Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B091001.6ON32731014540.0
NDAI0A001501.6ON31731013760.0
Smik_3.151.6ON31631113430.0
YCL059C (KRR1)1.6ON31631113380.0
Suva_3.1531.6ON31631113360.0
CAGL0B00352g1.6ON33731013210.0
Skud_3.41.6ON31631113140.0
SAKL0C00484g1.6ON33931113140.0
Kpol_2002.91.6ON33831013080.0
TPHA0E040001.6ON31631013000.0
KNAG0C002301.6ON34931013010.0
Kwal_33.130111.6ON33431112971e-180
Ecym_10091.6ON33631012961e-180
KLLA0C00506g1.6ON33031012911e-180
TDEL0C069601.6ON35031012821e-178
KLTH0F00506g1.6ON33231112511e-174
ZYRO0F18458g1.6ON31431012461e-173
KAFR0D001501.6ON34430812481e-173
TBLA0A049401.6ON31631012391e-172
AFR744W1.6ON34331012151e-168
SAKL0G03740g5.482ON2661461102e-05
Ecym_45525.482ON2711461112e-05
Suva_8.1975.482ON2741481093e-05
Kpol_543.135.482ON2681461093e-05
TDEL0A034605.482ON2721461093e-05
ZYRO0D11440g5.482ON2691461094e-05
Kwal_47.188645.482ON2711461094e-05
KLTH0G02574g5.482ON2711461084e-05
NCAS0A119605.482ON2701931075e-05
CAGL0K09460g5.482ON2611461076e-05
TPHA0J028205.482ON2681461051e-04
KLLA0C06446g5.482ON2741461051e-04
Skud_15.3105.482ON2761481051e-04
AFR390C5.482ON3111461051e-04
YOR145C (PNO1)5.482ON2741481041e-04
KAFR0E036005.482ON2761461041e-04
Smik_15.3265.482ON2741481032e-04
NDAI0A043105.482ON2741461022e-04
KNAG0C046105.482ON2771681023e-04
TBLA0D018905.482ON271146950.002
AAR002W1.420ON178163800.092
KAFR0B030308.309ON46724712.5
AGL183C8.309ON50724703.0
KNAG0G023508.309ON49724685.3
KLTH0E14014g8.798ON48699685.4
KLLA0D02398g1.290ON120583677.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09100
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   564   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   534   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   521   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   520   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   519   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   513   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   510   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   510   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   508   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   505   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   505   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   504   e-180
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   503   e-180
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   501   e-180
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   498   e-178
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   486   e-174
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   484   e-173
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   485   e-173
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   481   e-172
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   472   e-168
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    47   2e-05
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    47   2e-05
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    47   3e-05
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    47   3e-05
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    47   3e-05
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    47   4e-05
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    47   4e-05
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    46   4e-05
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    46   5e-05
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    46   6e-05
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    45   1e-04
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    45   1e-04
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    45   1e-04
AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON} ...    45   1e-04
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    45   1e-04
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    45   1e-04
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    44   2e-04
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    44   2e-04
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    44   3e-04
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    41   0.002
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    35   0.092
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.5  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   3.0  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.3  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   5.4  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    30   7.0  

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/310 (88%), Positives = 275/310 (88%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                IYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLH                 NK
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 NYIAPEEETY 310
           NYIAPEEETY
Sbjct: 301 NYIAPEEETY 310

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/310 (83%), Positives = 269/310 (86%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDT +++KW IEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALN HNL CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                IYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKL+                 NK
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 NYIAPEEETY 310
           +Y+AP E TY
Sbjct: 301 DYVAPSEPTY 310

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/311 (81%), Positives = 267/311 (85%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDT D+DKW IEEFK EDNASG PFAEESSFMTLFPKYRE+YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPPAQLPRKVDLEIESGEYFLSKREK+MKKL                   
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 KNYIAPEEETY 310
           K++IAPEEETY
Sbjct: 301 KDFIAPEEETY 311

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/311 (81%), Positives = 267/311 (85%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDT D+DKW IEEFK EDNASG PFAEESSFMTLFPKYRE+YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPPAQLPRKVDLEIESGEYFLSKREK+MKKL+                  
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 KNYIAPEEETY 310
           K++IAPEEE Y
Sbjct: 301 KDFIAPEEEAY 311

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/311 (81%), Positives = 266/311 (85%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDT DVDKW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPPAQLPRKVDLEIESGEYFLSKREK+MKKL+                  
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 KNYIAPEEETY 310
           KN++AP+EE Y
Sbjct: 301 KNFVAPQEEAY 311

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/310 (78%), Positives = 263/310 (84%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVST+N+DKPWDT D+DKW IEEFKPEDN SG PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH++GC LDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQLPRKVDL+IESGEYFLSK+EKE+KKLH                  K
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 NYIAPEEETY 310
           +YIAP+E+ Y
Sbjct: 301 DYIAPKEDEY 310

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/311 (79%), Positives = 265/311 (85%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNR+KPWDT D+DKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPPAQLPRKVDLEIESGEYFLSKR+K++KKL+                  
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 KNYIAPEEETY 310
           K++ APEEE+Y
Sbjct: 301 KDFTAPEEESY 311

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/311 (79%), Positives = 264/311 (84%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           M STHN+DKPWDTP++DKW IEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH++ C LDLVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXX-XXXXXXXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPPAQLPRKVDLEIESGEYFLSK+EKE+KKL                   
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 KNYIAPEEETY 310
           K+Y+APEE  Y
Sbjct: 301 KDYVAPEEAEY 311

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 262/310 (84%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHN+DKPWDT D+DKW +EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+K ++ C LDLVEGSMTVKTTRKTFDP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQ PRKVDLEIESGEYFLSK+EKE+K+L                  +K
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 NYIAPEEETY 310
           +Y+AP EE Y
Sbjct: 301 DYVAPMEEEY 310

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  505 bits (1300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 264/310 (85%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHN++KPWDT D+DKW +E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+KH++ C L+LV+GSMTV TTRKT+DP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPP+QLPRKVDLEIESGEYFLSK+EKE+K+LH                 +K
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 NYIAPEEETY 310
           NYIAP+EE Y
Sbjct: 301 NYIAPKEEKY 310

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/310 (77%), Positives = 260/310 (83%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHN+DKPWDT D+DKWHIEEFKPEDNASG PFAEESSFMTLFPKYRETYLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+ H++ C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQLPRKVDLEIESGEYFL+K+EK+ KKL                   K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 NYIAPEEETY 310
           +Y AP+E+ Y
Sbjct: 301 DYTAPKEKAY 310

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  504 bits (1297), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/311 (77%), Positives = 259/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           M STHN+DKPWDTPD+DKW IEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL KH++ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPP Q PRKVDL+IESGEYFLSK+EKE KKL                   
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 KNYIAPEEETY 310
           K+Y+AP E+ Y
Sbjct: 301 KDYVAPSEKEY 311

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  503 bits (1296), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/310 (78%), Positives = 264/310 (85%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHN+DKPWDTPD+DKW IEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+L C L+LVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL                   +
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 NYIAPEEETY 310
           +YIAP+E+ Y
Sbjct: 300 DYIAPDEKEY 309

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  501 bits (1291), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 245/310 (79%), Positives = 264/310 (85%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHN+DKPWDT +VDKW+IEEFKPEDN SGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TR+L+ H++ C L+LVEGSMTVKTTRKT+DPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP++GL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                IYTPFPPAQLPRKVDLEIESGEYFLSKREKE+KKLH                  K
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 NYIAPEEETY 310
           ++IAP+E  Y
Sbjct: 300 DFIAPKETDY 309

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  498 bits (1282), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 238/310 (76%), Positives = 260/310 (83%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDT D+DKW +EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALN H++ CVLDL+EGSMTVKTTRKTFDPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP++GL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQ PRK+DLEIESGEYFLSK+EKE+ KL                  +K
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 NYIAPEEETY 310
           +YIAP+E+ Y
Sbjct: 301 DYIAPKEDVY 310

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 261/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           M STHN+DKPWDTPD+DKW IEEFKPEDN SG+PFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTR+T+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXN 299
                 +YTPFPPAQ PRK+DL+IESGEYFL+K+EKE KKL                   
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 KNYIAPEEETY 310
           K+Y+AP E+ Y
Sbjct: 301 KDYVAPIEKGY 311

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  484 bits (1246), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 255/310 (82%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHN+DKPWDT ++DKWH +EFK EDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALNK+++ CVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG ++GL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAK+PELANEDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQ PRKVDLEIESGEYFL+KREKE KKL                   K
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 NYIAPEEETY 310
           +++ P+EE Y
Sbjct: 301 DFLPPKEEDY 310

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  485 bits (1248), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 243/308 (78%), Positives = 262/308 (85%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVST+N++KPWDT D+DKW  EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL KH++ C+LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPP QLPRKVDLEIESGEYFLSK+EKE+KKL                   K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 NYIAPEEE 308
           NYIAP+EE
Sbjct: 301 NYIAPKEE 308

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  481 bits (1239), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 262/310 (84%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVSTHNRDKPWDTPD++KW I+EFKPEDNASGLPF EESSFMTLFPKYRETYL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T++L+K+++ C LDL+EGSMTVKTTRKT+DPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQLPRKVDLEIESGEYFLSK+EKE+KKL                   K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 NYIAPEEETY 310
           ++IAP E+ Y
Sbjct: 301 DFIAPSEKEY 310

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  472 bits (1215), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 236/310 (76%), Positives = 257/310 (82%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60
           MVST N+DKPWDTPDVDKW IEEF PED+ASGLPFAEESSFMTLFPKYRETYLKS+W +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL KH++ C L+LVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHXXXXXXXXXXXXXXXXXNK 300
                +YTPFPPAQLPRKVDLEIE+GEYFLSK+EKE KKL                   K
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 NYIAPEEETY 310
           +YIAP E  Y
Sbjct: 300 DYIAPAEPEY 309

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTT-RKTFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 71/148 (47%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R T L++ W  +   L +H  L   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPFQGLKEVRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L +H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTT-RKTFDPAIILKARDLIKL 103
           P +R T L++ W  +   L +H  L   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++    + ++G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 84/193 (43%), Gaps = 10/193 (5%)

Query: 4   THNRDKPWDTPDVDKWHIEE-----FKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWN 58
           TH+  +P    +     ++E     F   + A G     ES  + + P +R T L++ W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKLLARSVPFPQAVKI 116
            +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK          ++ +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVM 174
           L+ DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+  I++    + ++
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GPFQGLKEVRRVV 187
           G F  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ WN +   L  H  L   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W+ +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++    + ++G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T LK+ W+ +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVTNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 70/148 (47%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R T L++ W  +   L +H  L   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSVMGPFQGLKEVRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR145C
           (PNO1)
          Length = 311

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTT-RKTFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   S+ ++T  R T DP  + K  D IK 
Sbjct: 139 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPRHTTDPGALQKGADFIKA 198

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T + +   +   R+ G +G +  A+E  T+
Sbjct: 199 FTLGFDLDDSISLLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKSKFAIENATR 258

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 259 TRIVLADSKIHILGGFTHIRMAREAV 284

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 70/148 (47%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R T L++ W  +   L +H  L   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPFQGLKEVRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L +H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 70/148 (47%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R T L++ W  +   L +H  L   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPFQGLKEVRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++    + ++G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 5/168 (2%)

Query: 24  FKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTV 82
           F   + AS      ES  + + P +R T L++ W  +   L  H  L   ++L   S+ +
Sbjct: 84  FSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVEL 142

Query: 83  KTTRK-TFDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFV 139
           +T  K T DP  + K  D IK          ++ +L+ DD+  +  ++ +  T + +   
Sbjct: 143 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLS 202

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGLKEVRRVV 187
           +   R+ G +G T  A+E  T+  I++  + + ++G F  ++  R  V
Sbjct: 203 RAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSVWNDVTRALNKH-NLGCVLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R T L++ W  +   L  H  L   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFQGLKEVRRVV 187
             I++  + + ++G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 35.4 bits (80), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 65/163 (39%), Gaps = 35/163 (21%)

Query: 54  KSVWNDVTRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQA 113
           ++VW +V RAL++    C   L          R       ++  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSE----CTAALF--------PRLELGSGSVIAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SVMGPFQGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPE 214
               P  G    +R+   CM  V  I HI ++  + + A+ P+
Sbjct: 97  ----PSCG--HYKRLNTLCMYCVGEIRHIWKVYTQTKPAEPPQ 133

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKKPELANEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 30.4 bits (67), Expect = 7.0,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 112  QAVKILQDDMA-CDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQ--- 167
            +A K+++D +A   ++    FV +K+   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 168  ---GNTVSVMGPFQGLKEVRRVV 187
                N + V+G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,554,109
Number of extensions: 1186913
Number of successful extensions: 2966
Number of sequences better than 10.0: 48
Number of HSP's gapped: 3024
Number of HSP's successfully gapped: 48
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)