Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B090901.7ON1191195984e-81
YCL058W-A (ADF1)1.7ON113951704e-16
ZYRO0F18436g1.7ON112981556e-14
Suva_3.1541.7ON1131011549e-14
Skud_3.51.7ON113921531e-13
NDAI0A001601.7ON1231231532e-13
SAKL0C00506g1.7ON105981512e-13
Smik_3.161.7ON113931443e-12
KAFR0D001601.7ON1111061434e-12
Kpol_2002.101.7ON1111111434e-12
TBLA0A049501.7ON113921411e-11
TPHA0E039901.7ON1161241365e-11
KNAG0C002401.7ON1261131262e-09
TDEL0C069501.7ON1111121182e-08
CAGL0B00374g1.7ON121911165e-08
AFR743CA1.7ON1011091085e-07
Kwal_YGOB_YCL058W-A1.7ON105931079e-07
Kwal_33.13015singletonOFF105931079e-07
KLTH0F00528g1.7ON10482963e-05
KLLA0C00528g1.7ON11678860.001
ZYRO0B06864g3.77ON29469760.059
TDEL0D010504.313ON55736690.57
TDEL0D042003.202ON46958680.75
Suva_7.2254.56ON92151633.4
Skud_11.1602.610ON101793615.9
Skud_7.2354.56ON91751609.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09090
         (119 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...   234   4e-81
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    70   4e-16
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    64   6e-14
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    64   9e-14
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    64   1e-13
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    64   2e-13
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    63   2e-13
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    60   3e-12
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    60   4e-12
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    60   4e-12
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    59   1e-11
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    57   5e-11
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    53   2e-09
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    50   2e-08
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    49   5e-08
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    46   5e-07
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    46   9e-07
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    46   9e-07
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    42   3e-05
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    38   0.001
ZYRO0B06864g Chr2 (546314..547198) [885 bp, 294 aa] {ON} similar...    34   0.059
TDEL0D01050 Chr4 (191904..193577) [1674 bp, 557 aa] {ON} Anc_4.3...    31   0.57 
TDEL0D04200 Chr4 (770451..771860) [1410 bp, 469 aa] {ON} Anc_3.2...    31   0.75 
Suva_7.225 Chr7 complement(398674..400607,401276..402107) [2766 ...    29   3.4  
Skud_11.160 Chr11 (290123..293176) [3054 bp, 1017 aa] {ON} YKL06...    28   5.9  
Skud_7.235 Chr7 complement(409489..412242) [2754 bp, 917 aa] {ON...    28   9.1  

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score =  234 bits (598), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MARSHSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDL 60
           MARSHSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDL
Sbjct: 1   MARSHSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDL 60

Query: 61  QKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           QKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF
Sbjct: 61  QKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 70.1 bits (170), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%), Gaps = 8/95 (8%)

Query: 28  KNSISFSDRKKAKHQVEKLNKK-ENLLPMNVLDLQKKKNLSKKPEPLK--SILHARSLLQ 84
           K SIS ++RK+ K QVEKLNK  E ++P  +     ++  +++P  LK  + L A  L++
Sbjct: 24  KRSISTAERKRTKLQVEKLNKSSETMIPTLL-----REASTQEPAKLKAETTLKAEELIK 78

Query: 85  DQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           DQ+KD ++R +IR E+  T+DS+ KQIEMISGF+ 
Sbjct: 79  DQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 64.3 bits (155), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 64/98 (65%), Gaps = 3/98 (3%)

Query: 22  NQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARS 81
           N  KK K SIS SD+K+ K +VEKL+ K  LLP  +  L +  + S K     S L AR+
Sbjct: 18  NGFKKPKKSISHSDKKRTKSKVEKLDAK-GLLPSEIFKLNR--SASSKTSNGSSSLLARN 74

Query: 82  LLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           L QD+K D++ R+K  A++K TD++I +QIEMISGF+ 
Sbjct: 75  LEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 63.9 bits (154), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 63/101 (62%), Gaps = 6/101 (5%)

Query: 20  GKNQVKKNKNSISFSDRKKAKHQVEKLNKK-ENLLPMNVLDLQKKKNLSKKPEPLKSILH 78
           GK Q KK    IS ++ K+ K QVE+LNK  E ++P  +L    K++L KK    +S L 
Sbjct: 18  GKKQQKKR--PISTAEMKRTKLQVERLNKSSETMIP-TLLKEASKQDLDKKK--TRSTLE 72

Query: 79  ARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           A  L++DQ +D ++R  I  E+  T+DS+ KQIEMISGF+ 
Sbjct: 73  AEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 63.5 bits (153), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%), Gaps = 2/92 (2%)

Query: 28  KNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQK 87
           K  IS ++RK+ K QVEKLNK   ++   +L     +  +KK    KS L A  L++DQ 
Sbjct: 24  KRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRA--KSTLKAEELVKDQA 81

Query: 88  KDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           KD ++R +I+ E+  T+DS+ +QIEMISGF+ 
Sbjct: 82  KDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 63.5 bits (153), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 72/123 (58%), Gaps = 7/123 (5%)

Query: 2   ARSHST-KTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDL 60
           ARS+S  + +  T  + +  KN   KN N I  SDRKK K +V   NK E+ L MNV +L
Sbjct: 3   ARSNSLHRRRLPTGRKIRKPKNHTNKN-NVIKQSDRKKNKIKVAMFNK-ESSLHMNVSEL 60

Query: 61  --QKKKNLSKKPEPLK--SILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISG 116
             Q    + +K + L+  S L A  LL DQKKD E  N+I+ E+K  +D + +QIEMISG
Sbjct: 61  NSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISG 120

Query: 117 FTF 119
           F F
Sbjct: 121 FKF 123

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 62.8 bits (151), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 59/98 (60%), Gaps = 4/98 (4%)

Query: 22  NQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARS 81
           N  KK    I  S +K+ + QVE+LNK+E LL     DL      S K +     L A++
Sbjct: 12  NGSKKPSGGIKKSQKKRTRIQVEQLNKQEFLLS----DLNMTNAGSTKTKEKPKTLQAKA 67

Query: 82  LLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           L QDQKKDKE R+K+  ++K T+D++  Q+EMISGF+ 
Sbjct: 68  LAQDQKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 60.1 bits (144), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 60/93 (64%), Gaps = 4/93 (4%)

Query: 28  KNSISFSDRKKAKHQVEKLNKK-ENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQ 86
           + SIS + +K+ K QVEKLNK  E ++P  + +   ++   +K E   S L A  L++DQ
Sbjct: 24  RRSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTE---STLKAGDLIKDQ 80

Query: 87  KKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           +KD ++R  I+ E+  T+D++ KQIEMISGF+ 
Sbjct: 81  EKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 59.7 bits (143), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 66/106 (62%), Gaps = 11/106 (10%)

Query: 20  GKNQVKK---NKNSISFSDRKKAKHQVEKLNKKE--NLLPMNVLDLQK-KKNLSKKPEPL 73
           G N++KK    KN IS S+RKK K  VEK N++   N+  +N  DL+K K+ LSK     
Sbjct: 11  GGNRIKKIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNK-DLKKDKRRLSK----T 65

Query: 74  KSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           K+ L  + LL DQ +D E++  I  + K T+DS+ KQIEMISGF+ 
Sbjct: 66  KNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 59.7 bits (143), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 9   TKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSK 68
            K++ + R K    +  K KN IS S++K+ K ++EK+NK E +LP ++L L  +    +
Sbjct: 2   AKSSVSMRKKGNVGKKSKRKNVISQSEKKRNKIKMEKINK-EGILPSDILQLNNETRNGQ 60

Query: 69  KPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
                +  L ++ L QD  KD+E   KI A +K TDDS+ KQIE+++GF+ 
Sbjct: 61  SEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 58.9 bits (141), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 62/92 (67%), Gaps = 6/92 (6%)

Query: 29  NSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQ-KKKNLSKKPEPLKSILHARSLLQDQK 87
           N IS  D+K+AK QVEK+NK+++LL  ++++L  K K L+K    L S    + L +DQ+
Sbjct: 27  NKISVGDKKRAKLQVEKMNKQDSLLS-DIINLNGKSKELAKNVNTLSS----KQLKKDQE 81

Query: 88  KDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           KD+ +  +I+ ++K T+D +  QIEMISGF+ 
Sbjct: 82  KDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 57.0 bits (136), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 13/124 (10%)

Query: 1   MARSHSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKE-----NLLPM 55
           MA+  S   K +  N  K  K++ K  K  +S   RK  KH+VEKLNK E     ++  +
Sbjct: 1   MAKGKSNNIKKSFRNNGKNVKDR-KNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINAL 59

Query: 56  NVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMIS 115
           N L+        KK E   S+L A++L +D  KD+++  KI +++K T+ S+ +QIEM+S
Sbjct: 60  NALN-------GKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMS 112

Query: 116 GFTF 119
           GF+ 
Sbjct: 113 GFSL 116

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 9/113 (7%)

Query: 16  RNKTGKNQVKKNKNS---ISFSDRKKAKHQVEKLNKKEN-LLPMNVLDLQKK-----KNL 66
           RN T + Q  K + S   I  S+RK+ K QVEKLN+  N ++  N +D++ +     + +
Sbjct: 14  RNDTKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEV 73

Query: 67  SKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
             +   +   L    L QD+ KD+ I+ ++  +QK TD S+  QIEMISGF+ 
Sbjct: 74  EGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 50.1 bits (118), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 5/112 (4%)

Query: 11  AATNNRNKTGKNQVKKNKN---SISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLS 67
           A  NN  KTGK   K  KN   +IS  D KK K +VE LN+    L   ++ L     + 
Sbjct: 2   AVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLS-EIIKLNASTAV- 59

Query: 68  KKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           K      + L  R+L +D +KD++IR K +AE++   +++EKQIE ISGF+ 
Sbjct: 60  KGSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 49.3 bits (116), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 54/91 (59%)

Query: 29  NSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKK 88
           N IS S+RKK+K    +LNK  ++  + ++       ++++P+  ++ L    L++DQK+
Sbjct: 31  NKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKR 90

Query: 89  DKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           DK++R  I      T+  + KQ+E++SGF+ 
Sbjct: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 46.2 bits (108), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 11  AATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKP 70
           AA  +R K  KN     +  IS +D+K+AK QVEKL+K+          +   +  +  P
Sbjct: 2   AAFQHRAKRSKNGASAKQGKISKADKKRAKLQVEKLDKR---------GVLLAELTAAAP 52

Query: 71  EPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
                +L A SL QDQ+ D + + +   E+   D  + +Q+E I+GF+ 
Sbjct: 53  AAKTGVLQAASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 45.8 bits (107), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 62/93 (66%), Gaps = 5/93 (5%)

Query: 27  NKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQ 86
           +KN I    + + K +VE+ NK+  L    + +L K+++  ++  PL+S+  +R L++D 
Sbjct: 18  SKNVIKKHQKIRTKLKVEQANKEVFL----ISELNKREDTKRQSSPLESLKPSR-LVKDI 72

Query: 87  KKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           KKD+  + ++ +++KATD+++ +Q+E+ISGF+ 
Sbjct: 73  KKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 45.8 bits (107), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 62/93 (66%), Gaps = 5/93 (5%)

Query: 27  NKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQ 86
           +KN I    + + K +VE+ NK+  L    + +L K+++  ++  PL+S+  +R L++D 
Sbjct: 18  SKNVIKKHQKIRTKLKVEQANKEVFL----ISELNKREDTKRQSSPLESLKPSR-LVKDI 72

Query: 87  KKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119
           KKD+  + ++ +++KATD+++ +Q+E+ISGF+ 
Sbjct: 73  KKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 56/82 (68%), Gaps = 5/82 (6%)

Query: 38  KAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIR 97
           + K +VE+ NK+  L+     +L ++++ +K+   L+S L    L++D++KDK ++ K+ 
Sbjct: 28  RTKLKVEQANKESFLIS----ELNEREHNTKRTPALES-LKVSDLIEDREKDKSMQKKME 82

Query: 98  AEQKATDDSIEKQIEMISGFTF 119
            ++++TD++I +Q+E+ISGF+ 
Sbjct: 83  EQKQSTDNNIIEQLELISGFSL 104

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 6/78 (7%)

Query: 42  QVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQK 101
           QV +L+K    L +++ D+   K   KKP    S L  + + +  K+DKE+  K   E+K
Sbjct: 45  QVRQLDK----LDLSIADIVPNK-AQKKPRSSAS-LEGQKVREHYKEDKEVVKKHDKEKK 98

Query: 102 ATDDSIEKQIEMISGFTF 119
           AT+  IE Q+E+ISGF+ 
Sbjct: 99  ATEKKIEDQLELISGFSL 116

>ZYRO0B06864g Chr2 (546314..547198) [885 bp, 294 aa] {ON} similar to
           uniprot|P36520 Saccharomyces cerevisiae YNL284C MRPL10
           Mitochondrial ribosomal protein of the large subunit
           appears as two protein spots (YmL10 and YmL18) on
           two-dimensional SDS gels
          Length = 294

 Score = 33.9 bits (76), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 51  NLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQ 110
           NL P  VLD++K K+L     P+K   H   +L + K +  +  KI A  KAT D+I+  
Sbjct: 117 NLEPGEVLDMKKMKDLGLVTGPIK---HGIKILGNGKTNFNVPIKIEAS-KATPDAIQ-A 171

Query: 111 IEMISG-FT 118
           IE + G FT
Sbjct: 172 IEKVGGEFT 180

>TDEL0D01050 Chr4 (191904..193577) [1674 bp, 557 aa] {ON} Anc_4.313
           YLR433C
          Length = 557

 Score = 31.2 bits (69), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 68  KKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKAT 103
           K  EP++   H +S+L+D+ + K +RNKI A  K +
Sbjct: 442 KTAEPVEDATHTKSILEDEARRKALRNKILAIAKVS 477

>TDEL0D04200 Chr4 (770451..771860) [1410 bp, 469 aa] {ON} Anc_3.202
           YBR003W
          Length = 469

 Score = 30.8 bits (68), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 54  PMNVLDLQKKKN-LSKKPEPLK--SILHARSLLQDQKKDKEIRNKIRAEQKATDDSIE 108
           P++VL   K  N L+K PEPL   +  H R +L  Q++  EI   I       DD I+
Sbjct: 137 PLHVLHGIKPLNPLTKGPEPLPQATFDHERGILPKQRRLAEIVEMIHTASLLHDDVID 194

>Suva_7.225 Chr7 complement(398674..400607,401276..402107) [2766 bp,
           921 aa] {ON} YGL049C (REAL)
          Length = 921

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 5   HSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPM 55
           HS  ++ ++  R+K   +  K N+   S  DR+KA  + E+   KEN++P+
Sbjct: 488 HSANSRMSSKRRSKRMGDDRKSNRGYTSRRDREKAFERAEEQAPKENIVPL 538

>Skud_11.160 Chr11 (290123..293176) [3054 bp, 1017 aa] {ON} YKL068W
           (REAL)
          Length = 1017

 Score = 28.1 bits (61), Expect = 5.9,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 27  NKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQ 86
           +K  + + DRK  KH V K NK  N++  N L+  K K ++   EPL     + S L   
Sbjct: 754 SKELLFYPDRKYLKHLVIKKNKSLNVVNSNDLEPNKVKLVTFTTEPLSEDNRSSSSLVPS 813

Query: 87  KKDKEIRNKIRAEQKATD-DSIEKQIEMISGFT 118
               EI +    +Q+  D +S + Q    SG T
Sbjct: 814 ALADEIDSCENVQQEDCDKNSSDIQSAPSSGLT 846

>Skud_7.235 Chr7 complement(409489..412242) [2754 bp, 917 aa] {ON}
           YGL049C (REAL)
          Length = 917

 Score = 27.7 bits (60), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 30/51 (58%)

Query: 5   HSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPM 55
           H++ ++ ++  R+K   +  + N+  IS  DR+KA  + ++   +EN+ P+
Sbjct: 485 HASNSRVSSKRRSKRMGDDRRSNRGYISRKDREKASDRADEQTSRENVPPL 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.122    0.312 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,612,095
Number of extensions: 626404
Number of successful extensions: 6851
Number of sequences better than 10.0: 602
Number of HSP's gapped: 6456
Number of HSP's successfully gapped: 744
Length of query: 119
Length of database: 53,481,399
Length adjustment: 88
Effective length of query: 31
Effective length of database: 43,390,791
Effective search space: 1345114521
Effective search space used: 1345114521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)