Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B091101.5ON1020102044650.0
NDAI0A001401.5ON1091115613491e-168
YCL061C (MRC1)1.5ON1096113011351e-137
Smik_3.141.5ON111366610201e-120
KAFR0D001401.5ON10418059931e-117
Kpol_2002.81.5ON98510799731e-115
ZYRO0F18480g1.5ON96010479431e-111
TPHA0E040101.5ON9659139051e-105
TDEL0C069701.5ON94110458971e-104
KNAG0C002201.5ON11619578662e-98
Skud_3.31.5ON11525068292e-93
Suva_3.1521.5ON11404148231e-92
CAGL0B00330g1.5ON11366237571e-83
TBLA0A075701.5ON12527227502e-82
SAKL0C00462g1.5ON11773947333e-80
Ecym_10081.5ON11186986783e-73
KLTH0F00484g1.5ON9936606362e-68
KLLA0C00484g1.5ON9256785928e-63
Kwal_33.130051.5ON9706715601e-58
AFR745W1.5ON10189035407e-56
CAGL0K12562g8.34ON168257781.7
CAGL0C00737g8.435ON816158719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09110
         (1020 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...  1724   0.0  
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   524   e-168
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   441   e-137
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   397   e-120
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   387   e-117
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   379   e-115
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   367   e-111
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   353   e-105
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   350   e-104
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   338   2e-98
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   323   2e-93
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   321   1e-92
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   296   1e-83
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   293   2e-82
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   286   3e-80
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   265   3e-73
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   249   2e-68
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   232   8e-63
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   220   1e-58
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   212   7e-56
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    35   1.7  
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    32   9.2  

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score = 1724 bits (4465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/1020 (88%), Positives = 903/1020 (88%)

Query: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60
            MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR
Sbjct: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60

Query: 61   NRLDGKENKEDTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXAINKEQEVVQTQLIAXXXX 120
            NRLDGKENKEDTPVPTQTQMIDNLYKDA             AINKEQEVVQTQLIA    
Sbjct: 61   NRLDGKENKEDTPVPTQTQMIDNLYKDAEELEEETIEYEKEAINKEQEVVQTQLIAKEKE 120

Query: 121  XXXXXXXPSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEKIP 180
                   PSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEKIP
Sbjct: 121  EIENIKNPSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEKIP 180

Query: 181  FTFTQKIQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRISQELQRTMTDM 240
            FTFTQKIQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRISQELQRTMTDM
Sbjct: 181  FTFTQKIQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRISQELQRTMTDM 240

Query: 241  DTQVINNTNLDVIEATMADLPNLNEPQSTVADIPSTGLKIHEIQKELERERNSKELKEYK 300
            DTQVINNTNLDVIEATMADLPNLNEPQSTVADIPSTGLKIHEIQKELERERNSKELKEYK
Sbjct: 241  DTQVINNTNLDVIEATMADLPNLNEPQSTVADIPSTGLKIHEIQKELERERNSKELKEYK 300

Query: 301  KPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRTXXXXXXXXXXXXXXXXLT 360
            KPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRT                LT
Sbjct: 301  KPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRTKEKPESSIKPKIKPKKLT 360

Query: 361  GLNTYENXXXXXXXXXXHIQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKS 420
            GLNTYEN          HIQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKS
Sbjct: 361  GLNTYENKLKKKLLEKKHIQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKS 420

Query: 421  NKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRNK 480
            NKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLED                 RNK
Sbjct: 421  NKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDIEKEKEIVENLLEEEIKRNK 480

Query: 481  RIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSDNIANSQIXXXXXXXXXXVLD 540
            RIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSDNIANSQI          VLD
Sbjct: 481  RIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSDNIANSQISDEEDEDSDSVLD 540

Query: 541  NGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENEINK 600
            NGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENEINK
Sbjct: 541  NGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENEINK 600

Query: 601  INTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLI 660
            INTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLI
Sbjct: 601  INTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLI 660

Query: 661  EKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSN 720
            EKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSN
Sbjct: 661  EKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSN 720

Query: 721  FNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYH 780
            FNPDEIRQMLALENKEMDLNMITKILYDIKN                           YH
Sbjct: 721  FNPDEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYH 780

Query: 781  XXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQ 840
                         IGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQ
Sbjct: 781  KRKRELMKKRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQ 840

Query: 841  EEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSL 900
            EEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSL
Sbjct: 841  EEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSL 900

Query: 901  KQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKT 960
            KQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKT
Sbjct: 901  KQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKT 960

Query: 961  VTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRSSLFSSHDESFENS 1020
            VTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRSSLFSSHDESFENS
Sbjct: 961  VTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRSSLFSSHDESFENS 1020

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  524 bits (1349), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 445/1156 (38%), Positives = 594/1156 (51%), Gaps = 202/1156 (17%)

Query: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEE----ALTEAVDV--MAPPVIGNGFIFGNA 54
            M+S+ ++     K RKTTY K   +P+ +E+     LT+      + P ++G GF+F N+
Sbjct: 1    MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 55   LIDKIRNRLDGKE--NKEDTPVPT---QTQMIDNLY-----------KDAXXXXXXXXXX 98
             IDK+R RL GK    +E TP+ +   +TQ+I NLY           K            
Sbjct: 61   TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120

Query: 99   XXXAINKEQEV----------VQTQLIAXXXXXXXXXXX-----------PSDAY----- 132
                   EQE+          + TQ+I                       P D Y     
Sbjct: 121  TGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQLIPGDTYDRTST 180

Query: 133  LQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEKIPFTFTQKIQDFVE 192
            +Q+TQ    K+  +  N      +T +IN                 +PFTFTQKI++F  
Sbjct: 181  MQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGS------------VPFTFTQKIKNFET 228

Query: 193  TVENYSTDLS-LSKDETITINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVINNTNLD 251
             + N + D +  SK +T+ I+      DN  ++     S  LQ T               
Sbjct: 229  NITNENDDFTNGSKSQTVLIST---NVDNVRAEYVDASSSLLQAT--------------- 270

Query: 252  VIEATMAD-LPNLNEPQSTVAD---IPSTGLKIHEIQKELERER---NSKELKEYKKPSK 304
             I AT+ D  P+      TVAD      + L IH+ QKELE E    N+ + KEYK  SK
Sbjct: 271  AIAATVRDDGPSSTALVGTVADDKLSSGSNLAIHKFQKELEEEEQLANNSKYKEYKGISK 330

Query: 305  EIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRTXXXXXXXXXXXXXX-------- 356
             I    +KF+K S L GFDNSSS    E    +K T+                       
Sbjct: 331  PILTNIVKFTKDSFLQGFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTASS 390

Query: 357  ---------------XXLTGLNTYENXXXXXXXXXXHIQLDSDSDNDSDIAKRFPISRTS 401
                             L  L+ YEN           +QL SD ++  D     P+SRTS
Sbjct: 391  DGTTIKPKIKSPKKFSKLNTLSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTS 450

Query: 402  KATLLNLKARLSK---KKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKL 458
            KAT+L +KARLSK   KK V+ + + NT+L+ LF+NLK++SRKQIL++QREL+EN+G   
Sbjct: 451  KATILTIKARLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNF 510

Query: 459  EDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEKSLSENEDAD--------FDLSANELED 510
            ED                 RN++IR REK++E   +   D+D        FDLSANE E+
Sbjct: 511  EDIEMEKELVENLLEQEIKRNQKIRQREKEREDKKNNANDSDSVNDSDVEFDLSANEQEE 570

Query: 511  EEEDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEISDE 570
            +E D   +  +++   I          +        DE+G                I DE
Sbjct: 571  QESDA--ELSDVSKPDIDEEVVYQRRNI--------DEDG----------------IQDE 604

Query: 571  DE-DSIFQLTRKEKHPVRIIQES------------DDENEINKINTIDLGVYGGNLDNPN 617
            D  D++     +E+ P+++ + S            DDE+ I+K N IDLG YG NL   N
Sbjct: 605  DVLDNVDADEEEEEAPLQLSKRSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTTAN 664

Query: 618  PLSSQTEPNEDDEDEKSTYENK--EITEEERHALILAEKKRIQLIEKKNAARTKEMKKKG 675
              S   +  E D+D+    + +  E+TE+ER  +I AEK +I++ ++K   + KEM KKG
Sbjct: 665  VKSQDDDDLEVDDDKNENLDTQPLELTEQERIDIIEAEKTKIKMQQEKMRHKEKEMMKKG 724

Query: 676  VNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENK 735
            V K FEMEAEESEDEWHGIGG DGE+SDEYDS+VEKMIDDYSK+NF+P+EIR+MLA ENK
Sbjct: 725  VTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENK 784

Query: 736  EMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIG 795
            EMDLNMI KILYDIKN                           YH             +G
Sbjct: 785  EMDLNMINKILYDIKN-GGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELG 843

Query: 796  DD-KKLIKNPKSKAFFESMVEDIVDEKNAF-----GDIESIEKSSTELDTQEE-----KE 844
            DD KKL+KNPKSKAFFESMVEDI D+KNAF     G+  + E ++T+ D +EE     KE
Sbjct: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKE 903

Query: 845  QDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRS 904
               +  + KKK +ISEEFVQ+TLSFL+S R+ EEF + E+LAKEQHG  VE+L SLKQ+S
Sbjct: 904  NGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQS 963

Query: 905  TIKEFRNPSQTNT--IDL---INNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNK 959
            +IK F++PS  ++  I L    N+ ++ E SP+  FK PS++KSF S+TDINEKF+DGNK
Sbjct: 964  SIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKFQDGNK 1023

Query: 960  TVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRS------------ 1007
            TVTISK Y+TVGSSKASITYLGKSRKLM P          SK+KP RS            
Sbjct: 1024 TVTISKSYRTVGSSKASITYLGKSRKLMAPTH--------SKMKPLRSRVTDNNKITKGE 1075

Query: 1008 ----SLFSSHDESFEN 1019
                SLFS+ D+SFEN
Sbjct: 1076 RNIGSLFSTGDDSFEN 1091

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  441 bits (1135), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 409/1130 (36%), Positives = 553/1130 (48%), Gaps = 228/1130 (20%)

Query: 9    SLPKKQRKTTYKKIHEEPNNDEEALTEAV---DVMAPP-VIGNGFIFGNALIDKIRNRLD 64
            SL  K+R TTYKK+   P  DE   T      D+  PP + GNGF+F NA +++++NRL+
Sbjct: 10   SLTAKKRTTTYKKV-AVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATLNRVKNRLE 68

Query: 65   GK----------ENKEDTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXA-INKEQEVVQTQ 113
            GK          +++ +  +P  TQ+I NLY                +  N      QTQ
Sbjct: 69   GKKAPEQNHNNGKDRSENSLP--TQLISNLYDGGEELEKSEVKDNSYSEKNVSSSFTQTQ 126

Query: 114  LIAXXXXXXXXXXXPSDAY--LQETQPIEEKSFLLGTNKELE------------------ 153
             I            P  +    + TQ I+E   +  T++ L+                  
Sbjct: 127  RIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQRIDSSG 186

Query: 154  -TQETQVINPVLSESQ---PSENRSS--NEKIPFTFTQKI--QDFVETVENYSTDLSLSK 205
             T +TQ I  +  +SQ    S N S+  + KIP   T+ I      ++++N   D  +  
Sbjct: 187  ATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGPDTQM-- 244

Query: 206  DETITINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVINNTNLDVIEATMADLPNLNE 265
                  ++P     +    +A  I Q    T  +  TQ+      D +  T+ D      
Sbjct: 245  ------DVPPQTAHDEDKTQAIGIPQA---THQEQKTQI------DTVAQTLQD------ 283

Query: 266  PQSTVADIPSTGLKIHEIQKELERERNSKELK---EYKKPSKEIKVIPIK--FSKTSLLD 320
                  ++P T LKI EIQ EL  E + +E     EYKKP K    IP K  FSK S L 
Sbjct: 284  ------EVPHT-LKIREIQSELASEDSKREKARNVEYKKPQKP---IPTKKFFSKESFLA 333

Query: 321  G-------------FDNS-----SSDDELEVQKDMKITRTXXXXXXXXXXXXXXXXLTGL 362
                           +N+      +DDEL   K +++  T                +  L
Sbjct: 334  DFDDSSSNEDDDIKLENAHPKPVQNDDELHENKSVELNLT-------DETRINEKRVPLL 386

Query: 363  NTYENXXXXXXXXXXHIQLDSDSDND------------SDIAKRFPISRTSKATLLNLKA 410
            ++Y N           I LD DSD+D            S      PIS+ SKAT+LNLKA
Sbjct: 387  SSYANNLKREIDSSKCITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQLSKATILNLKA 446

Query: 411  RLSK---KKPVKSNKSTNTSLD--VLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXX 465
            RLSK   K   + NKS +  +D  VL   L++ASRKQILDHQ+E++E +G KLED     
Sbjct: 447  RLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEK 506

Query: 466  XXXXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSDNIANS 525
                        RNKRIR +EK++EK L EN   DF L+A++   +              
Sbjct: 507  EIVENLLEQEILRNKRIRQKEKRREK-LEEN---DFQLNAHDSGSDSG------------ 550

Query: 526  QIXXXXXXXXXXVLDNGNHVAD-----EEGDANREADNSSISSKNEISDEDEDSIFQLTR 580
                           +GN +AD      E D  RE+D          S++++D I    +
Sbjct: 551  -------SESSGFALSGNEIADYESSGSENDNRRESD----------SEKEDDEIILKQK 593

Query: 581  KEKHPVRIIQESDDENEIN------------KINTIDLGVYGGN-------------LDN 615
            K  H   II ESD + E+             K   I+LG YG N             LD 
Sbjct: 594  KSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDT 653

Query: 616  PNPLSSQTEPNE-DDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAARTKEMKKK 674
             N      E N  ++E +   Y N+E  E  R  LI  EK +++  EK++ A+ KE+KK+
Sbjct: 654  QNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKR 713

Query: 675  GVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALEN 734
            GV   FEMEAEESEDEWHGIGGADGE SD+YDS++EKMIDDYSK+NFNP EIR+MLA EN
Sbjct: 714  GVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAEN 773

Query: 735  KEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXI 794
            KEMD+ MI KILYDIKN                           Y              I
Sbjct: 774  KEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEI 833

Query: 795  GDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE----SIEKSSTELDTQEEKEQDVTPG 850
            GDD KL+KNPKS AFFESMVEDI++ KN FG  E     I  ++T+LDTQ   +  +  G
Sbjct: 834  GDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQ---DNSINVG 890

Query: 851  ----------VDK--KKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHG--ENVED 896
                      VD+  KK +ISE+FVQK+LSFL+S  + E+F  +++L++ QHG  E +ED
Sbjct: 891  DNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELSRIQHGNDEAIED 949

Query: 897  LFSLKQRSTIKEFRNPSQTN-----TIDLI----------NNVENVESSPLGGFKPPSVI 941
            L++LKQ S+IK F N SQT+     T++ I          + VEN ++S +G FK PS+I
Sbjct: 950  LYTLKQNSSIKSFTN-SQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSII 1008

Query: 942  KSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKK 991
            KSF+SRTDIN+KFK+GNKTV I K YKTVGSSKASITY+GK+RKL+ PK+
Sbjct: 1009 KSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKR 1058

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  397 bits (1020), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 286/666 (42%), Positives = 371/666 (55%), Gaps = 99/666 (14%)

Query: 395  FPISRTSKATLLNLKARLSKK------KPVKSNKSTNTSLDVLFQNLKQASRKQILDHQR 448
             PIS+ SKAT+LNLKARLSK+      +P++  +      + LF  L++ASRKQILDHQR
Sbjct: 447  LPISQLSKATILNLKARLSKQNQDISQRPLEG-RDARLDHNKLFNTLRKASRKQILDHQR 505

Query: 449  ELVENRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANEL 508
            E++E +GFKLED                 RNK+IR +EK++EK     E+++F LS ++ 
Sbjct: 506  EVIETKGFKLEDMVKEKELVENLLEQEIIRNKKIRQKEKRREKL----ENSEFKLSPHDS 561

Query: 509  EDEEEDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEIS 568
              +                             +GN V D E      +++      +   
Sbjct: 562  GSDSG-------------------SESSKFALSGNEVTDYELSG---SEDEIREEPDNEE 599

Query: 569  DEDEDSIFQLTRKEKHPVRIIQESDDENE----------INKINTIDLGVYGGNLDNP-N 617
            +E+ED I    +K  H  R+I ESD ENE          + K   I+LG YG N++   N
Sbjct: 600  EEEEDDIVPKKKKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVN 659

Query: 618  PLSSQTEPNEDDED----EKSTYENKEITEEE----------------RHALILAEKKRI 657
                  + N    D    E++  ENK I E+                 R  LI  EK ++
Sbjct: 660  KFQETNDMNTQQTDKITMERNIVENKAILEDTAVVDEDNINEEADEAIRRELIDKEKLQL 719

Query: 658  QLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYS 717
            +  E + A + KE+K KGV   FEMEAEES+DEWHGIGGADGE SDEYDS+VEKMIDDYS
Sbjct: 720  RQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYS 779

Query: 718  KSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXX 777
            K+NFN  EIR+MLA ENKEMD+ MI KILYDIKN                          
Sbjct: 780  KNNFNSHEIREMLAAENKEMDVKMINKILYDIKN-GGFRNKRAKNSLELELSDDEDDVLQ 838

Query: 778  XYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE----SIEKS 833
             Y              IGD  KL+KNPKSKAFFESMVEDI++ KN F   E     I  +
Sbjct: 839  QYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITST 898

Query: 834  STELDTQEEKEQDV---------TPGVDK-KKNVISEEFVQKTLSFLRSGRDLEEFNIEE 883
            +T+LDT +    +V          P  DK KK +ISE+FVQK+LSFL+S  +  EF +++
Sbjct: 899  ATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN-NYNEFEMDK 957

Query: 884  DLAKEQHG---ENVEDLFSLKQRSTIKEFRNPSQTNT---------IDL------INNVE 925
            +LAK QHG   E +EDLF+LKQ S+IK F N SQT++         IDL       + +E
Sbjct: 958  ELAKMQHGNDDEPIEDLFTLKQHSSIKSFTN-SQTDSFTSRTVTTMIDLEKRTEDEDEME 1016

Query: 926  NVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRK 985
            N +SS + GFK PS++KSF+SRTDIN+KFK+GNKTV ISK YK VGSSKASITY+GK+RK
Sbjct: 1017 NGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRK 1076

Query: 986  LMPPKK 991
            LM PK+
Sbjct: 1077 LMAPKR 1082

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 112/363 (30%), Positives = 166/363 (45%), Gaps = 46/363 (12%)

Query: 9   SLPKKQRKTTYKK--IHEEPNNDE-EALTEAVDVMAPPVI-GNGFIFGNALIDKIRNRLD 64
           SL  K+R TTYKK  IH   +ND  +      D++APP + GNGF+F NA +++++NRL+
Sbjct: 10  SLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANATLNRVKNRLE 69

Query: 65  G-------KENK--EDTPVPTQTQMIDNLYKDAXX-XXXXXXXXXXXAINKEQEVVQTQL 114
           G        +NK  ED  V + +Q+I NLY+                  N      QTQ 
Sbjct: 70  GGKAPEQEHDNKDDEDEDV-SSSQLIANLYEGGEDLEETKSNENDCTGKNCMPTFTQTQR 128

Query: 115 IAXXXXXXXXXXXPSDAYLQE--TQPIEEKSFLLGTNKELETQE--TQVINPVLSESQPS 170
           I            P  +  +E  TQ I++  F+   NK  + Q+  T  I PV ++   S
Sbjct: 129 IPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFV---NKIPQAQKLSTTTIKPVATQRIDS 185

Query: 171 EN--RSSNEKIPFTFTQKIQDFVETVENYSTDLSL--SKDETITIN-------LPNHATD 219
           ++    S + +P    + I+   +     S DL +  SK   +TI        L      
Sbjct: 186 DDIITQSQQALPI---KPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRGPV 242

Query: 220 NS--TSKRAHRISQELQRTMTDMDTQVINNTNLDVIEAT--MADLPNLNEPQSTVAD-IP 274
           N   T   +   + E Q  +   +TQ  N T +D I  T    D   ++    T+ D +P
Sbjct: 243 NQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDGVP 302

Query: 275 STGLKIHEIQKELERERNSKELK---EYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDEL 331
            T LKI EIQ EL  E + +E     EY KP K I    +KFSK S L  FD+SSS+++ 
Sbjct: 303 HT-LKIREIQNELALEDSRRERASNVEYTKPQKTI-ATKLKFSKESFLADFDDSSSNEDA 360

Query: 332 EVQ 334
           E++
Sbjct: 361 EIK 363

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  387 bits (993), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 312/805 (38%), Positives = 430/805 (53%), Gaps = 105/805 (13%)

Query: 268  STVADIPSTGLKIHEIQKELERERNSKELKEYKKPSKEIKVIPIKFSKTSLLDGFDNSSS 327
            +TV+D     LKIHEIQ+ELE  + +K + EYK+  +  K + I F+K S  D FD   S
Sbjct: 289  ATVSDT----LKIHEIQRELEESQKTKTIPEYKQHVRTPKNV-IVFTKESYFDEFD---S 340

Query: 328  DDEL---------EVQKDMKITRTXXXXXX---------XXXXXXXXXXLTGLNTYENXX 369
            DDE          + QK   +  T                         L GLN YE   
Sbjct: 341  DDEEKEENLESEGDSQKVQLLKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLNNYELKL 400

Query: 370  XXXXXXXXHIQLDSDSDNDSDI---AKRFPISRTSKATLLNLKARLSKKKP-VKSNKSTN 425
                     I L+ DSD++  I    ++ PIS+ SKAT+ ++KARLSKK+P VK +  + 
Sbjct: 401  KRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSK 460

Query: 426  TSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMR 485
            T+L  LF  L++ASR+QI++HQ+E++E +G  LED                 RNK+IR R
Sbjct: 461  TTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQR 520

Query: 486  EKQKEKSLSENED----ADFDLSANELEDEE---EDGVNDSDNIANSQIXXXXXXXXXXV 538
            EK++EK L++ +D     DFD SANEL++ E   E+   DSDN  +             V
Sbjct: 521  EKEREKQLADAQDDENDLDFDHSANELDESELSGEESAIDSDNDYDDFSLEKTKRSKKKV 580

Query: 539  LDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENEI 598
            +           D++ E ++  +S   +I +E +DS+FQ                     
Sbjct: 581  IVE---------DSDTEIEDEKMSHNAQIREEKDDSLFQ--------------------- 610

Query: 599  NKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQ 658
            N+ N I+LG YG NL +  P+   TE  +  ++ K + E+ +  +EE     + EK RI+
Sbjct: 611  NR-NAINLGPYGDNL-SLAPIRITTE-KQSGKNFKVSRESGDERDEE-----IPEKDRIR 662

Query: 659  LIE----------KKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSE 708
            LIE          +K   + KEMK KG+    E EAEESEDEWHGIGG DGE+SDEYDSE
Sbjct: 663  LIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSE 722

Query: 709  VEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXX 768
            VEKMIDDYSK+NFNPDEIRQMLA ENKE D+ M+ KILYDIKN                 
Sbjct: 723  VEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKN--GGFRKRRKGAMDLEL 780

Query: 769  XXXXXXXXXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE 828
                      Y              +G+ + L+KNPKSKAFFESMV+DIV+ KN F   E
Sbjct: 781  SDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFE 840

Query: 829  SIEKSSTELDTQEEKEQDVTPGVD----KKKNVISEEFVQKTLSFLRSGRDLEEFNIEED 884
                 +   D   ++  +   G       KK ++SEEFVQ+TLSFL S +D+++F     
Sbjct: 841  PQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARS 900

Query: 885  LAKEQHGENVEDLFSLKQRSTIKEFRNP----SQTNT-IDLINN--VENVESSPLGGFKP 937
            +  E + E +EDL +LK++S+IK F+      SQ  T  D  N+   +++ +S +G    
Sbjct: 901  MRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTDFDKENDDSFDDLLNSRVG---T 957

Query: 938  PSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREK 997
             S++K+FS+  DIN+KF++G KTV +SK YK+V SSKASITY+GK RKL+ P+K K    
Sbjct: 958  SSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQK-KVANL 1016

Query: 998  IGSKIKPTR---SSLFSSHDESFEN 1019
              S IK T    S LFS  DESFE+
Sbjct: 1017 SSSDIKNTNSRTSKLFSRQDESFES 1041

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 6/87 (6%)

Query: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60
          M+ IF      K +++TTYKKI ++  ND    T   +   P + G GF+F N  +++I+
Sbjct: 1  MDGIFGNLQALKPKKRTTYKKISDDLEND----TSESNNDPPALTGEGFLFDNPTLNRIK 56

Query: 61 NRLDGKENK--EDTPVPTQTQMIDNLY 85
           RLDG+E    + T   +QTQ+I NLY
Sbjct: 57 KRLDGEEKDVVQYTMNFSQTQLISNLY 83

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  379 bits (973), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 361/1079 (33%), Positives = 537/1079 (49%), Gaps = 156/1079 (14%)

Query: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60
            M+ +F+     K +++TTYKK+ +    DE  ++E    +  P +G   +F N+ + +IR
Sbjct: 1    MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFN--IELPGLGQSILFNNSKLKQIR 58

Query: 61   NRLDGKEN-KEDTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXAINKEQEVVQTQLIAXXX 119
            NRL+G  N  E+     +TQ+I                              TQ+I+   
Sbjct: 59   NRLEGNNNDSENDSSQAETQVI----------------------------ADTQIISNLY 90

Query: 120  XXXXXXXXPSDA-YLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEK 178
                      +  +LQ TQ +E+               TQ+I+  ++ S  +        
Sbjct: 91   EGGEDLEEKEERRFLQRTQIVED--------------HTQIIDASVTYSSKT-------- 128

Query: 179  IPFTFTQKIQDFVETVENYSTDLSLSKDET---ITINLPNHATDNSTSKRAHRISQELQR 235
            I        Q ++   ++  T + +SK +    IT NL +      T+     +  E Q 
Sbjct: 129  IESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKKVLDTTLETQEL--ETQY 186

Query: 236  TMTDMDTQVINNTNLD---VIEATMAD--LPNLNEPQSTVADIPSTG--LKIHEIQKELE 288
              T +D   ++ T +D   +    +AD  + + +    TV D   +   LKI+EI+++L+
Sbjct: 187  GKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINEIERQLD 246

Query: 289  RERNSKELK----EYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRTXX 344
             E    + K    EYK+    + +  +KFSK   L+ FD+SSS  E + +  +K++ T  
Sbjct: 247  EEDQILKEKSMGTEYKRNIAPV-MSKVKFSKNDFLEHFDSSSS--EEDEEGVVKLSSTEP 303

Query: 345  XXXXXXXXXX-----XXXXLTGLNTYENXXXXXXXXXXHIQLDSDSDNDSDIAKRFPISR 399
                                 GL+ YEN           I+  SDS++++++  +  +SR
Sbjct: 304  ETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCIEF-SDSEDETEVTSK--VSR 360

Query: 400  TSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLE 459
             SKAT+L++KA LS+ KP +S+ +   +L  LF +LK+A++ QILDH++E++E +G+K+E
Sbjct: 361  ASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKME 420

Query: 460  DXXXXXXXXXXXXXXXXXRNKRIRMREKQKE-----KSLSENEDA--DFDLSANELEDEE 512
            +                 RN++IR+REKQKE     K   EN D   DF +SANEL D E
Sbjct: 421  EIEKEKEIVENLLEQEIERNRKIRIREKQKEELKKRKQRIENGDQEEDFAISANELSDSE 480

Query: 513  -EDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHVADE-EGDANREADNSSISSKNEISDE 570
              +  ND + +++++            LD    +  E E DA+R+      S K+   D 
Sbjct: 481  VPESDNDGEVMSSNEEASDSDDELRTQLDASTGIEKETEQDASRD------SEKDSERDI 534

Query: 571  DEDSIFQLTRKEKHPVRIIQESDD-----ENEIN-------KINTIDLGVYGGNLDNPNP 618
            DE++I  +  ++   + ++ ESD      EN +         +NTI+LG YG NL   N 
Sbjct: 535  DEENILNIKNRKSKKIHVVSESDSDSDSGENSVQVEANHQPSLNTINLGHYGDNLSQEN- 593

Query: 619  LSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNK 678
                 E N  D DE    E++E+ +E    ++  E  R +  E+K   + +E+K KG+  
Sbjct: 594  ---NNERNNIDSDES---EDEELYKE----MVKKEIDRRRDQERKQRQKLRELKDKGITD 643

Query: 679  LFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMD 738
            +FE+EAEESEDEWHGIGG DGE+SDEYDSEVEKMIDDYSK NFN  EIR+ LA ENK+MD
Sbjct: 644  MFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMD 703

Query: 739  LNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIGDDK 798
            L M+ +IL DIKN                           Y                 +K
Sbjct: 704  LKMVNRILNDIKN---GGFRKRRNALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNK 760

Query: 799  KLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVD------ 852
            KL+ N KS AF ESMV+DIV+ KN F             D +++   D TP  D      
Sbjct: 761  KLMTNKKSHAFLESMVDDIVEVKNPF-------------DERDDNIMDDTPETDAEGDVN 807

Query: 853  -------KKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRST 905
                   KKK ++SE FVQK+LSFL S R+LEEF +  +LAKEQH     D+F+LK   +
Sbjct: 808  SNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCS 867

Query: 906  IKEF------RNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNK 959
            IK         N S ++ +DL++  E + S+P  G K  SVIKSFSS  DI+ KFKDGNK
Sbjct: 868  IKSLESLPGSHNNSISSKLDLLH--EEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNK 925

Query: 960  TVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRSSLFSSHDESFE 1018
            TV +SK Y+TVGS+KASITYLGK+RKL+PPKK +++         + S LF   D SFE
Sbjct: 926  TVKVSKSYRTVGSAKASITYLGKARKLVPPKKKEHKPHSHKSKTASASRLFDEQDNSFE 984

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  367 bits (943), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 356/1047 (34%), Positives = 535/1047 (51%), Gaps = 117/1047 (11%)

Query: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60
            M+S+ E+      +R+TTYKK+ E    +EE   +  +   PP++GNGF+F N+ IDK+R
Sbjct: 1    MDSLLEKLDPLSSKRRTTYKKVFEP--QEEEETQQISNSPPPPILGNGFLFQNSTIDKVR 58

Query: 61   NRLDGKENKEDTPVPT-------------QTQMIDNLYKDAXXXXXXXXXXXXXAINKEQ 107
            NRL   E+  +                  QTQ+I +LY+ A              ++K+ 
Sbjct: 59   NRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVRLPLSKKT 118

Query: 108  EVVQTQLIAXXXXXXXXXXXPSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSES 167
                                 S A  ++TQ I     + G    +E Q T  I+   ++ 
Sbjct: 119  ---------------------SSASQEKTQVIPWAPTVEGVENNVE-QGTD-IHEEKTQQ 155

Query: 168  QPSENRSSNEKIPFTFTQKIQDFVET-VENYSTDLSLSKDETITINLPNHATDNSTSKRA 226
             P+E  S ++K     TQ IQ F +T VE  +  +S   +   T+++P +A   +TS+  
Sbjct: 156  VPNE-ISYDQK-----TQAIQSFQQTEVEPLTQRIS---EPERTLDVPTYA---ATSE-- 201

Query: 227  HRISQELQRTMTDMDTQVINNTNLDVIEATMADLPNLNEPQSTVADIPSTGLKIHEIQKE 286
             ++  + Q  +T +D   I+N+ L   +AT +D+P            P   LK+H+I+KE
Sbjct: 202  DQLDTQEQNPITQLD---ISNSLL--FQATDSDIPK----------SPPQRLKMHDIEKE 246

Query: 287  LERERNSKELK---EYKKPSKEIKVIPIKFSKTSLLDGFDN-SSSDDEL-EVQ-KDMKIT 340
            LE +R  ++ +   EY+ P K + V  + FSK + L  FD  SSS+DEL E++ +D++  
Sbjct: 247  LEEKRQERDHRRNIEYRAPEKPVNVKRV-FSKEAFLKNFDEESSSEDELIELRSRDIEKK 305

Query: 341  RTXXXXXXXXXXXXXXXXLTGLNTYENXXXXXXXXXXHIQLDSDSDNDSDIAKRFPISRT 400
             T                    + YE            IQLD D D   +  +  P+SR 
Sbjct: 306  HTEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQLDDDEDESDEDVEV-PLSRV 364

Query: 401  SKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLED 460
            SKAT+L++KAR SK++P+   K   T+L+ L   LK+AS+KQI DHQ EL+++RG+KLED
Sbjct: 365  SKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLED 424

Query: 461  XXXXXXXXXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSD 520
                             RNKR+  RE +++ S             N+LED      N+S+
Sbjct: 425  IEKQKEEIENLLEQEIARNKRLARRENEEDNS-------------NDLEDRSYGSGNESE 471

Query: 521  NIANSQIXXXXXXXXXXVLDNGNHVADE--EGDANREA-DNSSISSKNEISDEDEDSIFQ 577
            N A S I            ++  +  DE  + +  +EA D+ +IS++ + SDE+++   Q
Sbjct: 472  NSAFSDIEFSGDSESDDGQEDDMNNDDERVQKEKMQEAGDSDNISAREDHSDEEDEDSIQ 531

Query: 578  LTRKEKHPVRIIQESDDENEIN-KINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTY 636
              R + H +   ++SD E++     N IDLG YG NL   +    +  P  D      + 
Sbjct: 532  KGRTKNHKMLPAEDSDSEHDDTLPRNIIDLGPYGNNLQVNHEEDMENLPLSD------SA 585

Query: 637  ENKEITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGG 696
            E     EE+ + LI+ + ++I++ +KK   R K+MK KG+NK+ EMEAEESEDEW G+GG
Sbjct: 586  EIDAAEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGG 645

Query: 697  ADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXX 756
             DG++SDE+DS++E+MIDD++KSN N D++RQ+LA ENKE+D  M+ KILYDIKN     
Sbjct: 646  VDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKN--GGF 703

Query: 757  XXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVED 816
                                  Y                D +K  +N KSKAF ESMV+D
Sbjct: 704  RKRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDD 763

Query: 817  IVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDL 876
            I + KN FGD E   + +T++DTQE    +  P  +K+KN +S+EFVQ++LSFL +    
Sbjct: 764  IDESKNPFGDPEMDVEDNTDVDTQE----NDYPK-NKEKNTLSQEFVQRSLSFLSNNNSS 818

Query: 877  EEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFK 936
             EF + E +     G+  +D+ SLK+ S+I    N S     DL    ++ +   L  FK
Sbjct: 819  REFELGEQIT---LGDEEQDVSSLKRNSSIHALHNSSSPIKEDLEKENQDEDFITLPNFK 875

Query: 937  PPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNRE 996
            PPS+IKS +   D N KF+ G KTVT+SK Y+ VG S++SITY GK RKL+ P   KNR 
Sbjct: 876  PPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGP---KNRN 932

Query: 997  KIGSK-----IKPTRSSLFSSHDESFE 1018
               SK      KPT   L+ S   SF+
Sbjct: 933  STLSKGPRPASKPTMGKLWESQQNSFD 959

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  353 bits (905), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 330/913 (36%), Positives = 477/913 (52%), Gaps = 95/913 (10%)

Query: 156  ETQVINPVLSESQPSENRSSNEKIPFTFTQKIQDFVETVENYSTDLS--LSKDETITIN- 212
            +TQ+IN +    +  EN   +    F  TQ I D +  +E  + D S    K + ITIN 
Sbjct: 98   QTQIINNLYDGGEDLENEIFHN--SFKKTQIITDNI-LIETNTNDKSTQYEKTQVITINE 154

Query: 213  -LPNHATDNSTSKRAHRISQELQRTMTDMDTQVINNTN--------LDVIEATMAD--LP 261
             L +   D   + +   + +  Q   +++ TQV+N  N           I AT A+    
Sbjct: 155  RLSDKPLDVVNNTQTVLVIENTQPLPSEIKTQVVNEVNSALPVTQPTQTIVATQANEVTY 214

Query: 262  NLNEPQSTVADIP--STGLKIHEIQKELERE-RNSKELK---EYKKPSKEIKVIPIKFSK 315
            +  E   TV D+   STGLKI +I+KELE E R +KE +   E+K    E K I  KFSK
Sbjct: 215  DTQELMPTVDDVAMRSTGLKITDIEKELEEEQRLAKETEFGTEFKFKESESK-ISKKFSK 273

Query: 316  TSLLDGFDNSSSDDELEV--QKDMKITRTXXXX-XXXXXXXXXXXXLTGLNTYENXXXXX 372
               L+ FD+SSS ++     +K   + ++                 + GL  YE+     
Sbjct: 274  EDFLNHFDDSSSSEDETSKNEKGPNVDKSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRK 333

Query: 373  XXXXXHIQL-DSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVL 431
                  I+  +SD D+D++I+  +     SKA +LN++A  SK++P  S KS  T+L +L
Sbjct: 334  ANNEQIIEFSESDEDSDTNISPSY----ASKAVILNIRANKSKQQPKVSQKSDQTTLLML 389

Query: 432  FQNLKQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEK 491
            + NLK+AS++QI+ +Q+EL+E +G  LE+                 RN++IR REKQK+K
Sbjct: 390  YNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQKIRQREKQKQK 449

Query: 492  SLSENED------ADFDLSANELEDEEEDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHV 545
               EN+D       +FDLSANELED +  G     + A S              +N    
Sbjct: 450  K--ENQDDLNSNPEEFDLSANELEDSDIPG----SDFAESN-------------NNSEKD 490

Query: 546  ADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESD--------DENE 597
             +EE +   E D    + K+ + +EDE   F + +++     I+ +SD        D  E
Sbjct: 491  DEEEENDEEEEDEQEDAPKSTVDEEDEG--FAIGKRKHKKTEIVDDSDSEIEAQIVDSKE 548

Query: 598  INKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRI 657
            I   NTIDLG YG N+             +   +  +  E  +  +EER+  I++E  R 
Sbjct: 549  IITANTIDLGHYGDNII------------QQSRETLNETEESDEEDEERYNAIISEGIRK 596

Query: 658  QL-IEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDY 716
            Q  +EK+ A R KEMK  GV+K+FE+EAEESEDEWHGIGG D + SD YDSEVEKMIDDY
Sbjct: 597  QKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDY 656

Query: 717  SKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXX 776
            S+ NFNP EIR+MLA ENKE DL ++ KILYDIKN                         
Sbjct: 657  SRQNFNPSEIREMLAKENKETDLALVNKILYDIKN--GGFRTRKRRDRDLEFSDDDDDDL 714

Query: 777  XXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIES-----IE 831
              Y              I  DKK++KNPKSKAFFES+V+DI++ KN F D+ +     +E
Sbjct: 715  KAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVE 774

Query: 832  KSSTELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHG 891
            K +  +D   +++        KKK VISEEFVQ++LSFL S R+ +EF I       +  
Sbjct: 775  KETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKA 834

Query: 892  ENVEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGG----FKPPSVIKSFSSR 947
             +  DL++LK+ S+IK  ++ + + +  + +N+    S   G      +  SV+ SFSS 
Sbjct: 835  TSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLRKTSVLNSFSSD 894

Query: 948  TDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNK--NREKIGSKIKPT 1005
             DIN KFK+G K+V +S  YKTVGS++ASITY+G SR+L+ PKK++     K  S+  P+
Sbjct: 895  VDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPS 954

Query: 1006 RSSLFSSHDESFE 1018
            R  LF + + SFE
Sbjct: 955  R--LFDNQEGSFE 965

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 60/110 (54%), Gaps = 29/110 (26%)

Query: 1   MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPV------IGNGFIFGNA 54
           M+S+F++ +  KK+R TTY KI   P++  E   E+ D++          +  G +FGN+
Sbjct: 1   MDSLFDQLNHFKKKR-TTYDKI---PHDLLEEEQESEDILKNKTAKEISQLDGGILFGNS 56

Query: 55  LIDKIRNRLD---------GKE---------NKED-TPVPTQTQMIDNLY 85
           ++ +IRNRL+         GKE         N++D T +  QTQ+I+NLY
Sbjct: 57  ILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLY 106

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  350 bits (897), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 342/1045 (32%), Positives = 509/1045 (48%), Gaps = 130/1045 (12%)

Query: 1    MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPP-VIGNGFIFGNALIDKI 59
            M+ +FE F    K+R+ TY+K  +   N+++  TE  D + PP V+GNGF+F ++ +DK+
Sbjct: 1    MDKLFESFDNAIKKRRATYQKAVQ---NEDDEYTE--DPLVPPAVLGNGFLFNSSTLDKV 55

Query: 60   RNRLDGKENKEDTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXAINKEQEVVQTQLIAXXX 119
            +NRL+ K+ ++ T     TQ++ NLY+D               +  + + + T LI    
Sbjct: 56   KNRLN-KDQEQGTQAIDTTQVLSNLYEDG----EDLEKEVPSILQSKSKPIPTILI---- 106

Query: 120  XXXXXXXXPSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSEN--RSSNE 177
                    PS       QP  E     G           V  P+   S  ++N  R   E
Sbjct: 107  --------PSIEREILKQPFNENHNFTG-----------VTVPIAKSSAITKNLDREDLE 147

Query: 178  KIPFTFTQKIQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRISQELQRTM 237
                  TQ I DF  +     T +  +  ET        A D  T   A  I+ E   T 
Sbjct: 148  SPEIPETQPIPDFSASDVPTQTQVLKTTSET--------AADTGTVATAA-IAYEESLTQ 198

Query: 238  TDMDTQVI---NNTNLDVIEATMADLPNLNEPQSTVADIPSTGLKIHEIQKELERERNSK 294
             ++  Q      N+  D+I+ T AD             +P T LKIHEI++   RE  + 
Sbjct: 199  VEVSEQTYPDQRNSQEDIIQQTAADA------------VPITRLKIHEIEEMWSREVQT- 245

Query: 295  ELKEYKKPSKEIKVIPIK-FSKTSLLDGFDNSSSDDELEVQKDMKITR-------TXXXX 346
            E KE+K   +  +  P+K F+K + +  FD SS  D     +++K T        +    
Sbjct: 246  ETKEHKVKYRAPR--PLKVFTKEAFMQDFDKSSDSDSDVFDQEIKATSPIGRNNDSISEV 303

Query: 347  XXXXXXXXXXXXLTGLNTYENXXXXXXXXXXHIQLDSDSDNDSDIAKRFPISRTSKATLL 406
                           L  Y+            + L S+SD++ D+A     S  +KAT+L
Sbjct: 304  GTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLA--VSTSHEAKATVL 361

Query: 407  NLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXXX 466
             LKARLSK++P   ++    SL  L +NL+ ++++QILD Q+E +E +G K ED      
Sbjct: 362  KLKARLSKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKE 421

Query: 467  XXXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEED-GVNDSDNIANS 525
                       RNKRIRM+EK+K +    N+     L     ED + +  V+D D++   
Sbjct: 422  IVENLLEQEIARNKRIRMKEKEKAQM---NDVPSLALPNRVEEDNDSNYSVSDEDSVIKE 478

Query: 526  QIXXXXXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHP 585
                         LD  +  +D+ G  + E   +S S+  EI D DED I +  + + H 
Sbjct: 479  D------------LDYSDLESDDSG--SNEPKIASDSAGVEI-DSDEDDI-RFMKGKAHK 522

Query: 586  VRII--QESDDENEINKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITE 643
            + ++   ES++E ++   + I+LG YG NL     +++  +      +E +T    EI+E
Sbjct: 523  ISLLNDDESEEEEDLTVNSAINLGAYGDNL-----ITTTKDEAHTSAEEHTTQLVNEISE 577

Query: 644  EERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSD 703
             + +  +  EK +I+  E+K   R K+MK+ GV  +F+MEAEES+DEW G+GG DGE  D
Sbjct: 578  SQ-YRTMEKEKSKIRAQEEKQ--RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETID 634

Query: 704  EYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXX 763
            +YDS++EKMIDD+S +  N D+IRQ+L  ENKE DL  + KIL+DIKN            
Sbjct: 635  DYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKN--GGFRKRRQNN 692

Query: 764  XXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIG-DDKKLIKNPKSKAFFESMVEDIVDEKN 822
                           Y               G DDKKL+KN +SKAFFESMVEDI+D K+
Sbjct: 693  LQLELSDDEDDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKD 752

Query: 823  AFGDIESIEKSSTELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIE 882
             F +         E   +++K + +    +K+K+ IS EFVQ++LSFL S RD  EF + 
Sbjct: 753  PFSN-------QAETSEKDKKSEGLVDASNKQKDTISHEFVQQSLSFLSSSRDFSEFEVA 805

Query: 883  EDLAKEQHGENVEDLFSLKQRSTIKEFRNPS-------QTNTIDLINNVENVESSPLGGF 935
                  Q GE   DL SLKQ ST+K    PS       + +  +  N+V  VESS     
Sbjct: 806  R---VSQEGERNTDLNSLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESS----- 857

Query: 936  KPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNR 995
               SV+KSF    + N+K K+G KTVT+SK Y+TVG +KASITYLGK RKL+ PKK+   
Sbjct: 858  -YSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAE 916

Query: 996  EKIGSKIKPTRSS-LFSSHDESFEN 1019
             +  SK+    +S +F + + SFEN
Sbjct: 917  VRTTSKLSTLGNSKIFRNFESSFEN 941

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  338 bits (866), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 328/957 (34%), Positives = 477/957 (49%), Gaps = 166/957 (17%)

Query: 128  PSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSE-----NRSSNEKIPFT 182
            P+     ETQP +    ++ TN     Q TQ+I+P   ++QP++     + S+ + IP  
Sbjct: 295  PAQIIDAETQPTQ----IIDTN----AQPTQIIDP---DTQPTQLINYSHESNGKHIP-- 341

Query: 183  FTQKIQDFVETVENYSTDLSLSKDETITINLPNH--ATDNSTSKRAHRISQELQRTMTDM 240
             T    D +      ST  SL     + +N+P H  AT  +TS   H+            
Sbjct: 342  -TLPAPDAL-----LSTGTSL-----LGLNIPLHRYATAGTTSNPKHK-----------N 379

Query: 241  DTQVINNTNLDVIEATMADLPNLNEPQSTVADIPSTG---LKIHEIQKELERE------R 291
            D+Q I   N+    ATM D     E Q TVAD   +G   LKIHEIQ +++ E      R
Sbjct: 380  DSQHIIEDNI----ATMRDRLETQEFQPTVADDVKSGGNTLKIHEIQTQIDEETRNMLNR 435

Query: 292  NSKELKEYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQKDMKITRTXXXXXXXXX 351
              +  K    PS+    + ++F+K S +  F+ S S  ++E   D +I  T         
Sbjct: 436  GVEHRKSRGVPSR----VEVRFTKESFMADFEESDSASDMESDSD-QINDTTPETGSSQN 490

Query: 352  XXX----------XXXXLTGLNTYENXXXXXXXXXXHIQLDSDSDNDSD--IAKRFPISR 399
                             +TGL++YE            + L SD    S+    K   +S+
Sbjct: 491  SDSNKARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQ 550

Query: 400  TSKATLLNLKARLSKKKPVKSNKSTN-TSLDVLFQNLKQASRKQILDHQRELVENRGFKL 458
             SKA +LN+KA+  KKK +    +TN T+LD LF +LK+ +R+QIL HQ E++  +G   
Sbjct: 551  ASKAAVLNIKAKALKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINH 610

Query: 459  EDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANELE---DEEEDG 515
            +D                 RNKR+R RE+++E+   E  D D + SANELE   D + D 
Sbjct: 611  KDLEREKEIVEDLLEQEILRNKRLREREREREQKEEEQSDMDNNYSANELESFDDSDHDS 670

Query: 516  VNDSDNIANSQIXXXXXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSI 575
            +N+                            DE    +    ++ + S+    DE+E + 
Sbjct: 671  LNE----------------------------DEPNINDDNNSSNGVDSE----DEEEFAA 698

Query: 576  FQLTR-KEKHPVRIIQESDDENE--------------------INKINTIDLGVYGGNLD 614
            FQ+ + K++  ++I  ESD E E                    +N IN IDLG YG NL+
Sbjct: 699  FQVLKGKKRKNMQIQPESDSEEETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLE 758

Query: 615  NPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLI--EKKNAARTKEMK 672
                L+     N +  D K   + KE      HA  + +K+R++ I  EKK   +  E+K
Sbjct: 759  IRAELN-----NTEKLDTKCMLDEKE------HARAV-DKERLKTIMKEKKLMLKRAELK 806

Query: 673  KKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLAL 732
            +KGV+  FE EAEESEDEWHGIGG DGEVSDEYDSEVEKMIDDYS+++ +P+EIR++L  
Sbjct: 807  EKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVS 866

Query: 733  ENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXX 792
            ENKEMD+ M+ KIL+DIKN                           Y             
Sbjct: 867  ENKEMDVKMVNKILFDIKN--GNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLL 924

Query: 793  XIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDI------------ESIEKSSTELDTQ 840
             +GDDKKL+KN K+KAFF+S+VEDIV+ KN FG +                ++   +  +
Sbjct: 925  DLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNK 984

Query: 841  EEKEQDVTPGVDK-KKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFS 899
            EEK     P  +K KK V+SEEFVQ++LSFL S R+L EF   +DLA+ QH ++V DL++
Sbjct: 985  EEK-----PTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYT 1039

Query: 900  LKQRSTIKEFRNPSQTNTIDLINNVENVESS-PLGGFKPPSVIKSFSSRTDINEKFKDGN 958
            LK++S++K F++    N I  ++  +N  ++     F+PPS+IKSF+S+ ++++KF++G 
Sbjct: 1040 LKKQSSVKSFKSVGSKNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGK 1099

Query: 959  KTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGS--KIKPTRSSLFSSH 1013
            KTV   K YK VG SK S+TY+ K RKL  PK  K     G   KI    S  F S+
Sbjct: 1100 KTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTGGERKISAQTSHSFKSN 1156

 Score = 62.0 bits (149), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 14/96 (14%)

Query: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60
          M+ + E F+  K +R+TTYKK+ +  N+ +EA  +  D +   + GNGF+FGNA +DKI+
Sbjct: 1  MDDLLERFNSVKVKRRTTYKKVQQ--NSTDEAAGDD-DCVPTSLAGNGFLFGNATVDKIK 57

Query: 61 NRLDG-----------KENKEDTPVPTQTQMIDNLY 85
          NRL+            K + ED    +Q+Q++  LY
Sbjct: 58 NRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLY 93

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  323 bits (829), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 230/506 (45%), Positives = 290/506 (57%), Gaps = 68/506 (13%)

Query: 580  RKEKHPVRIIQESDDENEIN-------------KINTIDLGVYGGNLDN--PNPLSSQTE 624
            +K  H   +I ESD E E               K N IDLG YG N+D    N     T 
Sbjct: 649  KKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATT 708

Query: 625  PNEDDED----------------EKSTYENKEITEEERHALILAEKKRIQLIEKKNAART 668
             N    D                 ++   ++E++E  R  LI  +K +++  EKK+ A  
Sbjct: 709  LNTQKIDNIIIKTHTIENREEEEVENDSIDEEVSEAIRRELIDKKKSQLRQKEKKHVAEL 768

Query: 669  KEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQ 728
            KE K KG+   FEMEAEESEDEWHG+GGADGE S+EYDSEVEKMIDDYSK++FN  EIR+
Sbjct: 769  KEFKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIRE 828

Query: 729  MLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXX 788
            MLA ENKEMD+ MI +ILYDIKN                           Y         
Sbjct: 829  MLAAENKEMDVKMINRILYDIKN-GGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMR 887

Query: 789  XXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE----SIEKSSTELDTQEEKE 844
                 IGDD KL+KNPKSKAFFESMVEDI++ KN F   E     +  ++T+LDTQ+   
Sbjct: 888  KRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDS 947

Query: 845  QDVTPG--------VD--KKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQH---G 891
              +           VD   KK +ISE+FVQK+LSFLRS  + +EF ++++ A+ QH    
Sbjct: 948  IQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEFEMDKERARIQHDIGD 1006

Query: 892  ENVEDLFSLKQRSTIKEFRN-PSQT-------NTIDL------INNVENVESSPLGGFKP 937
            E VEDLF+LKQ S+IK F N P+ +       + IDL       N VEN + S +GGFK 
Sbjct: 1007 EGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKH 1066

Query: 938  PSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNRE- 996
            PS+IKSF+SRTDIN+KFK+GNKTV ISK YKTVGSSKASITY+GK+RKLM PKK  +R+ 
Sbjct: 1067 PSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDH 1126

Query: 997  ---KIGSKIKPTRSSLFSSHDESFEN 1019
                     K  +S LF S  +SF++
Sbjct: 1127 HHNHHSKAWKTQKSKLFESGQDSFDS 1152

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 100/371 (26%), Positives = 164/371 (44%), Gaps = 58/371 (15%)

Query: 1   MESIFEEFS-LPKKQRKTTYKKIHEE-PNNDEEALTEAV--DVMAPPVI-GNGFIFGNAL 55
           M+++ E  S L  K+R TTYKKI    P+ D++   + +  ++ APP + GNGF+FGNA 
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 56  IDKIRNRLDG----------KENKEDTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXAI-N 104
           +++++NRL+G          K+N+ +  V   TQ+I NLY                ++ +
Sbjct: 116 LNRVKNRLEGIDVPEDDRQIKDNENEDAV--STQLIANLYDGGEDLEETKSMGDNASLKD 173

Query: 105 KEQEVVQTQLIAXXXXXXXXXXXPSDAYLQ--ETQPIEEKSFLLGTNKELETQE----TQ 158
                 QTQ I            P  +  Q    + I +  F    +   +TQ+    T 
Sbjct: 174 GIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFF---STAAQTQKIIPATA 230

Query: 159 VINPVLSESQPSENRSS-NEKIPFTFTQKIQDFVETVENYSTDLS--------LSKDETI 209
            I PV ++   S + +S  +++P  FT+ I+   + +   + D          L+ + ++
Sbjct: 231 RIIPVATQRIHSRDTASQTQQVP--FTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASL 288

Query: 210 TINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVINN---TNLDVIEATMADLPNLNEP 266
                             +I  +  +T  D  TQ  ++   T +D +  T+ D       
Sbjct: 289 LFQTTPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHD------- 341

Query: 267 QSTVADIPSTGLKIHEIQKELERERNSKELK---EYKKPSKEIKVIPIKFSKTSLLDGFD 323
                D+  T LKI E+Q EL  E + +E     EYKK  + I  + I FSK S L  FD
Sbjct: 342 -----DVSHT-LKIRELQSELALEDSKREKARNVEYKKSRRNIPTM-INFSKESFLADFD 394

Query: 324 NSSSDDELEVQ 334
           NSSSD+  +VQ
Sbjct: 395 NSSSDEGTDVQ 405

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  321 bits (823), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 208/414 (50%), Positives = 258/414 (62%), Gaps = 39/414 (9%)

Query: 641  ITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGE 700
            ++E  R  LI  EK   +  EK+ A + KE+K KGV   FEMEAEESEDEWHG+GGADGE
Sbjct: 729  VSEAIRRELIDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGE 788

Query: 701  VSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXX 760
             SDEYDSEVEKMIDDYSK+ FN  EIR+MLA ENKEMD+ MI KILYDIKN         
Sbjct: 789  GSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKN-GGFRNKRA 847

Query: 761  XXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDE 820
                              Y              IGDD KL+KNPKSKAFFESMVEDI++ 
Sbjct: 848  KNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEF 907

Query: 821  KNAFG----DIESIEKSSTELDTQE-----------EKEQDVTPGVDKKKNVISEEFVQK 865
            KN FG      + +  ++T+LDTQ+             E +   G   KK +ISE+FVQK
Sbjct: 908  KNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQK 967

Query: 866  TLSFLRSGRDLEEFNIEEDLAKEQHGE---NVEDLFSLKQRSTIKEFRNPSQTNTID--L 920
            +LSFL+S  + +EF ++ +LA+ QHG    +V DLF+LKQ S+IK F N SQTN++    
Sbjct: 968  SLSFLKSN-NYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTN-SQTNSLSSRT 1025

Query: 921  INNV-------------ENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVY 967
            +N V             EN + S +GGFK PSVIKSF+SRTDIN+KFK+GNKTV ISK Y
Sbjct: 1026 MNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSY 1085

Query: 968  KTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPT---RSSLFSSHDESFE 1018
            KTVGSSKASITY+GK+RKLM PK+        + IK +   +S LF +  +SF+
Sbjct: 1086 KTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFD 1139

 Score =  137 bits (346), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 157/515 (30%), Positives = 221/515 (42%), Gaps = 100/515 (19%)

Query: 9   SLPKKQRKTTYKKIHEEPNNDEEALTEA---VDVM-APPVI-GNGFIFGNALIDKIRNRL 63
           SL  K+R TTYKK+   P  DE   T+    +D M APP + GNGF+FGNA +++++NRL
Sbjct: 53  SLTSKKRATTYKKV-ASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRL 111

Query: 64  DG----------KENKEDTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXAINKEQEVVQTQ 113
           +G          KEN ED  V + TQ+I NLY                         QTQ
Sbjct: 112 EGRNELGQDGQDKEN-EDEDVFS-TQLIANLYDGGEELESKSNGDKNNQKVNVSSFTQTQ 169

Query: 114 LIAXXXXXXXXXXXPSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENR 173
            I                 + E +P               TQ+ +    V++ SQ     
Sbjct: 170 RIPVSITQQNNEINVPIHSINEGEP---------------TQKAKNRGSVITTSQ----- 209

Query: 174 SSNEKIPFTFTQKIQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRISQEL 233
              + IPFT  Q  Q   + + N+    + S+ + I    P+ A   +    A+    + 
Sbjct: 210 --TQAIPFTTAQITQKTTQCLNNHG---ATSQTQQIPPTKPSEAQTQADVATANDSDTQQ 264

Query: 234 QRTMTDMDTQVINNTNLDVIEATMADLPNLNEPQSTVAD---------------IPSTGL 278
           +  M   +T  +  T  D   +T      +N P  TV D               +P T L
Sbjct: 265 KVPMLTTETSPLFQTVPDQSPSTQ-----MNTPPPTVHDDRTQMDTVAQTMQDKVPPT-L 318

Query: 279 KIHEIQKELERE---RNSKELKEYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQK 335
           KIHE+Q EL  E   R   +  EY+K  K I ++  +FSK S L  FDNSSSD++   + 
Sbjct: 319 KIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVK-RFSKESFLADFDNSSSDEDTNFKL 377

Query: 336 D-------------MKITRTXXXXXXXXXXXXXXXXLTGLNTYENXXXXXXXXXXHIQLD 382
           +             + I+++                L  L+TY N           I LD
Sbjct: 378 ESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPL--LSTYANNLKREIDSSKCITLD 435

Query: 383 ----SDSDNDSDI--------AKRFPISRTSKATLLNLKARLSKK-----KPVKSNKSTN 425
               SD DND+ +            PIS+ SKAT+ NLKARLSK+     +    NK   
Sbjct: 436 LDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFK 495

Query: 426 TSLDVLFQNLKQASRKQILDHQRELVENRGFKLED 460
           +  + L   L++ASRKQILDHQRE+VE +GFKLED
Sbjct: 496 SDHNKLINTLRKASRKQILDHQREIVETKGFKLED 530

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  296 bits (757), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 245/623 (39%), Positives = 340/623 (54%), Gaps = 36/623 (5%)

Query: 379  IQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQA 438
            +QL SDSD++ D A  + +S  SKATLLNLK RLSKKKPVK   +   S ++LF NL++A
Sbjct: 514  LQLSSDSDDEVDSAVIYKLSNKSKATLLNLKVRLSKKKPVKKVHNEKDSTNLLFNNLRKA 573

Query: 439  SRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEKS--LSEN 496
            +++QI+ H++EL+E+RG   ED                 RN +IR REK+KE +  L+E 
Sbjct: 574  TKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQ 633

Query: 497  E--DADFDLSANELEDEEEDGVNDSDNIANSQIXXXXXXXXXXV---LDNGNHVADEEGD 551
            E  ++D++ S +E +      +++SD + NS I          +   L N N    ++GD
Sbjct: 634  EIMESDYEYSGDESD------ISNSDIVDNSSISSQQINYTEEITYGLKNSNE--SDKGD 685

Query: 552  ANREADNSSISSK-NEISDEDEDSIFQLTRKEKHPVRIIQESDDENEINKINTI-DLGVY 609
             +    N  I  + + + DE +  I +  R  K P      SD E++    + I D    
Sbjct: 686  NSPAVINGPIELELDNVDDEGDIEIKRSHRTSKKPFLF---SDTESDFQNDDIITDASSS 742

Query: 610  GGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAARTK 669
               L  P   S +T P  +D D     +    TE+ER A I  + KR Q  E K   + +
Sbjct: 743  AERL--PIDESQETSPENEDHDSSEDID----TEQERIAAIKQQVKRQQEREVKERKKLQ 796

Query: 670  EMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQM 729
            E+  KGVN+ FE EAEES+DEW GIGG DG+   EYDSEVEKMIDDYSK+  +   +RQ 
Sbjct: 797  ELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQK 856

Query: 730  LALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXX 789
            +  ENKEMDL ++ KILYDIKN                           +          
Sbjct: 857  IMDENKEMDLKLVNKILYDIKN--GGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQ 914

Query: 790  XXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTP 849
                  D  KL KNPKSKAFFESM+ D+V++KN F D+    +   E  TQE+ E++   
Sbjct: 915  RMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEYNE 974

Query: 850  GVDKKKN--VISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIK 907
                K+    ISE+FVQKTLSFL +    +EF     ++KE+    + D+ +LK  S++ 
Sbjct: 975  AKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK---GIGDMNALKSNSSLS 1031

Query: 908  EFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVY 967
                 S +  I  IN+ E+V       FK PS+I+SFSS+  I++KFKDGNK+V +S  Y
Sbjct: 1032 FCSKLSTSRKI--INDEEDV-IEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSY 1088

Query: 968  KTVGSSKASITYLGKSRKLMPPK 990
            KTVG SKASITYLGK+RKL+PPK
Sbjct: 1089 KTVGGSKASITYLGKTRKLVPPK 1111

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  293 bits (750), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 266/722 (36%), Positives = 357/722 (49%), Gaps = 115/722 (15%)

Query: 362  LNTYENXXXXXXXXXXHIQLDSDSDND--SDIAKRFPISRTSKATLLNLKARLSKKKPVK 419
            L+ YEN           I L SDS+ +  SDI      S  SKA +L+++ +LSKKKP  
Sbjct: 580  LSQYENRLKENLLYNNSIDLYSDSEENTQSDIL----FSTASKAQILDIRHKLSKKKPQV 635

Query: 420  SNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRN 479
              K+  T+LD LF  LK+AS+KQI DHQ+  +E++G KLED                 RN
Sbjct: 636  KKKTIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLLEQEIERN 695

Query: 480  KRIRMREKQKE--------KSL-SENEDADFDLSANELEDEEEDGVNDSDNIANSQIXXX 530
            ++IR +E+++E        KS+ S +++ DFD SANELED      NDSD          
Sbjct: 696  RKIRAKERKRENKKNKVDDKSVQSASDEDDFDHSANELEDS---FYNDSD---------- 742

Query: 531  XXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQ 590
                                      +N  I    E   ED+ +IF   R +K    + +
Sbjct: 743  --------------------------ENKEIIEPEEEDSEDDINIF---RHKKGLKLVTE 773

Query: 591  ESDDEN----EINKI----NTIDLGVYGGNLDNPNPLSSQTEPN--EDDE----DEKSTY 636
            ESD EN    E  KI    N I+LG YG NLD+ + + ++      ED E    D  +  
Sbjct: 774  ESDSENDNPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADNSTEN 833

Query: 637  ENKEITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGG 696
             N E+ E E    I  E ++ +L E K  A+ +E+KK G +K+F+MEAEESEDEW GIGG
Sbjct: 834  SNNELNELEYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGG 893

Query: 697  ADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXX 756
            ADGEVSDEYDSEVEK+IDDYS+ +FNPDEIR  L  ENKEMD+ M+ +ILYDIKN     
Sbjct: 894  ADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKN--GGF 951

Query: 757  XXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVED 816
                                  Y              + +  K++K  KSKAFF SMV+D
Sbjct: 952  RKRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDD 1011

Query: 817  IVDEKNAF--------------------GDIESIEKSSTELDTQEEKEQDVTPGVDKKKN 856
            IV+  N F                     + +    +  +   +   +        +KK 
Sbjct: 1012 IVETSNPFMITQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKF 1071

Query: 857  VISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQ-- 914
            V+SE+FV KTLSFL   +++ EF    +  K Q G  + D+ SLKQ+S+IK     S   
Sbjct: 1072 VMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIG-TINDIQSLKQKSSIKTMHVLSMMS 1130

Query: 915  --TNT------------IDLINNVENVESSPLGGF-KPPSVIKSFSSRTDINEKFKDGNK 959
              TN             I    + +N    PL    K PS+IK F S  DIN+KFKDGNK
Sbjct: 1131 QDTNVDLDASDKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNK 1190

Query: 960  TVTISKVYKTVGSSKASITYLGKSRKLMPPKK---NKNREKIGSKIKPTRSSLFSSHDES 1016
            TVTIS  YKTVG  K SIT  G+ RKL+ P K   N N+ +I +    + S LF + D+S
Sbjct: 1191 TVTISNSYKTVGGMKTSITSFGR-RKLVAPVKTHNNFNKNRISNIKSSSNSKLFRNQDKS 1249

Query: 1017 FE 1018
            F+
Sbjct: 1250 FK 1251

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 12/97 (12%)

Query: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPV----IGNGFIFGNALI 56
          M+++F+     K +++TTYKK+ E+   +   L +A   ++ PV    +  GF+F N  +
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATE---LDKAATTISNPVPSFNLSEGFLFANDKL 59

Query: 57 DKIRNRLD--GKENKEDTP---VPTQTQMIDNLYKDA 88
          +KI+NRL+   K N   T    +PT      + YK++
Sbjct: 60 EKIKNRLNLGSKSNNTTTGNVDIPTNQNKFSDQYKNS 96

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  286 bits (733), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 187/394 (47%), Positives = 243/394 (61%), Gaps = 34/394 (8%)

Query: 650  ILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEV 709
            +LA +KR Q  E K   + KEMK+KGV+K+FEMEAEESEDEWHG+GGADGE+SDEYDSE+
Sbjct: 792  VLA-RKREQ--EHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSEL 848

Query: 710  EKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXX 769
            EKM+DDY+K+ F+P EIRQMLA E+KE D  ++ KIL+DIKN                  
Sbjct: 849  EKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDD 908

Query: 770  XXXXXXXXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIES 829
                     YH              G+  KL+ NPKS AFFESMVED+V+ KN F   E+
Sbjct: 909  EDDELQR--YHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGET 966

Query: 830  IEKSSTEL-------DTQEEKEQDVTPG----VDKKKNVISEEFVQKTLSFLRSGRDLE- 877
             +  S  +       +  E   Q    G     ++K+  IS+EFVQ++LSFL S  +L+ 
Sbjct: 967  ADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDN 1026

Query: 878  EFNIEEDLAKEQHG------ENVEDLFSLKQRSTIKEFRNPSQTN--TIDLINNVENVES 929
            EF ++  LAK QH       +++EDLF+LKQ S IK    P++T+  T+DL    E   +
Sbjct: 1027 EFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDL----EVDGN 1082

Query: 930  SPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPP 989
            SP  GFK PSVI SFSSR DINEKFK+G KTV +SK YKT+G S+ASITYLGK RKL  P
Sbjct: 1083 SPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAP 1142

Query: 990  KKNKNREK--IGSK---IKPTRSSLFSSHDESFE 1018
            K+ ++  K   G +     P R+ LF+ +D+SFE
Sbjct: 1143 KRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176

 Score =  104 bits (260), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 131/282 (46%), Gaps = 52/282 (18%)

Query: 362 LNTYENXXXXXXXXXXHIQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSN 421
           LN+Y+N          HI LDS SD D +     P S+ SKA +L +KAR SK++ +K  
Sbjct: 412 LNSYKNQLKARLDSKEHIDLDSSSDEDEN---SVPASKMSKAAVLEIKARTSKRQGIKKT 468

Query: 422 KSTNT-----SLDVLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXX 476
           +   +     SL  LF +LK+A++KQILDH+RE+ E RG  LED                
Sbjct: 469 RQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528

Query: 477 XRNKRIRMREKQKEKS--LSENED----ADFDLSANELEDEEEDGVNDSDNIANSQIXXX 530
            RN++IR+REKQ+EK   L E +D     DFD S NEL     DG  +S+  + S+    
Sbjct: 529 ERNRKIRLREKQREKKKELDEQQDGGYPGDFDYSENEL-----DGEPESEPASGSEDVPD 583

Query: 531 XXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQ 590
                  VLD                ++S   S+ +  D+++D    L + +K   RI  
Sbjct: 584 SDAPDSDVLD----------------EDSDDESREKDRDDEDDEAIVLPKSKKRAKRIAN 627

Query: 591 -------------ESDDE----NEINKINTIDLGVYGGNLDN 615
                         SD+E    N     N IDLG YGGNL N
Sbjct: 628 FGSGPGPDSDSDLGSDNEPISRNGPRPGNVIDLGAYGGNLAN 669

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 148/363 (40%), Gaps = 91/363 (25%)

Query: 13  KQRKTTYKKIHE----EPNNDEEALTEAVDVMAPPVIGNGFIFGNA-LIDKIRNRLDGKE 67
           K++KTTY K  E    +  NDEE          P +    F+FGN+ ++DK+++RL+G  
Sbjct: 14  KKKKTTYVKDIEVYATQEENDEEK-------KQPQLSSASFLFGNSTIVDKVKSRLNGVS 66

Query: 68  NKE-----DTPVPTQTQMIDNLYKDAXXXXXXXXXXXXXAINKEQEVVQTQLIAXXXXXX 122
           N+E        +P QTQ+I N Y                  + EQ+ V            
Sbjct: 67  NEETDGERGDALP-QTQVIPNYY---------------DGEDLEQDFVSPPKPRRVSNTG 110

Query: 123 XXXXXPSDAYLQETQPIEEKSFLLGTNKELETQETQVINPVLSESQPSENRSSNEKIPFT 182
                  D+        EE++ L+ T +E    E+QV+ PV++  Q SE       IP +
Sbjct: 111 HGQDCDCDS--------EEQTQLMPT-QETGAYESQVV-PVIAPVQVSET------IPVS 154

Query: 183 FTQKIQDFVETVENYSTDLSLSKDETITINL--PNHATDNSTSKRAHRISQELQ-RTMTD 239
               +    E++   S D         T NL  P +          ++ SQ++Q  T   
Sbjct: 155 INDGL--LGESLFKTSKDEVKGNGGNTTRNLAEPCYGLTQIIPSPQYKNSQQMQLETQEA 212

Query: 240 MDTQVINNTNLDVIEATMADLPNLNEP---QSTVAD------------IPSTG------- 277
            +TQ ++ T   ++EAT  D P L+E     +TVAD            +P T        
Sbjct: 213 GETQEVDKTQR-ILEATARD-PTLSEEDFVAATVADGSEAVTTQLDTCVPDTSALGDVQP 270

Query: 278 -------------LKIHEIQKELERERNSKELKEYKKPSKEIKVIPIKFSKTSLLDGFDN 324
                        L IHEI+K+L+ E   ++     KP   + V+  KF K + L+ FD 
Sbjct: 271 TAPDQSAHRNSQRLLIHEIEKDLDAEEEREKRITEAKPHDVVLVVKKKFDKEAFLNNFDC 330

Query: 325 SSS 327
           SSS
Sbjct: 331 SSS 333

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  265 bits (678), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 239/698 (34%), Positives = 337/698 (48%), Gaps = 116/698 (16%)

Query: 379  IQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSN--KSTNT-SLDVLFQNL 435
            I LDS SD +   + +F  S   KA LLN+KA++SK   +  N  +S N+ +L  LF +L
Sbjct: 421  IILDSSSDEEH-ASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISL 479

Query: 436  KQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEKSLS- 494
            K+A++KQILDH+RE+ E RG  LE                  RN+RIR+REK+KE  L  
Sbjct: 480  KKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENELRL 539

Query: 495  ENED------ADFDLSANELEDEEEDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHVADE 548
              ED         D  AN  E  E D   +SD+I   +            +D    V+D 
Sbjct: 540  RYEDINNCSTGSSDGDANS-EIPESDTSEESDDIEVDETNLLADDDEYSDID----VSDI 594

Query: 549  EGDANREADNSSISSKNEISDE----------------DEDSIFQLTRKEKHPVRIIQES 592
            +   N+  + ++ + K EI++E                +ED I  + R   H  R+ +  
Sbjct: 595  QNSCNKNIEWTANNKKQEIANEVTEEEEEEEEEEEEEEEEDKII-VNRHYHHKFRLAENR 653

Query: 593  DDENEINKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEI----------T 642
               ++  K NTIDLG YG NL+    L +   PN    DE  TY  K+           T
Sbjct: 654  FHTSKAPK-NTIDLGAYGDNLN----LGNAGLPN---NDEYLTYRIKKFEGLSPSKSATT 705

Query: 643  EEERHALILAEKKRIQLI------------------------------------------ 660
            E +  + + AE   ++ I                                          
Sbjct: 706  ELDVKSDLAAESSILETIKDGNWRLKKSGEIETGEEEEPKEEGEEEKRKIVKELMLKLRL 765

Query: 661  -EKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKS 719
             EK    + KEM+K GVNK+ E+EA+ESEDEWHG+GG D E SDEYDS+++KMIDDY+K+
Sbjct: 766  QEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKN 825

Query: 720  NFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXY 779
             F+P EIR++LA E+ + D NM+ KIL+DIK                            Y
Sbjct: 826  EFDPVEIRKILASEDLQHDKNMVNKILHDIK--TGGFRKRGRGELDLELSEDEDGILQSY 883

Query: 780  HXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDI-VDEKNAFGDIESIEKSSTELD 838
                             +  +  NPKS  FFESMV++  +  + A G  +S    ST + 
Sbjct: 884  RAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQSTNV- 942

Query: 839  TQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAK-----EQHGEN 893
               E +Q+      K+K VISE FV++TLSFL S  ++     E ++ K     + +   
Sbjct: 943  --LELKQNT-----KQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSE 995

Query: 894  VEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEK 953
            VEDL++LK+ STIK        NT      V   E     GFK PSV+++F SR D+N+K
Sbjct: 996  VEDLYTLKETSTIKVL------NTYSGKPIVNEDEDGAEFGFKAPSVMQTFGSRNDVNDK 1049

Query: 954  FKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKK 991
            FKDG K+V IS  YKT+GSS+A+IT+LGK RKL+ PK+
Sbjct: 1050 FKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKR 1087

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 11/80 (13%)

Query: 10 LP-KKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIRNRLDG--- 65
          LP K +RKTTYK  HE+ + +   +     ++ P    N  +F NA++DK+RNRL+G   
Sbjct: 7  LPGKARRKTTYKIEHEKLSQEAGYI-----IIKPSNAEN--VFANAIVDKVRNRLEGTIS 59

Query: 66 KENKEDTPVPTQTQMIDNLY 85
            ++ DT     ++ + NLY
Sbjct: 60 SPDRLDTLSSKLSETVGNLY 79

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  249 bits (636), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 223/660 (33%), Positives = 326/660 (49%), Gaps = 68/660 (10%)

Query: 402  KATLLNLKARLSKKK-----PVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGF 456
            KA +L+LKARLSKK      P     S  +S  +LF +L++A++ QILD+++E  +++G 
Sbjct: 360  KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 457  KLEDXXXXXXXXXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEEDGV 516
              +                  RNK+IR+RE ++E+   +NE  DF   ++       D  
Sbjct: 420  DYDKITEEKNSIESLLERELARNKKIRLREIEQER---QNERKDFGEQSSAF-----DYS 471

Query: 517  NDSDNIANSQIXXXXXXXXXXV-LDNGNHVADE--EGDANREADNSSISSKNEISDEDED 573
            ND      S            V L +G   AD+  E  ANR  D       NE    +ED
Sbjct: 472  NDELEEEPSDEEIDENQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNE----EED 527

Query: 574  SIFQLT-RKEKHPVRIIQESDDENEINKINTIDLGVYGGNLDNPNPLSSQTEPNED---- 628
            +I +   RK K    I  + +D + +N  N IDLG YG N+ N N +  Q +  E     
Sbjct: 528  AIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIE-QEQVGEHVGAH 586

Query: 629  -DEDEKSTYENKEI-----------TEEERH-----ALI--LAEK-KRIQLIEKKNAART 668
             + D  +T  NK +            E+  H      +I  L EK KR +L+ +   A+ 
Sbjct: 587  IENDLTTTGRNKNLIKPSSRSSSFQVEDNSHEDMNPGVIRELIEKHKRKELLRE---AKL 643

Query: 669  KEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQ 728
            +++ +   +++ + EAEES+DEWHGIGG DGE  D++DS++EKMIDDYS S F+  E+R+
Sbjct: 644  EKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRK 703

Query: 729  MLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXYHXXXXXXXX 788
                E    D +M+ KIL+DI+                            YH        
Sbjct: 704  RQIEEEISEDKSMVNKILHDIE--TGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLR 761

Query: 789  XXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVT 848
                  G+ K L +NPKSKAFFE++VEDI  +     +     +  + ++  EEK  D  
Sbjct: 762  QKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSD-- 819

Query: 849  PGVDK--KKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAK------EQHGENVEDLFSL 900
               DK  KK V+SE FVQ+TLSFL SG   EE   E +L          + E  +D+F+L
Sbjct: 820  --SDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFAL 877

Query: 901  KQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKT 960
            KQ S+IK    P++ ++  LI++ E++    L   +  S    F+ R D NEKF++G KT
Sbjct: 878  KQNSSIKSLSAPTRNSSNMLIDDQEDL----LSRKRACSFFARFTKRVDANEKFEEGKKT 933

Query: 961  VTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRS-SLFSSHDESFEN 1019
            V     YK  GSSKASITYLGK+RKL  PKK  +++      KP     +F+S+ ESFE+
Sbjct: 934  VRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSESFES 993

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 10/54 (18%)

Query: 42 PPVIGNGFIFGNALIDKIRNRLDGKENKE--DTPVP--------TQTQMIDNLY 85
          P V G GF+FGN+++ ++++RL   EN E   T  P        +QTQ++   Y
Sbjct: 29 PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY 82

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  232 bits (592), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 230/678 (33%), Positives = 332/678 (48%), Gaps = 114/678 (16%)

Query: 379  IQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKS---NKSTNTSLDVLFQNL 435
            I+L+S S+++ D       S++SKA LL +KA+ S+ K  K+   + ST  SL  LF +L
Sbjct: 322  IELNSSSESEDDYK-----SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSL 376

Query: 436  KQASRKQILDHQRELVENRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMREK-QKEKSLS 494
            K  +R QIL+ +RE+   +G  LE                  RN+R+++REK ++EKS  
Sbjct: 377  KTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQELERNRRVKLREKREREKS-- 434

Query: 495  ENEDADFDLSANELEDEEEDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHVADEEGDANR 554
              +D     S+    D     V DSD +  S +          +  +G+  +DE+     
Sbjct: 435  --KDTSKAASSGSASD-----VPDSD-VMESDLSLSDSDVEQHLGLHGSTGSDEDS---- 482

Query: 555  EADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENEINKIN----TIDLGVYG 610
             AD S+                    K  +P+    ES   ++ N++      I+LG YG
Sbjct: 483  -ADTSA------------------AHKNNNPIIDDDESSSSSDDNEVTQEPIGINLGHYG 523

Query: 611  GNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALIL------------------- 651
             NL + N     TE +  D+ +++   N E+     H+  L                   
Sbjct: 524  DNLTSSNV----TENDGADQSDRNVPSNSELKMNRSHSAKLLVGELSSDSSVDSDSSEDE 579

Query: 652  ---AEKKRIQ-------LIEKKNAARTKE-MKKKGVNKLFEMEAEESEDEWHGIGGADGE 700
                E+ R+Q        +E + A + K+ +K  G+NK+ EMEAEESEDEWHG+GGADGE
Sbjct: 580  LDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGE 639

Query: 701  VSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXX 760
             SD+YDS+++ MIDD+SKS F+   IR+ LALENKEMD  MI KIL+DI           
Sbjct: 640  NSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRG 699

Query: 761  XXXXXXXXXXXXXXXXXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDE 820
                                              G    ++ N KSKAFF+SMVEDI   
Sbjct: 700  ALDLELSDDEDELLRQFREKRREIMKQKLLENVDG----VVNNSKSKAFFDSMVEDITR- 754

Query: 821  KNAFGDIESIEKSSTELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRS-GRDLEEF 879
                   +SI   ++  +T++E        + KKK VISEEFVQ +LSFL +   D+ EF
Sbjct: 755  -------KSIPAVTSFSNTRDE--------MGKKKIVISEEFVQSSLSFLSAKDDDINEF 799

Query: 880  NIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPS 939
             +      E   +  EDL SLKQRS IK   +P +       ++V+         FK PS
Sbjct: 800  EV-----TEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSLD----FKLPS 850

Query: 940  VIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIG 999
            ++KSFSS +D+N+KFK G KTVTISK Y+    S+++IT+LGK RKL  P+  K+   + 
Sbjct: 851  IVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVR 910

Query: 1000 SKIKPTRSSLFSSHDESF 1017
               KPT SSLF S+ +SF
Sbjct: 911  ---KPT-SSLFDSNSDSF 924

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  220 bits (560), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 214/671 (31%), Positives = 319/671 (47%), Gaps = 84/671 (12%)

Query: 398  SRTSKATLLNLKARLSKKK---PVKSNKST--NTSLDVLFQNLKQASRKQILDHQRELVE 452
            S +SKA +L+LKAR+SKKK    V S+K T  + SL  LF +L++A+R Q+++H+  L+ 
Sbjct: 335  SLSSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLL 394

Query: 453  NRGFKLEDXXXXXXXXXXXXXXXXXRNKRIRMREKQK-EKSLSENEDADFDLSANELEDE 511
             RG  L +                 RNK+++  E QK E S S++   +F   ++     
Sbjct: 395  LRGVDLAEIAKEKESVESLLERELARNKKVKQEEIQKGEDSSSDSSSDEFCNDSSTSLGS 454

Query: 512  EEDGVNDSDNIANSQIXXXXXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEIS--- 568
              D  +DS+                   D+ N   DE  D     D   + SK+E+S   
Sbjct: 455  HSDSADDSNG-----------------YDDYNQEVDESVDTEV-VDLGPLKSKHELSVKT 496

Query: 569  ---------DEDEDSIFQLTRKEKHPVRIIQESDDENEIN--KINTIDLGVYGGNLDNPN 617
                      ++ED    +T+K+K     + +SDDE   N  +   IDLG YG N+    
Sbjct: 497  TNLTIVRAESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENILGTE 556

Query: 618  PL------------SSQTEPNEDDEDEKS--------TYENKEITEEERHALI--LAEKK 655
             +            SS  E   +    KS          E  +  EE R+ +I  L EK+
Sbjct: 557  RIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKR 616

Query: 656  RIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDD 715
            +++  E    A+ KE+ +   N + + EAEES+DEW G+GGADGE SD YDSE+++MIDD
Sbjct: 617  KLK--EALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDD 674

Query: 716  YSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXX 775
            YS +  +P+ +R+ L  E K  D +M+ +IL+DI+N                        
Sbjct: 675  YSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIEN--GGFRKRGRYAMDLTLSDDEDDD 732

Query: 776  XXXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSST 835
               YH               +   L  NPKSKAFF+S+ ED  D K    +++  +  ++
Sbjct: 733  LLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED--DLKGGIANLKEYQSHAS 790

Query: 836  ELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLE---EFNIEEDLAKEQHGE 892
             L    +  +D   G  K++  ISE+FVQKTLSFL+S  D +   EF    D  +   G+
Sbjct: 791  PL----KAAKDEISG--KRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGD 844

Query: 893  NVE--DLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDI 950
              E  D + LKQ S IK F  P +++    + N + V    L G    ++++ F    D 
Sbjct: 845  FAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGV----LSGKANTTLVERFVRSVDT 900

Query: 951  NEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKI--GSKIKPTRSS 1008
            NEKF++G KTV     YK  GSS+ASIT+LGK+R L   K+  +      G KI  T   
Sbjct: 901  NEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIM-TSHQ 959

Query: 1009 LFSSHDESFEN 1019
             F+S  +SFEN
Sbjct: 960  FFASDGQSFEN 970

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 14/81 (17%)

Query: 4  IFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIRNRL 63
          + ++ S P+ +R    KK+H     D+E+         P V G GF+F N++ ++++ R+
Sbjct: 3  LIDQLSNPRTKRSGFVKKLHL---FDDES--------CPTVGGTGFLFENSIFNQVKKRI 51

Query: 64 DGKENKE---DTPVPTQTQMI 81
             ++ E   + P    T+++
Sbjct: 52 KATDDNEINHNAPTTASTEIL 72

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  212 bits (540), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 259/903 (28%), Positives = 416/903 (46%), Gaps = 141/903 (15%)

Query: 187  IQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVIN 246
            +QD +ET       +SLS+ + I        T+   ++    +    Q +M   D Q  +
Sbjct: 170  LQDELETGVAVDGRISLSQTQVIV-----SGTNYGPTRVDDEVVATQQDSMGTADAQCWD 224

Query: 247  NTNLDVIEAT--MADLPNLNEPQSTVADIPSTGLKIHEIQKELERERNSKELKEYKKPSK 304
               LD   A    A +P+      T+A      L IH+I++E+   +  KEL    + +K
Sbjct: 225  TQTLDCALADDFQATIPDAQ----TLATARHEKLFIHQIEEEIA-TKTQKELPMMTQ-AK 278

Query: 305  EIKVIP---IKFSKTSLLDGFDNSSSDDELEVQ-----KDMKITRTXXXXXXXXXXXXXX 356
            E   IP   + F+K + LD FD+   D E E+       D +++                
Sbjct: 279  EAPYIPKQKLVFTKDNFLDSFDD---DSETEIHGGLDGSDRQVSYNDREHTETGPQSSQP 335

Query: 357  XXLTGLNT---YENXXXXXXXXXXH-----IQLDSDSDNDSDIAKRFPISRTSKATLLNL 408
                G +T   Y            +     I LD  S++D+D+      S  SKA +L +
Sbjct: 336  ATGEGQDTQVLYPALQSLSITSKSYQEARQIILDESSEDDTDVNLS---SAVSKAAVLAI 392

Query: 409  KARLSK-KKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDXXXXXXX 467
            KAR SK   P K +++ ++  + LF  L++A+R+Q+L+ +R  +E RG  +++       
Sbjct: 393  KARNSKFITPQKIDETKSSKSNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQ 452

Query: 468  XXXXXXXXXXRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEEDGVNDSDNIANSQI 527
                      RN+RIR+REK+ E+   ENE+ +  +S+++   +E+   +D+ +IA+   
Sbjct: 453  LGNLLEQELERNRRIRIREKKIERERLENENVELTISSDDASSDEDVPESDAGSIADP-- 510

Query: 528  XXXXXXXXXXVLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVR 587
                                  G ++ E ++S +SS+ + SD  E+S   +  K +   R
Sbjct: 511  ----------------------GASSTEDEDSGLSSEID-SDMGEESDHSVVTK-RRSRR 546

Query: 588  IIQESDDENEINKIN--TIDLGVYGGNL---------------------DNPNPLSSQTE 624
            I+ +SDDE      N   I LGVYG N+                     D+ +P+ + T 
Sbjct: 547  ILVQSDDEGTETTENRQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSPVKTTTS 606

Query: 625  PNEDDEDEKSTYENK----------------------------EITEEERHALILAEKKR 656
              +   D ++  +++                            E+ +E R  ++     R
Sbjct: 607  TPKGLTDGRAELDHESPDGHSLNTNLQQGLSKSESSSTKVSEDELDQETRRKILSDLLAR 666

Query: 657  IQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDY 716
             +   ++N  R +EMKKKG+ K+ EMEAEESEDEWHGIGG+D E+S++YDSEVEKMIDDY
Sbjct: 667  NRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDY 726

Query: 717  SKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNXXXXXXXXXXXXXXXXXXXXXXXXX 776
            S  + N D +R +LA   ++ D N++ KIL+DI                           
Sbjct: 727  SVHSSNADHLRAILAKNERQHDENIVNKILHDIST--GGFRRRGKGALDLEMSENEDQEL 784

Query: 777  XXYHXXXXXXXXXXXXXIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTE 836
              +               GD  KL+ NPKS AFF++MV+D+ +   +FG+          
Sbjct: 785  QQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEA--SFGNT--------- 833

Query: 837  LDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQ--HGENV 894
             D   +++ D  P    +K VISE+FV++TLSFL S     E   E           E +
Sbjct: 834  FDANIDEKTD--PSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEI 891

Query: 895  EDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLG--GF---KPPSVIKSFSSRTD 949
            +DL +LKQ S IK  +      +++L   +  + S   G  GF   +  S  KSF++ T+
Sbjct: 892  QDLHTLKQNSNIKHLK-----GSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTN 946

Query: 950  INEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKN-KNREKIGSKIKPTRSS 1008
            +++KFK G K V I K  KT+G SKA+IT++G+ R+L+PPK + K+ E   +  K  RS 
Sbjct: 947  VDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQ 1006

Query: 1009 LFS 1011
            LFS
Sbjct: 1007 LFS 1009

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON}
           similar to uniprot|P43565 Saccharomyces cerevisiae
           YFL033c RIM15 protein kinase involved in expression of
           meiotic genes
          Length = 1682

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%)

Query: 801 IKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVDKKKNV 857
           IK  +S+AFFE+++++++D  NA  +I   E   T  +   E++Q  +  V  K N+
Sbjct: 307 IKGTRSRAFFETIIDELIDLCNAAININPSEYHETTANELTEQDQQRSDSVSCKNNI 363

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 72/158 (45%), Gaps = 18/158 (11%)

Query: 539 LDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTR----------KEKHPVRI 588
           + +G+ + + +G +NR    S +   + I   D DS+FQ  +           E++ VR+
Sbjct: 608 IASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRV 667

Query: 589 IQESDDENEINKINTIDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHA 648
            QE    N +N     +  +    LD+P  L +    +   + E++    K I  +E  +
Sbjct: 668 EQEQSLTNYMNNGEWSNAFLLALQLDHPMRLFNVLRSSMGSQPEQA--NGKVIFNQELDS 725

Query: 649 LI--LAEKKRIQLIEKK----NAARTKEMKKKGVNKLF 680
           LI  L + + IQL+++       ART  + +K ++ +F
Sbjct: 726 LIGTLNKDQLIQLMKRCRDWNTNARTHMVAQKTISCIF 763

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.126    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,885,614
Number of extensions: 5102214
Number of successful extensions: 36950
Number of sequences better than 10.0: 1240
Number of HSP's gapped: 35319
Number of HSP's successfully gapped: 1580
Length of query: 1020
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 900
Effective length of database: 39,721,479
Effective search space: 35749331100
Effective search space used: 35749331100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 71 (32.0 bits)