
           T
Sbjct: 441 T 441

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 124/481 (25%), Positives = 196/481 (40%), Gaps = 99/481 (20%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M+ L++I+ERLL RS EAI QLD WI                    +  + +D   ++ +
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWI----------LLQNKNRHISENKSGLD---SIER 47

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
             ++Y  ++ +LNSL +R ++I+D +  +KN     ++ E N S      IQ+L+ EF++
Sbjct: 48  LDDKYTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTS-----RIQELMLEFKE 102

Query: 121 ITQKLSELST---VRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKK 177
           IT  L+E++      N                 F PKPL+I++R++            + 
Sbjct: 103 ITLSLNEIAQQDDETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRN 162

Query: 178 VSFNEDESNSSISHSRSMES-------LHENSKSLRNTKSMDVLKRSTFKNHSD---FSK 227
           +SF     N S++   S+ S       L E  + L   +S     R+      D     K
Sbjct: 163 ISFCPIHENLSVTEYESLPSSPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQLDK 222

Query: 228 LLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHG-----TPIRGADTPLLRR 282
               +QRLS+ +F     A+ D  E  N    SD+ TVI        T     D   +RR
Sbjct: 223 YFKDKQRLSLTLFGS---ADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRR 279

Query: 283 YNSHESILSFRKPTQSRQPNQI------------LPYSSVRQ---PSMQSVAVNSNPIFS 327
            NSHES+LS       +  N +            L  S+ R    PS+Q++ V+     S
Sbjct: 280 CNSHESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLS 339

Query: 328 RMR----------PNATSKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSV- 376
           R             + TSKDLL+S +              P +     K  FF+KFNS+ 
Sbjct: 340 RFSREQDREMTQLGSKTSKDLLTSVMT-----------ATPITTQRNNKLTFFDKFNSMF 388

Query: 377 ----TSEIGTTTTQLYPTNSSMSNKFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELL 432
                SE   TT +   +  S  N F                   + +E+LN+AL T ++
Sbjct: 389 NFSTISEEQKTTVEKNRSAESPRNDF-------------------VSIEELNEALTTNMV 429

Query: 433 L 433
           +
Sbjct: 430 M 430

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 132/514 (25%), Positives = 224/514 (43%), Gaps = 139/514 (27%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M  ++ ++ERL++R  EA++QL++ I                      N++  I+     
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFD------------PNNSHCFIQ----- 43

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
            +++Y +++A+L+SL++R E ++++L        R+Q+ + N+   E + ++ L++EFQD
Sbjct: 44  -VQEYYSFLARLSSLKLRAEHVQESL--------RHQRKDPNDVCIEYETLEKLIYEFQD 94

Query: 121 ITQKLSELS-TVRNPXXXXXXXXXXXXXXXXFKPKPLRIISR---------------SNT 164
           IT  L+E++   ++P                   K L+II R               S  
Sbjct: 95  ITMSLNEVARAYQSPTKSARSGSSKESSVIPL--KTLKIIERNRDSLIGTSPMKKSLSQL 152

Query: 165 HSHLHQQTSLDKK-VSFNEDESN-----SSISHSRSM------ESLHENS------KSLR 206
               H Q+   K+ V F ED+ +      S+  + S+      ++L E+       K+LR
Sbjct: 153 KKEEHNQSLPAKRNVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLR 212

Query: 207 NTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVI 266
             KS DV      K ++D+ +   ++ RLS+++FDD    N D          SD+ TVI
Sbjct: 213 MAKSYDVGLNGRAKKNADW-EFFKNKNRLSLSVFDD---VNTDA---------SDEETVI 259

Query: 267 SHGTP------IRGAD---TPLLRRYNSHESILSFRKPTQSRQPNQILPYSSVRQPSMQS 317
           S   P       +  D   +  +RR NSHESILS +  + S   N I+      +P+ QS
Sbjct: 260 SVSPPNISYYLSQNEDQYPSKQVRRCNSHESILSRKILSPSTPANLIM------RPTYQS 313

Query: 318 V----AVNSNPIFSRMRPNAT----------SKDLLSSFINKPQPNRLHQ-----QKPKP 358
           V    A+ + P  S    N+T          SKD+LS F+  P P++ ++         P
Sbjct: 314 VWQKKAIVTKPTISCSTSNSTASPTIGSPHLSKDMLSQFVTAP-PSKKYRGWFSSSNSTP 372

Query: 359 NSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSNK--------------------- 397
            ++S+F KW  FN  + VT EIG       P NSS S+                      
Sbjct: 373 FASSIFQKW--FNSDSLVTKEIGN------PDNSSPSSGRPIVENRQRHSSSNSYSTSIV 424

Query: 398 FNPNDIPSSASIREPVFDDSLHLEDLNDALNTEL 431
             PN       + +P+   ++   +L +ALNTE 
Sbjct: 425 IGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEF 458

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 120/465 (25%), Positives = 204/465 (43%), Gaps = 110/465 (23%)

Query: 7   ISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQFLEQYN 66
           +S+ LL RS+EA+ QL+ W+                                   L Q  
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQ------------------------------LHQTT 34

Query: 67  TYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYI-QDLVHEFQDITQKL 125
               QLNSL  + ++I + L+   ++ I +  +E      E+ +I + L+HEF +I+ KL
Sbjct: 35  AEYKQLNSLCAKSKYISN-LLKDDSSSIPHDLMEQ----KERSFIVESLIHEFNEISTKL 89

Query: 126 SELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISR-----SNTHSHLHQQTSLDKKVSF 180
           +E+ T  +P                F+PKPL ++ +     S T S    +  L++K+S 
Sbjct: 90  NEIVTHTSPQSTIDS----------FEPKPLNLLRKNKILESPTRSSPVTRGRLERKISI 139

Query: 181 N------EDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQR 234
           N        + NS  +  +   +   N ++LRN KS        +  + D+        R
Sbjct: 140 NLFPMHTTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYH------YGLNGDYINPFKENNR 193

Query: 235 LSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNSHESIL---- 290
           LSI+ F+ D   N++ ++  +   D D   V S   P        L+R NS +S+     
Sbjct: 194 LSISFFNGDNTFNDNNSDSESDIDDDDTVLVTS---PFLTNPKQKLKRSNSQDSVFWNEN 250

Query: 291 SFRKPTQSRQPNQILPYSSVRQPSMQSVAVNSNPIFSR--MRPNATSKDLLSSFINKPQP 348
             RKP+  +Q N + P S++ +P+ +   ++S  +F +   R  ++SK LL+SF+     
Sbjct: 251 YLRKPSFQKQLN-LFP-STLTKPTAE---LSSTQVFLKNTGRLGSSSKALLTSFVK---- 301

Query: 349 NRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTT---------------------TTQL 387
           + L QQ+   N++S      F N FNSVTSEIG +                      + L
Sbjct: 302 DNLQQQQRTHNASS------FNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTL 355

Query: 388 YPTNSSMSNKFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELL 432
             +  S  N+F+  D  + +  ++P+ ++ +   DLNDALNTE L
Sbjct: 356 ITSKKSRFNRFSSVD--NISPTKKPIINNDVQYSDLNDALNTEFL 398

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 112/292 (38%), Gaps = 62/292 (21%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M  LQ+I++  L  SQ A+ +LD  +                     TN           
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTN----------- 49

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
            + QY  Y+ QL SL  + + + DT++   +  + + Q         Q+ I++L+ EFQ+
Sbjct: 50  -MAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQ---------QRAIENLIQEFQE 99

Query: 121 IT---QKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKK 177
           I    +     S   +P                F+PKPL+I+ R         + S    
Sbjct: 100 IAKNDENFISYSMRESPNSMSVQSICS------FQPKPLKILQRRQAQLESPTKRSFRPS 153

Query: 178 VSF---NEDESNSSISHSRSMESL--------------HENSKSL--RNTKSMDVLKRST 218
           +S      DE+N + +  RS E L              H N+ +L  R+ KS D      
Sbjct: 154 MSLLDNRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRR 213

Query: 219 FKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGT 270
              H +       RQRLSI+  +D+    ED          SD+ATVIS G+
Sbjct: 214 SNPHENRLNFFKDRQRLSISFIEDE----ED---------VSDEATVISAGS 252

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 93/428 (21%), Positives = 164/428 (38%), Gaps = 78/428 (18%)

Query: 1   MSLLQDISERLLVRSQEAILQLDVWIXXXXXXXXXXXXXXXXXXXXDTNTNMDIRGTLPQ 60
           M  L  I++  L RS+EA+++L+  +                     +            
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSST----------- 49

Query: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120
            + QY +Y+ QLN L ++ + ++D +      G R   L ++     Q+ I+ L H+++ 
Sbjct: 50  -IVQYYSYLGQLNCLYIKAQSLKDMM------GNRCGHLPNST----QEAIERLEHDYKA 98

Query: 121 ITQKLSELSTVRNPXXXXXXXXXXXXXXXXFKPKPLRIISR--------------SNTHS 166
           +    +EL  +R                  F+PKPL+II R              +   +
Sbjct: 99  LCNHANELG-IREKNLEDSPSCLSPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMA 157

Query: 167 HLHQQTSLDKKVSFNEDE---SNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHS 223
               ++  DK   +  DE   +NS  ++S       +  K +R  KS           H 
Sbjct: 158 KSFCRSGTDKNSDYIPDEIGKTNSCNTNSPCTNEAKKEPKFIRVVKSCGTGLNKHSNPHE 217

Query: 224 DFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGA----DTPL 279
           +       RQRLSI+  +DD        E+      SD+ T+ S G+P+  +    D   
Sbjct: 218 NRLSFFRDRQRLSISFIEDD--------EYL-----SDEETITS-GSPLNASFLLNDFAK 263

Query: 280 LRRYNSHESILSFRKP---TQSRQPNQILPYSSV--RQPSMQSVAVNS-------NPIFS 327
           + +   ++++ S R      +  Q   + P+ S+  ++     + + S        P FS
Sbjct: 264 VAKGRPNQTLASSRHVENNERGAQTAAVSPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFS 323

Query: 328 RMRPNAT-SKDLLSSFINKPQPNRLHQQ-KPKPNSNSLFGKWNFFNKFNSVTSEIG---- 381
             +   T SK++LS F+ K    + H   K    S      +  FN    VTSE G    
Sbjct: 324 PKKFETTESKEILSHFVIKEPRTKSHSWLKGCDKSVPFLQTFKIFNNQVLVTSETGCRNV 383

Query: 382 --TTTTQL 387
             TT+T+L
Sbjct: 384 DRTTSTKL 391

>Ecym_2743 Chr2 (1438180..1441914) [3735 bp, 1244 aa] {ON} similar to
            Ashbya gossypii AER194W
          Length = 1244

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 151  FKPKPLRIISRSNTHSHLHQQTSLDK-KVSFNEDESNSSISHSRSMESLHENSKSLR 206
            FKP  LRI     TH       S+    +++ E  SNS + H+  +ES  +NS  LR
Sbjct: 983  FKPSTLRIFHDQPTHCKFCGSASVASFSIAYTEQHSNSLVMHTFQLESKTKNSICLR 1039

>Kpol_297.2 s297 (2732..3733) [1002 bp, 333 aa] {ON} (2732..3733)
           [1002 nt, 334 aa]
          Length = 333

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 66/165 (40%), Gaps = 22/165 (13%)

Query: 80  EFIRDTLVNKKNTGIRNQQLESNN-------SVDEQKYIQDLVHEFQDITQKLSELSTVR 132
           EF +  L  KK   I NQQ+E+ N       + + QK    + HE     Q LS+L+ + 
Sbjct: 9   EFQQSVLSYKKQYKIANQQIETTNNESNRKDASEFQKRASGIAHEISGTAQLLSKLAILA 68

Query: 133 NPXXXXXXXXXXXXXXXXFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNEDESNSSISHS 192
                                + +  I ++      HQ+++  +  + N D  N ++ HS
Sbjct: 69  KRKPMFNDNPVEIAELSFLIKRKIYAIEQNLVDLSKHQRSNGSQNANNNVDGRNGNVQHS 128

Query: 193 RSMESLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSI 237
           +       N  +L NTK  ++          DF  +L +RQRL I
Sbjct: 129 K-------NVMNLLNTKMKNI--------SGDFKDVLEARQRLEI 158

>Kwal_26.8139 s26 complement(662785..664245) [1461 bp, 486 aa] {ON}
           YKL039W (PTM1) - Putative membrane protein [contig 55]
           FULL
          Length = 486

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%)

Query: 165 HSHLHQQTSLDKKVSFNEDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSD 224
           H +L Q+T  DK+   N+  S   ++  +S E L E    +++T    V+  S     + 
Sbjct: 99  HQYLFQKTIKDKETGENKTLSTKILTFYQSSEGLQETKYPIKSTGYYCVIASSEESQKAK 158

Query: 225 FSKLLNSR 232
           FS ++N R
Sbjct: 159 FSAVVNFR 166

>KNAG0E02580 Chr5 complement(509587..513030) [3444 bp, 1147 aa] {ON}
           Anc_2.476 YMR086W
          Length = 1147

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 21/150 (14%)

Query: 197 SLHENSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQ 256
           S HENS+++++       K+ T  N++   K + S + ++  +   +   ++ GN    Q
Sbjct: 674 SFHENSEAVQDN---SYSKKGTSDNNAVVKKAVKSEKSMAGYLRSTNPYLSKRGN----Q 726

Query: 257 YSDSDQATVISHGTPIRGADTPLLRRYNSHESILSFRKPTQSRQPNQILPYSSVRQPSMQ 316
               D AT  S            +RR NS E   S   PT+   P +  P S +R P MQ
Sbjct: 727 KPSGDGATQKSA----------TMRRGNSSEGTSST--PTKQTSPRR--PQSELRPPGMQ 772

Query: 317 SVAVNSNPIFSRMRPNATSKDLLSSFINKP 346
            ++    PI S ++ ++      S F + P
Sbjct: 773 QISRQRTPIKSALKKSSPHSKGGSKFSDSP 802

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12236 YOL100W Saccharomyces
            cerevisiae YOL100W PKH2 Serine/threonine protein kinase
            involved in sphingolipid-mediated signaling pathway that
            controls endocytosis
          Length = 1111

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 21/113 (18%)

Query: 289  ILSFRKPTQSRQPNQI-LPYSSVRQP-----------------SMQSVAVNSNPI-FSRM 329
            +L   KP Q R+P+Q  L YSS  Q                  S+ SVA   + +  S  
Sbjct: 959  VLVQEKPVQQREPHQKELYYSSSPQALGSPPAVPSRTPKTPRSSLYSVASGDSTVSLSGT 1018

Query: 330  RPNATSKD--LLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEI 380
             P+ ++K+  +  SF+N  + N   Q  P P S+ L     ++N  NSV   I
Sbjct: 1019 GPSRSAKNEHMFESFVNSKEKNTKKQTSPVPMSSKLVSGLPYYNYNNSVGLGI 1071

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,604,890
Number of extensions: 2118444
Number of successful extensions: 10763
Number of sequences better than 10.0: 312
Number of HSP's gapped: 11241
Number of HSP's successfully gapped: 334
Length of query: 433
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 321
Effective length of database: 40,638,807
Effective search space: 13045057047
Effective search space used: 13045057047
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)