Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B090801.8ON93934729e-63
CAGL0B00396g1.8ON88893234e-40
Ecym_10101.8ON82703219e-40
ZYRO0F18414g1.8ON87713141e-38
TBLA0A049601.8ON96823114e-38
KLTH0F00550g1.8ON82763086e-38
TPHA0E039801.8ON86933087e-38
Kpol_2002.111.8ON86863061e-37
SAKL0C00528g1.8ON110863063e-37
AFR743W1.8ON82703001e-36
YCL057C-A (MOS1)1.8ON97903011e-36
Kwal_33.130161.8ON82802992e-36
Smik_3.171.8ON97852993e-36
Skud_3.61.8ON97902983e-36
Suva_3.1551.8ON97882976e-36
NDAI0A001701.8ON96892723e-32
KNAG0C002501.8ON94922672e-31
KLLA0C00550g1.8ON82662628e-31
KAFR0D001701.8ON90742592e-30
TDEL0C069401.8ON86702551e-29
SAKL0C10230g3.119ON97151730.078
TBLA0I021503.310ON74936690.30
Smik_15.2315.655ON65340650.79
YOR054C (VHS3)5.655ON67440651.1
ZYRO0G20570g1.324ON59544631.9
YCL031C (RRP7)1.43ON29741604.2
CAGL0B00880g1.43ON30532604.6
Smik_3.461.43ON29732595.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09080
         (93 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   186   9e-63
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   129   4e-40
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   128   9e-40
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   125   1e-38
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   124   4e-38
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   123   6e-38
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   123   7e-38
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   122   1e-37
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   122   3e-37
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   120   1e-36
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   120   1e-36
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   119   2e-36
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   119   3e-36
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   119   3e-36
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   119   6e-36
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   109   3e-32
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   107   2e-31
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   105   8e-31
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   104   2e-30
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   102   1e-29
SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} simila...    33   0.078
TBLA0I02150 Chr9 (496050..498299) [2250 bp, 749 aa] {ON} Anc_3.3...    31   0.30 
Smik_15.231 Chr15 complement(394040..396001) [1962 bp, 653 aa] {...    30   0.79 
YOR054C Chr15 complement(427833..429857) [2025 bp, 674 aa] {ON} ...    30   1.1  
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    29   1.9  
YCL031C Chr3 complement(64675..65568) [894 bp, 297 aa] {ON}  RRP...    28   4.2  
CAGL0B00880g Chr2 complement(77088..78005) [918 bp, 305 aa] {ON}...    28   4.6  
Smik_3.46 Chr3 complement(66360..67253) [894 bp, 297 aa] {ON} YC...    27   5.1  

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  186 bits (472), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 93/93 (100%), Positives = 93/93 (100%)

Query: 1  MSTDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRT 60
          MSTDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRT
Sbjct: 1  MSTDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRT 60

Query: 61 FPVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          FPVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV
Sbjct: 61 FPVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  129 bits (323), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 73/89 (82%), Gaps = 2/89 (2%)

Query: 5  NNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVW 64
          +N  ++   +   TP   RSILNDKWDVVLSNM+VK+GLGF VGVV SV+FFKRR+FPVW
Sbjct: 2  SNKEETKAKTVDYTPV--RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVW 59

Query: 65 LGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          LG+GFG GRGY+EGDAIFRS AGLR+ KV
Sbjct: 60 LGVGFGAGRGYSEGDAIFRSTAGLRSVKV 88

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  128 bits (321), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%)

Query: 23 RSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIF 82
          RSILNDKWDVVLSN++VK GLGFSVGV+ASV+FFKRR FPVWLGIGFG+GRGYAEGDAIF
Sbjct: 12 RSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIF 71

Query: 83 RSPAGLRTAK 92
          RS AGLRT K
Sbjct: 72 RSHAGLRTMK 81

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  125 bits (314), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 60/71 (84%), Positives = 66/71 (92%)

Query: 22 DRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAI 81
          ++SILNDKWDVVLSN+LVK GLGF VGVVASV+ FKRR FPVWLGIGFG+GRGYAEGDAI
Sbjct: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75

Query: 82 FRSPAGLRTAK 92
          FRS AGLRT+K
Sbjct: 76 FRSAAGLRTSK 86

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  124 bits (311), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 2/82 (2%)

Query: 12 PTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGV 71
            STAVT   +RSILNDKWD+V+SNMLVK   GF  GV+ASVIFFKRR FPVWLG+GFG+
Sbjct: 17 SASTAVTS--NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGL 74

Query: 72 GRGYAEGDAIFRSPAGLRTAKV 93
          GRGY+EGDAIFRS AGLR+ +V
Sbjct: 75 GRGYSEGDAIFRSTAGLRSFQV 96

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  123 bits (308), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 67/76 (88%), Gaps = 1/76 (1%)

Query: 17 VTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYA 76
          V+PT  RS+LNDKWDVVLSN++VK GLGF  GVVASV+ FKRR FPVW+G+GFG+GRGYA
Sbjct: 7  VSPT-SRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYA 65

Query: 77 EGDAIFRSPAGLRTAK 92
          EGDAIFRS AGLRT K
Sbjct: 66 EGDAIFRSSAGLRTVK 81

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  123 bits (308), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 62/93 (66%), Positives = 70/93 (75%), Gaps = 7/93 (7%)

Query: 1  MSTDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRT 60
          MS   N N    TS        +SILNDKWDVVLSNMLVK GLGF VGVV S++ FKRR 
Sbjct: 1  MSEQKNNNNLELTSP-------KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRA 53

Query: 61 FPVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          FPVWLGIGFGVGRGY++GDAIFRS AGLR+ ++
Sbjct: 54 FPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 61/86 (70%), Positives = 65/86 (75%), Gaps = 2/86 (2%)

Query: 8  NQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGI 67
           QS        PT  RSILNDKWDVVLSN LVK  LGF  GV+ASVI FKRR FPVWLGI
Sbjct: 3  QQSQELQITSAPT--RSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60

Query: 68 GFGVGRGYAEGDAIFRSPAGLRTAKV 93
          GFG+GRGY+EGDAIFRS AGLR + V
Sbjct: 61 GFGIGRGYSEGDAIFRSAAGLRKSTV 86

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  122 bits (306), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%)

Query: 5   NNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVW 64
           N  ++ T +        ++SILNDKWDVVLSN++VK GLGF  G+VASV+ FKRR FPVW
Sbjct: 22  NQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVW 81

Query: 65  LGIGFGVGRGYAEGDAIFRSPAGLRT 90
           LG+GFG+GRGYAEGDAIFRS AGLRT
Sbjct: 82  LGVGFGLGRGYAEGDAIFRSSAGLRT 107

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (88%)

Query: 23 RSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIF 82
          RSILNDKWDVVLSN++VK GLGF  GV ASV+FFKRR FPVWLG+GFG+GRGYAEGDAIF
Sbjct: 12 RSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAIF 71

Query: 83 RSPAGLRTAK 92
          RS AGLR  +
Sbjct: 72 RSHAGLRAVR 81

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  120 bits (301), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/90 (65%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 5  NNPNQSTPTSTA-VTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPV 63
            P +STP+  +    +   +IL+ KWD+VLSNMLVK  +GF VGV  SV+FFKRR FPV
Sbjct: 8  QQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67

Query: 64 WLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          WLGIGFGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 68 WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 13 TSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVG 72
          +  A    + RS+LNDKWDVVLSN++VKVGLGF  GVVASV+ FKRR  PVW+G+GFG+G
Sbjct: 2  SDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLG 61

Query: 73 RGYAEGDAIFRSPAGLRTAK 92
          RGY+EGDAIFRS AGLRT K
Sbjct: 62 RGYSEGDAIFRSSAGLRTVK 81

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  119 bits (299), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (78%), Gaps = 8/85 (9%)

Query: 17 VTPTIDRS--------ILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIG 68
          VTP+ D S        +L+ KWD+VLSNMLVK  +GF VGV  SV+FFKRR FPVWLGIG
Sbjct: 13 VTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIG 72

Query: 69 FGVGRGYAEGDAIFRSPAGLRTAKV 93
          FGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 73 FGVGRGYAEGDAIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  119 bits (298), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (78%), Gaps = 1/90 (1%)

Query: 5  NNPNQSTPTSTAV-TPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPV 63
            P +ST ++ ++   +   +IL+ KWD+V+SNMLVK  +GF VGV  SV+FFKRR FPV
Sbjct: 8  QEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67

Query: 64 WLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          WLGIGFGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 68 WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  119 bits (297), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 57/88 (64%), Positives = 70/88 (79%), Gaps = 1/88 (1%)

Query: 7  PNQSTP-TSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWL 65
          P +STP T++    +   ++L+ KWD+VLSNMLVK  +GF +GV  SV+FFKRR FP WL
Sbjct: 10 PAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWL 69

Query: 66 GIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          GIGFGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 70 GIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  109 bits (272), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 71/89 (79%), Gaps = 6/89 (6%)

Query: 11 TPTSTAVTP------TIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVW 64
          T    AV P      TID+SILNDKWD+VLSN LVKVGLGF VGVV SVIFFKRRTFPVW
Sbjct: 8  TEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVW 67

Query: 65 LGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          LGIGFG GRGYAEGDAIFRS AG+R+  V
Sbjct: 68 LGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  107 bits (267), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/92 (69%), Positives = 73/92 (79%), Gaps = 7/92 (7%)

Query: 2  STDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTF 61
          +T NN  Q       +   IDRS+LNDKWDVVLSNMLVKVG+GF VGVV SV+ F+RR F
Sbjct: 10 ATQNNNGQ-------LATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAF 62

Query: 62 PVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93
          PVWLGIGFGVGRGY+EGDAIFRS +G+RT KV
Sbjct: 63 PVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  105 bits (262), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 58/66 (87%)

Query: 24 SILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIFR 83
          SIL+ +WDVVLSN++ K  LG  VG+VASV+FFKRR FPVW+G+GFG+GRGYAEGDAIFR
Sbjct: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72

Query: 84 SPAGLR 89
          + AGLR
Sbjct: 73 TNAGLR 78

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  104 bits (259), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (90%)

Query: 20 TIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGD 79
          +IDRSILNDKWD+VLSNMLVKVGLGF VGVV SVIFFKRR FPVWLGIG+G GR Y+EGD
Sbjct: 17 SIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVWLGIGYGFGRAYSEGD 76

Query: 80 AIFRSPAGLRTAKV 93
          AIFRS AGLR+ ++
Sbjct: 77 AIFRSNAGLRSVQI 90

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  102 bits (255), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%)

Query: 23 RSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIF 82
          RSILNDKWDVVLSNMLVK GLGF VGVV SV+FFKRR FPVWLGIGFG+GRGYAEGDAIF
Sbjct: 16 RSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLGRGYAEGDAIF 75

Query: 83 RSPAGLRTAK 92
          RS AGLR+ K
Sbjct: 76 RSAAGLRSVK 85

>SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 971

 Score = 32.7 bits (73), Expect = 0.078,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 45  FSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIFRSPA---GLRTAK 92
           F  G VA+ ++FKRR  P++  +     R YA G+  F  PA   GLR  K
Sbjct: 677 FLAGTVAAHLYFKRRFIPLFDAVPLSAIR-YARGEPTFLYPARDQGLREIK 726

>TBLA0I02150 Chr9 (496050..498299) [2250 bp, 749 aa] {ON} Anc_3.310
           YBR083W
          Length = 749

 Score = 31.2 bits (69), Expect = 0.30,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 5   NNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVK 40
           N  N+S+ T +++TP   +S  NDKW   + N  V+
Sbjct: 275 NTQNKSSNTPSSLTPQTGKSHDNDKWTAEVENAFVE 310

>Smik_15.231 Chr15 complement(394040..396001) [1962 bp, 653 aa] {ON}
           YOR054C (REAL)
          Length = 653

 Score = 29.6 bits (65), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 33  VLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVG 72
           + +N L K+ LG    ++ SVI     TFP++L    G G
Sbjct: 475 LTANTLAKIALGLCDNLLTSVIRAWNPTFPIFLAPSMGSG 514

>YOR054C Chr15 complement(427833..429857) [2025 bp, 674 aa] {ON}
           VHS3Negative regulatory subunit of protein phosphatase 1
           Ppz1p and also a subunit of the
           phosphopantothenoylcysteine decarboxylase (PPCDC; Cab3p,
           Sis2p, Vhs3p) complex, which catalyzes the third step of
           coenzyme A biosynthesis
          Length = 674

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 33  VLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVG 72
           + +N L K+ LG    ++ SVI     TFP++L    G G
Sbjct: 474 LTANTLAKIALGLCDNLLTSVIRAWNPTFPIFLAPSMGSG 513

>ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} similar
           to uniprot|P47042 Saccharomyces cerevisiae YJL057C
           probable serine/threonine kinase
          Length = 595

 Score = 28.9 bits (63), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 3   TDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFS 46
           +D+ P QST T   +TP++ +     KW  VL NM++   + FS
Sbjct: 511 SDSRPKQST-TRPKLTPSVWK-----KWLCVLMNMVIVTSITFS 548

>YCL031C Chr3 complement(64675..65568) [894 bp, 297 aa] {ON}
           RRP7Essential protein involved in rRNA processing and
           ribosome biogenesis
          Length = 297

 Score = 27.7 bits (60), Expect = 4.2,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 2   STDNNPNQSTPTSTAVTPTIDRSILNDKWDVV--LSNMLVK 40
           STD N  + TP +TA+   +D + +N+ W+ +   SN+  K
Sbjct: 110 STDVNEKRYTPRNTALLKFVDAASINNCWNALKKYSNLHAK 150

>CAGL0B00880g Chr2 complement(77088..78005) [918 bp, 305 aa] {ON}
           similar to uniprot|P25368 Saccharomyces cerevisiae
           YCL031c RRP7 involved in pre-rRNA processing and
           ribosome assembly
          Length = 305

 Score = 27.7 bits (60), Expect = 4.6,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 2   STDNNPNQSTPTSTAVTPTIDRSILNDKWDVV 33
           S D+N  + TP +TA+   +D + LN+ W  +
Sbjct: 118 SEDSNKERFTPRNTALLKFVDEASLNNCWSSI 149

>Smik_3.46 Chr3 complement(66360..67253) [894 bp, 297 aa] {ON}
           YCL031C (REAL)
          Length = 297

 Score = 27.3 bits (59), Expect = 5.1,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 2   STDNNPNQSTPTSTAVTPTIDRSILNDKWDVV 33
           STD N  + TP +TA+   +D + +N+ W+ +
Sbjct: 110 STDINEKRYTPRNTALLKFVDDASINNCWNAL 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,727,435
Number of extensions: 328574
Number of successful extensions: 1207
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1207
Number of HSP's successfully gapped: 29
Length of query: 93
Length of database: 53,481,399
Length adjustment: 64
Effective length of query: 29
Effective length of database: 46,142,775
Effective search space: 1338140475
Effective search space used: 1338140475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)