Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B090701.9ON73073038340.0
ZYRO0F18392g1.9ON72572327190.0
Kpol_2002.121.9ON73972427100.0
NDAI0A001801.9ON74074226820.0
KAFR0D001801.9ON72372626630.0
SAKL0C00550g1.9ON73271826510.0
TPHA0E039701.9ON74773026150.0
KNAG0C002601.9ON74473125990.0
TBLA0A075601.9ON74168425150.0
KLLA0C00572g1.9ON71270624860.0
Suva_3.1561.9ON71270223850.0
CAGL0B00418g1.9ON74373723820.0
YCL057W (PRD1)1.9ON71270423760.0
Smik_3.181.9ON71271423610.0
Skud_3.71.9ON71268123390.0
Ecym_1011na 1ON71670722000.0
AGR406C1.9ON68367817920.0
AGR405Cna 1ON71768017490.0
ABR185WsingletonON45741510031e-128
NDAI0E020102.432ON7786424832e-50
KAFR0D029502.432ON7776384575e-47
SAKL0E03938g2.432ON7675634566e-47
Kpol_297.82.432ON7875574567e-47
KNAG0A062002.432ON7895704495e-46
NCAS0A042802.432ON7736474381e-44
Suva_11.912.432ON7756454363e-44
AFR198W2.432ON7766864344e-44
KLTH0D04730g2.432ON7726234292e-43
TPHA0G023902.432ON7956244274e-43
TDEL0A020802.432ON7876894212e-42
ZYRO0G20130g2.432ON7866894212e-42
Skud_11.932.432ON7725664151e-41
CAGL0D02112g2.432ON7616254142e-41
Smik_11.1022.432ON7725294133e-41
YKL134C (OCT1)2.432ON7726594052e-40
Ecym_60992.432ON7735204018e-40
Kwal_26.76162.432ON7705513937e-39
TBLA0I007102.432ON7736273911e-38
KLLA0B12397g2.432ON7796323832e-37
Kwal_33.141251.236ON31442751.8
KLTH0F06182g1.236ON32042751.9
TBLA0H035908.539ON60084717.0
CAGL0H07821g3.561ON96180708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09070
         (730 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...  1481   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...  1051   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....  1048   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9       1037   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...  1030   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...  1025   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...  1011   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...  1005   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   973   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   962   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   923   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   922   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   919   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   914   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    905   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   852   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   694   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   678   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   390   e-128
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   190   2e-50
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   180   5e-47
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   180   6e-47
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   180   7e-47
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   177   5e-46
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   173   1e-44
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   172   3e-44
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   171   4e-44
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   169   2e-43
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   169   4e-43
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   166   2e-42
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   166   2e-42
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   164   1e-41
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   164   2e-41
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   163   3e-41
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   160   2e-40
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   159   8e-40
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   155   7e-39
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   155   1e-38
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   152   2e-37
Kwal_33.14125 s33 (539186..540130) [945 bp, 314 aa] {ON} YKR046C...    33   1.8  
KLTH0F06182g Chr6 (544018..544980) [963 bp, 320 aa] {ON} similar...    33   1.9  
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    32   7.0  
CAGL0H07821g Chr8 (761870..764755) [2886 bp, 961 aa] {ON} highly...    32   8.8  

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score = 1481 bits (3834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/730 (98%), Positives = 718/730 (98%)

Query: 1   MLWRIGLSRYSSTRIANKKLLISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTW 60
           MLWRIGLSRYSSTRIANKKLLISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTW
Sbjct: 1   MLWRIGLSRYSSTRIANKKLLISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTW 60

Query: 61  KWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHV 120
           KWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHV
Sbjct: 61  KWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHV 120

Query: 121 SADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEK 180
           SADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEK
Sbjct: 121 SADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEK 180

Query: 181 VHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVM 240
           VHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVM
Sbjct: 181 VHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVM 240

Query: 241 EQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETL 300
           EQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETL
Sbjct: 241 EQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETL 300

Query: 301 KLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXD 360
           KLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQ            D
Sbjct: 301 KLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKD 360

Query: 361 CEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLK 420
           CEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLK
Sbjct: 361 CEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLK 420

Query: 421 FVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSY 480
           FVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSY
Sbjct: 421 FVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSY 480

Query: 481 ITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGP 540
           ITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGP
Sbjct: 481 ITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGP 540

Query: 541 GATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALR 600
           GATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALR
Sbjct: 541 GATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALR 600

Query: 601 QLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAG 660
           QLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAG
Sbjct: 601 QLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAG 660

Query: 661 YYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTND 720
           YYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTND
Sbjct: 661 YYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTND 720

Query: 721 AFLKELGLHN 730
           AFLKELGLHN
Sbjct: 721 AFLKELGLHN 730

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/723 (69%), Positives = 603/723 (83%), Gaps = 6/723 (0%)

Query: 11  SSTRIAN--KKLLISAIVLPATAFILTRKS-FYMTLPTNNKLLVAPTGTAPTWKWSPESI 67
           S +R+A   +K + S + +PA A  + R S F  +  ++  L +AP  +AP+W ++P+S+
Sbjct: 5   SCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQ-SAPSWAFTPQSL 63

Query: 68  LAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIR 127
           L +T  +I+++   YDSLA +  P+VE+LVKPYMH+EN  GLI +QLTF Q VSADK IR
Sbjct: 64  LDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIR 123

Query: 128 DASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDD-DLKSKDFETYKFIEKVHKDYV 186
           DASV+ATE LQ+F IE S+R DLF QFDKIWN++KD   +  S+++E YK++EK+H+DY 
Sbjct: 124 DASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYT 183

Query: 187 RNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKF 246
           R+GL LPE+KR++VK +K KIA+NSL +SKNLGEQKE+V+FTKE+L GVSESVM+QFE+F
Sbjct: 184 RDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQF 243

Query: 247 VDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQL 306
            D +    KYKVTFKYPDIFPVLKTA+ PKTRKLA+  DQ+KVPQNE LFVETL+LRN+L
Sbjct: 244 KD-ENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNEL 302

Query: 307 AQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGL 366
           A +LGYSTYANYNL++KMAKNQ+ V+ F+N LKDKLKPLG             +CE LGL
Sbjct: 303 ADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGL 362

Query: 367 AYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETN 426
            YD HYY+WDHRYYDNK+LKDNYNVDLE+ISEYYP+ESTI GML IYETLLKLKFV+ET+
Sbjct: 363 PYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETD 422

Query: 427 PKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGD 486
           P+ + VWHEDVKQLAVWKMD+   PEF+GWIYFDLHPRDGKY HAANFGIS+SY+ +DG 
Sbjct: 423 PEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGT 482

Query: 487 RSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWD 546
           RS+PVTALVCNFSK + KKPSLLKHNEI+TFFHELGHGIHDLVG+N+   FNGPGA PWD
Sbjct: 483 RSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWD 542

Query: 547 FVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGL 606
           FVEAPSQMLEFWTWN+ EL  LS HY++GEKI +DLL SLI+TKHV+GALFALRQLHFGL
Sbjct: 543 FVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGL 602

Query: 607 FDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMW 666
           FDM VHT+KNV  L+LLKLWNELRE++ LVENG+  TKGYDSFGHIMSDSYSAGYYGYMW
Sbjct: 603 FDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMW 662

Query: 667 AEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKEL 726
           AEVFAADMY+T+FA+DPL+S+AGVQYRDIVL  GGLYE  D L+EFLGREP+ +AFLKEL
Sbjct: 663 AEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKEL 722

Query: 727 GLH 729
           GL+
Sbjct: 723 GLN 725

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 1048 bits (2710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/724 (67%), Positives = 606/724 (83%), Gaps = 10/724 (1%)

Query: 11  SSTRIANKKL-LISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILA 69
           S   + N+K  ++S   +PA AF + +   Y T+ TN+ LL+AP   APTW W+PE I+ 
Sbjct: 21  SGKTLKNRKTRIVSFFAVPAIAFTILK---YSTM-TNSSLLIAPQ-PAPTWNWTPEGIVK 75

Query: 70  KTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDA 129
             + +I ++  ++D+LAAI  P+VE+ + PYM++EN    ++NQLTFLQHVSADK IRD+
Sbjct: 76  DAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDS 135

Query: 130 SVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLK----SKDFETYKFIEKVHKDY 185
           S++ATEL+Q+F IEAS+R DLF QFDKIW  VKD+ +      SK++E+Y+FIEK HKD+
Sbjct: 136 SMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDF 195

Query: 186 VRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEK 245
           +R+GLNL +EKR  VKDI+KKIASNSLN+SKNLGEQKE+++FTKE+L GVS++VMEQFEK
Sbjct: 196 IRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEK 255

Query: 246 FVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQ 305
           F D KT EEK+KVTFKYPDI PVLK+A+ P TRKLA+ +DQNKVP+NEALFV+TLKLRN 
Sbjct: 256 FKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRND 315

Query: 306 LAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELG 365
           L+ +L YS YANYNL++KMAKN+ETVF+F+++LK KL+PLG             D +EL 
Sbjct: 316 LSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELN 375

Query: 366 LAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDET 425
           L YD+HYYIWDHRYYDNK+LKDN+NVDLE+ISEYYP+ES+I GML IYET++KLKFV+ET
Sbjct: 376 LPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEET 435

Query: 426 NPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDG 485
           +P  ++VWHEDVKQL+VWKMD+   PEFIGWIYFDLHPRDGKY HAANFGISSSY+ ++ 
Sbjct: 436 DPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDEND 495

Query: 486 DRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPW 545
            RS+PVTALVCNFSK T  KPSLLKHNE+TTFFHELGHGIHDLVG N+C+R NGPG+ PW
Sbjct: 496 KRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPW 555

Query: 546 DFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFG 605
           DFVEAPSQMLEFWTWNKNEL+SLS HY+TGEKI E L++SL++TKHVNGALFALRQLHF 
Sbjct: 556 DFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFS 615

Query: 606 LFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYM 665
            FDM VHT ++V  LNLL+LWN LRE+ICLVENG+E++KGYDSFGHIMS +YSAGYYGYM
Sbjct: 616 TFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYM 675

Query: 666 WAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKE 725
           WAEVFA DMYYTKFA+DPLNS++GV+YRDI+L+ GG+YE+ D L+EFLGREP N AFLKE
Sbjct: 676 WAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKE 735

Query: 726 LGLH 729
           +GL+
Sbjct: 736 MGLN 739

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/742 (67%), Positives = 601/742 (80%), Gaps = 16/742 (2%)

Query: 1   MLWRIGLSRYSSTRIANKKLLISAIVLPATAF-----ILTRKSFYM---TLPTNNKL--- 49
           M+W  GL++    +I+++K LI + ++          I+  K  Y     + TNN +   
Sbjct: 1   MIWSTGLTKSLFNQISSRKKLIVSSIVVPVVSVSLINIIQSKRTYSPNNIIMTNNTVNNK 60

Query: 50  --LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDE 107
              +AP  T P W W+P+ IL +TK  I+     Y+S++ IE PS+E+L+ PYM+YEN  
Sbjct: 61  HGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMNYENKM 120

Query: 108 GLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDD- 166
           GL++NQLTFLQHVSADK IRDAS+EAT LL+D  I  S+R ++++QF+K+W  V++DDD 
Sbjct: 121 GLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDF 180

Query: 167 LKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVS 226
           LK+  FETYKFIEK+HKD +RNGL    E+  Q+K IK KI++++L +S NLGEQ EYVS
Sbjct: 181 LKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVS 238

Query: 227 FTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQ 286
           FTKE+L GVSE+VM+QFEKF+DPKTNE+KYKVTFKYPDIFPVLKTA+ PKTRK+A++ DQ
Sbjct: 239 FTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQ 298

Query: 287 NKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLG 346
           NKVP+NE L    LKLR +LA  LGYSTYANYNLDIKMAKNQETV  F+N+LK+KLKPL 
Sbjct: 299 NKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPLA 358

Query: 347 QXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTI 406
           +            +CEELG+ YD HYYIWDHRYYDNK+LKDN+NVD+E+ISEYYPLESTI
Sbjct: 359 EKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTI 418

Query: 407 KGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDG 466
            GML IYET+L LKF++ET+P  K+VWH DVKQL+VW MDD  NP F+GWIYFDL+PRDG
Sbjct: 419 DGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDG 478

Query: 467 KYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIH 526
           KY HAANFGI+SSYIT++  RS+PVTALVCNFSK T  KP+LLKH+EITTFFHELGHGIH
Sbjct: 479 KYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIH 538

Query: 527 DLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSL 586
           DLVG+NK ARFNGPG+ PWDFVEAPSQMLEFWTWNKNELLSLS HY+TGEKI EDLLDSL
Sbjct: 539 DLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSL 598

Query: 587 IATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGY 646
           I+TKHVNGALFALRQLHFGLFDMTVHTTK++E+L+LLKLWNE RE+ICLVENG   TKGY
Sbjct: 599 ISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGY 658

Query: 647 DSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIA 706
           +SFGHI+SDSYSAGYYGYMWAEVFAADMY+TKFA +PL+   G++YRD++LA GGLYEI 
Sbjct: 659 NSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIN 718

Query: 707 DKLKEFLGREPTNDAFLKELGL 728
           D L EFLGREP+N  FLKELGL
Sbjct: 719 DNLLEFLGREPSNKPFLKELGL 740

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/726 (69%), Positives = 600/726 (82%), Gaps = 11/726 (1%)

Query: 7   LSRYSSTRIANKKLLISAIVLPATAFILTRKSFY-MTLPTNNKLLVAPTGTAPTWKWSPE 65
           L+R S   I ++K  +S + +PAT++++  + +  MT+       +AP   AP+W W+P 
Sbjct: 2   LNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNMTISA----FIAPQA-APSWNWNPS 56

Query: 66  SILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKL 125
            +L   + VIDN+  LYD L+++++P+VE+LV+PYM +EN    ++N+L FLQHVS D  
Sbjct: 57  RLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPK 116

Query: 126 IRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQV--KDDDDLKSKDFETYKFIEKVHK 183
           IR+AS++ATELLQ F IEAS+R DLF QFDKIW ++  K DD +K  DFET+KFIEKVHK
Sbjct: 117 IREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHK 176

Query: 184 DYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQF 243
           DYVR+GLNLPE+KR ++K+IK KI +NSL YSKNLGEQKE ++FT+E+L GVS++V EQF
Sbjct: 177 DYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQF 236

Query: 244 EKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLR 303
           EKF+D +T EEK+KVTFKYPDIFPVLKTA+ P+TR+ A+++DQNKVPQNE LFVETLKLR
Sbjct: 237 EKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296

Query: 304 NQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEE 363
           N+LA  L YSTYANYNL+ KMAK QETV DF+N+LK +LKPL              +C+E
Sbjct: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356

Query: 364 LGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVD 423
           L   YD HYYI+DHRYYDNK+LKDN+NVDLE ISEYYPLE TI GML IYE L KLKF +
Sbjct: 357 LNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE 416

Query: 424 ETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYI-T 482
           ET  K K VWHEDVKQLAVWKMD+ + PEF+GWIYFDLHPRDGKY HAANFGISSSY+  
Sbjct: 417 ET--KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDI 474

Query: 483 QDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGA 542
           + G RS+PVTALVCNFSKST  +PSLLKHNEITTFFHELGHGIHDLVGKNK +RFNGPGA
Sbjct: 475 ETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGA 534

Query: 543 TPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQL 602
           TPWDFVEAPSQMLEFWTWN NEL SLS HY++ EKI +DLL SLI TKHVNGALFALRQL
Sbjct: 535 TPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQL 594

Query: 603 HFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYY 662
           HFGLFDMTVHTT NVE LNLLKLWNELRE+ICLVE G+EL+KGYDSFGHIMSDSYSAGYY
Sbjct: 595 HFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYY 654

Query: 663 GYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAF 722
           GYMWAEVFAADMY+TKF+ +PL+S+ GVQYRDIVLANGGLYEIAD L++FLGREP+ +AF
Sbjct: 655 GYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAF 714

Query: 723 LKELGL 728
           LKELGL
Sbjct: 715 LKELGL 720

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/718 (68%), Positives = 583/718 (81%), Gaps = 14/718 (1%)

Query: 23  SAIVLPATAF------------ILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAK 70
           S + +PA AF            +   KS Y T+       + P   AP+WK+SPE IL  
Sbjct: 16  SLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPEDILQL 75

Query: 71  TKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDAS 130
           T E I + + L+D+LA +E P+VESLVKP++ +EN    ++NQLTFLQHVSADK +RDAS
Sbjct: 76  TNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDAS 135

Query: 131 VEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGL 190
            +ATELLQDF IEAS+R DLF QFDK+W   KDD   K + FE YKF+EK HKDYVR GL
Sbjct: 136 TKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEKCHKDYVRAGL 195

Query: 191 NLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPK 250
           NLPEEKRN+VK+++KKI++NSL +SKNLGEQKE+V+FT E+L GVS SVM+QFEKF D  
Sbjct: 196 NLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEKFTD-T 254

Query: 251 TNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLL 310
              EK+KV+FKYPDI PVLKTA+ P+TRK A+  DQNKVPQNE LF+ETL+LR++LA LL
Sbjct: 255 DGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLL 314

Query: 311 GYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDD 370
           GYSTYANYNLDIKMAK QETV  F+ +LK+KLKPLG             DC+EL + +D+
Sbjct: 315 GYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCKELAIPFDN 374

Query: 371 HYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIK 430
           HYYIWD+RYYDNK+LK+NYNVD E+ISEY+PLE TI GML IYET+LKLKFV+ET+ + K
Sbjct: 375 HYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKK 434

Query: 431 DVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFP 490
            VWHEDVKQLAVWK+D  ++PEF+GWIYFDLHPRDGKY HAANFGI+SSY+ +DG RS P
Sbjct: 435 QVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV-RDGARSHP 493

Query: 491 VTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEA 550
           VTALVCNFSK + KKP+LLKH+EITTFFHELGHGIHDLVG N   RFNGPGATPWDFVEA
Sbjct: 494 VTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEA 553

Query: 551 PSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMT 610
           PSQMLEFWTWNKNEL +LS HY+TGEKI E LLDSLIATKHVNGALFALRQL FGLFDMT
Sbjct: 554 PSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMT 613

Query: 611 VHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVF 670
           VHT K++E L++  LWN+LR+++ LVENG+++TKG++SFGHIMS +YSAGYYGYMWAEVF
Sbjct: 614 VHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGYYGYMWAEVF 673

Query: 671 AADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728
           AADMY+TKFA+DPLN   GV+YRDIVL+ GGLYEI D L+EFLGREP N+AFLKELGL
Sbjct: 674 AADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKELGL 731

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/730 (65%), Positives = 595/730 (81%), Gaps = 18/730 (2%)

Query: 17  NKKLLISAIVLPATAFILTRKS-----FYMT--LPTNNKLLVAPTGTAPTWKWSPESILA 69
           NK +L+S + +PA A  +  ++     FY    +  N    +AP   +P W +SPE IL+
Sbjct: 19  NKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQ-LSPKWDFSPERILS 77

Query: 70  KTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDA 129
             K++ID + + Y+++ AIE PS+E+ V P +++EN+  L +NQLTFLQHVS DKLIRDA
Sbjct: 78  DAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDA 137

Query: 130 SVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDD---DDLKS---KDFETYKFIEKVHK 183
           S+EATEL+ +F IE S+R D+F+QFDKI+N +KD+   +DLK+   KD+E +K++EK HK
Sbjct: 138 SLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHK 197

Query: 184 DYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQF 243
           DYVR+GLNL EEKRN++K+IKK+IA NSL +SKNLGEQ E+V+FTKE+L+GVS+ VM+QF
Sbjct: 198 DYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQF 257

Query: 244 EKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLR 303
           E + D +T E+K+KVTFKYPDIFPVLKTA+ P TRK+A+ +DQNKVP+NE LF++TLKLR
Sbjct: 258 ETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLR 317

Query: 304 NQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEE 363
            QL ++LGY TYANYNLDIKMAKNQETV +F+ +LKDKLKPL +            + +E
Sbjct: 318 YQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQE 377

Query: 364 LGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVD 423
           L +AYDDHYYIWDHRYYDNK+LKD +NVDLE+ISEYYP+ESTI+GML IYET++ LKF++
Sbjct: 378 LNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIE 437

Query: 424 ETNPKIKDVWH-EDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYIT 482
           ET+  +K  W  +DVKQLAVWKMDD   PEF+GWIYFDLHPR+GKY HAANFG++ SYI 
Sbjct: 438 ETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYID 497

Query: 483 QDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGA 542
           +D  R +PVTALVCNFS +T  KP+LLKHNEITTFFHELGHGIHDLVG N   RFNGPGA
Sbjct: 498 KDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGA 557

Query: 543 TPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQL 602
            PWDFVEAPSQMLEFWTWNKNELLSLS HY+TGEKI E LL+SLIATKHVNGALFALRQL
Sbjct: 558 VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQL 617

Query: 603 HFGLFDMTVHTTKN---VEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSA 659
           HFGLFDM VHTT +   +++++L++LWN LRE+I LVENG+E+ KGYDSFGHIMSDSYSA
Sbjct: 618 HFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSA 677

Query: 660 GYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTN 719
           GYYGYMWAEVFA DMYY+KFA DPLN+++G++YRDI+LA GG+ E  D LKEFLGREP+ 
Sbjct: 678 GYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSK 737

Query: 720 DAFLKELGLH 729
           +AFLKELGL 
Sbjct: 738 EAFLKELGLQ 747

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/731 (67%), Positives = 578/731 (79%), Gaps = 16/731 (2%)

Query: 13  TRIANKKL-LISAIVLPATAFILTRKSFYMTLPTN----------NKLLVAPTGTAPTWK 61
            +++  KL L+  +VLP   F  +   FY +  +           +  LV P G  P W+
Sbjct: 15  VKVSRSKLTLLPFVVLPTALFATSH--FYQSSRSYSSTSSGLSRMSPQLVPPAGALPRWE 72

Query: 62  WSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVS 121
           +    I  +   +I++    YD L  I  PS+++LVKPYM++EN  GL+VNQL FLQHVS
Sbjct: 73  FPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLCFLQHVS 132

Query: 122 ADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKD---FETYKFI 178
           +DK IR+AS +ATELLQ+F IE S+R DLF QFDKIW ++K   +  S D   FE YKF+
Sbjct: 133 SDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQFEIYKFV 192

Query: 179 EKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSES 238
           EK HKD+VR GLNL EE RN+VKDIK KIASNSL +SKNLGEQKE++ F+KEQL GVS++
Sbjct: 193 EKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDGVSDT 252

Query: 239 VMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVE 298
           VMEQFE+  D  TNE  YKVTFKYPDIFPVLK A+  +TRK A+  DQNKVPQNE LFV 
Sbjct: 253 VMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVA 312

Query: 299 TLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXX 358
           TLKLR++LA LLGY TYANYNL+IKMAK Q TVF F+N+LKDKLKPLG+           
Sbjct: 313 TLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGILKSIKE 372

Query: 359 XDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLK 418
            +C+ELG+ +D  YYIWDHRYYD K+LKDN+NVD E I+EYYP++STI+GML IYET+ K
Sbjct: 373 AECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYETVFK 432

Query: 419 LKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISS 478
           LKFV+E +   K+VW+EDVKQ+AVWKMD+ K P F+GWIYFDLHPRDGKY HAANFGI+S
Sbjct: 433 LKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIAS 492

Query: 479 SYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFN 538
           SYI +DG RS+PVTALVCNFSKS+  KPSLLKHNEITTFFHELGHGIHDLVGKN+ ARFN
Sbjct: 493 SYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFN 552

Query: 539 GPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFA 598
           GPGATPWDFVEAPSQMLEF+TW+KN L SLS HY+TGE+I E LLDSLIATKHVNGALFA
Sbjct: 553 GPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFA 612

Query: 599 LRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYS 658
           LRQLHFGLFDMTVHT+K+V  L+LLKLW +LR++I LVENG + TKGYDSFGHIMSDSYS
Sbjct: 613 LRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYS 672

Query: 659 AGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPT 718
           AGYYGYMWAEVFA DMY TKFA +PL+S  G++YRDIVLANGGLYEI D LKEFLGREP+
Sbjct: 673 AGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFLGREPS 732

Query: 719 NDAFLKELGLH 729
            DAFLKELGL 
Sbjct: 733 KDAFLKELGLQ 743

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/684 (68%), Positives = 566/684 (82%), Gaps = 5/684 (0%)

Query: 50  LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGL 109
           L AP   APTW W+P  ++   +++ID + + YD+L  ++ P   + + PYM+YEN  G 
Sbjct: 59  LNAPQA-APTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGS 117

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDL-- 167
           ++NQLTFLQHVS++K IRDAS +AT+LLQ+F IE S+R  LF QFDKIWNQ+KD  D   
Sbjct: 118 LINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE 177

Query: 168 -KSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVS 226
              KD E Y+F+ KVH+D+VR GLNL E KR ++K+IKK IA+NSL ++ NLGEQ E+V+
Sbjct: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVA 237

Query: 227 FTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQ 286
           FTKE+L GVS+SVMEQFEKF D KT +E YKVTFKYPDIFPVLKTA+ P+TRK A+  DQ
Sbjct: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297

Query: 287 NKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLG 346
           NKV +N  LF  TLKLRNQLA +LGYSTYANYNL++KMAK Q++VF F+ +L D+LKPLG
Sbjct: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357

Query: 347 QXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTI 406
                        + +EL L +D+HYY+WDHRYYDNK+LKDNYNVDLE+ISEYYPL+STI
Sbjct: 358 SKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTI 417

Query: 407 KGMLGIYETLLKLKFVDETN-PKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRD 465
           +GML IYETLL LKF++E +  K K+VWH++VKQLAVWKMD+ +NPEF+GWIYFDLHPRD
Sbjct: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477

Query: 466 GKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGI 525
           GKY HAANFGISSSYI  + +RS+PVTALVCNFSK T  KP+LLKHNEITTFFHELGHGI
Sbjct: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537

Query: 526 HDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDS 585
           HDLVGKN  +RFNGPGA PWDFVEAPSQMLEFWTWNKNELLSLS HY+TGEKI  +LL+S
Sbjct: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597

Query: 586 LIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKG 645
           L+ATKHVNGALFALRQLHFGLFDM VHT+K++E+L+ LKLWNELRE++ LVENG+  TKG
Sbjct: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKG 657

Query: 646 YDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEI 705
           YDSFGHIMSDSYSAGYYGYMWAEVFA DMYYTKFA++PL ++ GV+YRD VLA GGLYEI
Sbjct: 658 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEI 717

Query: 706 ADKLKEFLGREPTNDAFLKELGLH 729
            D L +FLGR+P+N+AFLKELGL+
Sbjct: 718 EDNLIQFLGRKPSNEAFLKELGLN 741

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/706 (65%), Positives = 562/706 (79%), Gaps = 8/706 (1%)

Query: 23  SAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNLY 82
           S +V+P  AF   + +   ++ T    +V     AP+W ++ E +L +T E ID++  L 
Sbjct: 15  SLVVIPTLAFASFQFNAIRSIMTKTDFVVPQA--APSWNYTTEELLKQTHEAIDSSNELL 72

Query: 83  DSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSI 142
           DSL +I  PSVE+ V PY+H+EN    + NQLTFLQHVS+DK +RD S + TEL+++F I
Sbjct: 73  DSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGI 132

Query: 143 EASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKD 202
           E+S+R  LF+QFD +WNQ+KDD   K   FE YKF+EK HKD++R+GLNLPEE+R++VK+
Sbjct: 133 ESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKE 192

Query: 203 IKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKY 262
           IKKKI++NSL +SKNLGEQ E+++FTKE+L GVSE+VM+QFE  VD +    KYKVTFKY
Sbjct: 193 IKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFET-VD-EDGITKYKVTFKY 250

Query: 263 PDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDI 322
           PDIFPVLK+A+  +TRK A+I DQNKVPQNEALF+ETL+LRN LA+LL Y +YA+YNLDI
Sbjct: 251 PDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNLDI 310

Query: 323 KMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDN 382
           KMAK +E V  F+N+LK+KLKPLG+            +C+EL   YD  YYIWD+RYYDN
Sbjct: 311 KMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRYYIWDNRYYDN 370

Query: 383 KFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAV 442
           ++LK N+ +D E+I+EY+PLESTIKGML IYET+LKLKF++E N    D WH DVK+L+V
Sbjct: 371 QYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDN---GDTWHPDVKKLSV 427

Query: 443 WKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKST 502
           WKMDD   P F+GWIYFDLHPR+GKY HAANFGISSS++  DG RS+PVTALVCNFSK T
Sbjct: 428 WKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPT 486

Query: 503 DKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNK 562
             KP+LLKH+E+TTFFHELGHGIHDLVG N   RFNGP ATPWDFVEAPSQMLEFWTWNK
Sbjct: 487 KDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNK 546

Query: 563 NELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNL 622
            EL SLS HYQT EKI + LLDSL+ TKH+NGALFALRQLHFGLFDM VHTTK++  LN+
Sbjct: 547 KELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNV 606

Query: 623 LKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASD 682
            +LWN LRE+ICL++NG+  TKG++SFGHIMSDSYSAGYYGYMWA+VFA+DMYYTKF  D
Sbjct: 607 TELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLED 666

Query: 683 PLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728
           PLNS  GVQYRDI+LA GGLYEI D L EFLGR+P N AFLKELGL
Sbjct: 667 PLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/702 (62%), Positives = 549/702 (78%), Gaps = 6/702 (0%)

Query: 30  TAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIE 89
           T  + TR  F  ++ T      AP  T P+W ++P  I  +TKE+I+ +   YDS++ +E
Sbjct: 16  TPLLYTR--FLSSMTTTASFPTAPQ-TPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVE 72

Query: 90  EPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLD 149
            P+V + V+P+M +EN+ G I+NQLTFLQHVS+DK IRDASV+++  L + +I+ S+R D
Sbjct: 73  SPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHD 132

Query: 150 LFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIAS 209
           +F QF ++W   +   D  S + ET+++IEK +KDY+ +GL L E  R +VK+IKKKI+ 
Sbjct: 133 VFLQFARVWQDAQSQAD--SIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISV 190

Query: 210 NSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPK-TNEEKYKVTFKYPDIFPV 268
           NS+N+SKNLGEQKE+++FTKEQL+GV +S++ QFE     K +NE  YKVTFKYPDIFPV
Sbjct: 191 NSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPV 250

Query: 269 LKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQ 328
           +K A   +TRK A+++DQNKV +NEA+ ++TLKLR+++A LLGY TYANYNL  KMAK+ 
Sbjct: 251 MKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDS 310

Query: 329 ETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDN 388
            TV DF+N+LK KL PLG+            D ++     D +YYIWDHRYYDNK+L +N
Sbjct: 311 TTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLEN 370

Query: 389 YNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDE 448
           +NVDLE+ISE++PLE+TI GML IYETL  LKF++  NP+ K VWHEDVKQLAVW MDD 
Sbjct: 371 FNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDP 430

Query: 449 KNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSL 508
           K+P FIGWIYFDLHPRDGKY HAANFG+SSS++  D  RS+PVTALVCNFSKST  KPSL
Sbjct: 431 KSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSL 490

Query: 509 LKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSL 568
           LKHNEI TFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL+ L
Sbjct: 491 LKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHL 550

Query: 569 SGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNE 628
           S HY+TGEKI E L+DSLI TKHVNGALF LRQLHFGLFDM VH+ K++++L++   WN+
Sbjct: 551 SSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQ 610

Query: 629 LREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQA 688
           LR+ I L+ NG  L+KGY SFGHIMSDSYSAGYYGY+WAEVFA DMY+TKFA DPLN++ 
Sbjct: 611 LRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKN 670

Query: 689 GVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN 730
           G+QYRDIVLA GGL +I D LKEFLGREP+ DAFLKELGL N
Sbjct: 671 GIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/737 (63%), Positives = 563/737 (76%), Gaps = 21/737 (2%)

Query: 9   RYSSTRIANKKLLISAIVLPA-------------TAFILTRKSFYMTLPTNNKLLVAPTG 55
           R  +T   +KK   + I LP              T+ I        T  TN   L  P  
Sbjct: 12  RVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSLTPPQ- 70

Query: 56  TAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLT 115
             P+W++ PE IL++TKE I N    YD L AI+ P++E+L+ PY+++EN+  L++NQLT
Sbjct: 71  YPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQLT 130

Query: 116 FLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETY 175
           FLQHVS DK IRDAS+EAT LLQDF IE+  R+DLF+QFD IWNQ+KD  D + +DFE +
Sbjct: 131 FLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKD-EFEDFEIW 189

Query: 176 KFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGV 235
           +F+EK HKDYVR GLNLP +K  +VK+IKKKIA N L +SKNLGEQKEY+ FT E+LKGV
Sbjct: 190 RFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTAEELKGV 249

Query: 236 SESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEAL 295
            ESV+EQFEK V+ +   +K KVT+KYPDIFPVLK AQ P+TR  A++ DQNKVP+NE L
Sbjct: 250 PESVIEQFEK-VNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHL 308

Query: 296 FVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXX 355
           F +TLKLRN+LA +LGY TYANYNLDIKMAKN +TV  FVN+L  KL+   +        
Sbjct: 309 FKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKN 368

Query: 356 XXXXDCE-ELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYE 414
               + E E  + YD  YYIWDHRYYDNK+LK+N+NVD E+I+EYYPLESTI GML IYE
Sbjct: 369 LKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYE 428

Query: 415 TLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANF 474
           TLLKLKFV+    + K  WH+DVKQLAVWK+D  +NPEF+GWI+FDLHPRDGKY HAANF
Sbjct: 429 TLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANF 486

Query: 475 GISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKC 534
           G+SSSYI+ +G RS+P+TALVCNFSKST  KPSLLKH+EITTFFHELGHGIHDLVG N+ 
Sbjct: 487 GLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRI 546

Query: 535 ARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNG 594
            RFNGPGA PWDFVEAPSQMLEFWTWN  ELLSLS +Y+   KI   LL+SLI TKHVNG
Sbjct: 547 GRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNG 606

Query: 595 ALFALRQLHFGLFDMTVH--TTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHI 652
           ALFALRQLHFGLFDM VH  + + ++ L++ KLWN+LREKICL+ NG++ T GY+SFGHI
Sbjct: 607 ALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHI 666

Query: 653 MSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEF 712
           MS SYSAGYYGYMWAEVFA DMYYTKF +DPLN + GV+YRDIVLA GGLYEI D L+EF
Sbjct: 667 MSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEF 726

Query: 713 LGREPTNDAFLKELGLH 729
           LGR+P  DAFL+ELGLH
Sbjct: 727 LGRKPAKDAFLEELGLH 743

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/704 (62%), Positives = 555/704 (78%), Gaps = 5/704 (0%)

Query: 28  PATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAA 87
           P  + +L  +S Y ++       +AP    P W ++P  I  KT E+I+N+ N YDS++ 
Sbjct: 13  PVISPLLYTRSLY-SMANTTSFPIAPQA-PPNWSFTPSDISGKTNEIINNSNNFYDSMSK 70

Query: 88  IEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMR 147
           +E PSV + V+P+M +EN+ G I+NQLTFLQHVS+DK IRDASV ++  L + +I+ S+R
Sbjct: 71  VESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLR 130

Query: 148 LDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKI 207
            D+F QF ++W  V+   D  S + ET+K++EK +KDY+ +GL L E  R ++K+IKKKI
Sbjct: 131 HDIFLQFARVWQDVQSKAD--SVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKI 188

Query: 208 ASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKF-VDPKTNEEKYKVTFKYPDIF 266
           + NS+N+SKNLGEQKEY++FTKEQL+GV +S++ QFE    D  +NE  YKVTFKYPDIF
Sbjct: 189 SVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIF 248

Query: 267 PVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAK 326
           PV+K A   +TRK A+++DQNKVP+NEA+ ++TLKLR++LA LLGY TYANYNL  KMA+
Sbjct: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAE 308

Query: 327 NQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLK 386
           +  TV +F+N+LKDKL PLG+            D ++L    D +YYIWDHRYYDNK+L 
Sbjct: 309 DSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLL 368

Query: 387 DNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMD 446
           +N+NVDLE+ISEY+PLE+TI GML IYETL  LKF++  + + K VWH+DVKQ+AVW MD
Sbjct: 369 ENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMD 428

Query: 447 DEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKP 506
           D K+P F+GWIYFDLHPRDGKY HAANFG+SSS++  D  RS+PVTALVCNFSKST  KP
Sbjct: 429 DPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKP 488

Query: 507 SLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELL 566
           SLLKHNEI TFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL+
Sbjct: 489 SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELI 548

Query: 567 SLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLW 626
           +LS HY+TGEKI E L++SLI TKHVNGALF LRQLHFGLFDM VHT K++++L++   W
Sbjct: 549 NLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTW 608

Query: 627 NELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNS 686
           N+LR+ I L+ NG  L+KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMY+TKFA DPLN+
Sbjct: 609 NQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNA 668

Query: 687 QAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN 730
           + G+QYRDIVLA GGLY+I D LKEFLGREP+ DAFLKELGL N
Sbjct: 669 KNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/714 (62%), Positives = 558/714 (78%), Gaps = 9/714 (1%)

Query: 18  KKLLISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDN 77
           K    S I+ P    + TR  + M+  T+    +AP    P W ++P  I  KTKE+ID 
Sbjct: 7   KNWFTSPIISP---LLYTRSLYSMSNATS--FPIAPQA-PPNWTFTPNDINGKTKEIIDK 60

Query: 78  ATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELL 137
           + N Y+S++ +E P+V + V+P+M +EN+ G I+NQLTFLQHVS+DK IRDASV ++  L
Sbjct: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 138 QDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKR 197
            + +I+ S+R D++ QF ++W   +   D  S + ET+K+IEK +KDY+ +GL L E  R
Sbjct: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSD--SIERETFKYIEKSYKDYIHSGLELDESNR 178

Query: 198 NQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKF-VDPKTNEEKY 256
            ++KDIKKKI+ NS+N+SKNLGEQKEY++FTKEQL+GV +SV+ QFE    D   NE  Y
Sbjct: 179 LKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLY 238

Query: 257 KVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYA 316
           KVTFKYPDIFPV+K A   +TRK A+++DQNKVP+NEA+ ++TL+LR++LA LLGY TYA
Sbjct: 239 KVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYA 298

Query: 317 NYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIWD 376
           NYNL  KMAK+  TV DF+N+LKDKL PLG+            D ++L    D +YYIWD
Sbjct: 299 NYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWD 358

Query: 377 HRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHED 436
           HRYYDNK+L +N+NVDLE+ISEY+PLE+TI GML IYETL  LKF++  + + K VWH+D
Sbjct: 359 HRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDD 418

Query: 437 VKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVC 496
           VKQLAVW MDD K+P+F+GWIYFDLHPRDGKY HAANFG+SSS++T D  RS+PVTALVC
Sbjct: 419 VKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVC 478

Query: 497 NFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE 556
           NFSKST  KPSLLKHNEI TFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLE
Sbjct: 479 NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE 538

Query: 557 FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKN 616
           FWTWNKNEL+ LS HY+TGEKI E L+DSLI TKHVNGALF LRQLHFGLFDM VHT K+
Sbjct: 539 FWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD 598

Query: 617 VEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYY 676
           +++L++ + WN+LR+ I L+ NG  L+KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMY+
Sbjct: 599 LQNLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYH 658

Query: 677 TKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN 730
           TKFA DPLN++ G+QYRDIVLA GGL +I D LK+FLGREP+ DAFLKELGL N
Sbjct: 659 TKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/681 (64%), Positives = 540/681 (79%), Gaps = 4/681 (0%)

Query: 51  VAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLI 110
           +AP    PTW ++P  I  KT E+ID +   Y+ ++ +E PSV + ++P+M +EN+ G I
Sbjct: 35  IAPQA-PPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPI 93

Query: 111 VNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSK 170
           +N+LTFLQHVS+DK IRDASV+++  L + +I+ S+R D+F QF ++W   +   D   K
Sbjct: 94  INRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK 153

Query: 171 DFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKE 230
             ET+K+IEK +KD++ +GL L E  R ++K+IKKKI+ NS+N+SKNLGEQKEY++FTKE
Sbjct: 154 --ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTKE 211

Query: 231 QLKGVSESVMEQFEKFVDPKTNEEK-YKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKV 289
           QL+GV +S++ QFE     K  E+  YKVTFKYPDIFPV+K A   +TRK A+++DQNKV
Sbjct: 212 QLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKV 271

Query: 290 PQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXX 349
           P+NEA+ ++TLKLR++LA LLGY+TYA+YNL  KMAK+  TV DF+N+LK KL PLG+  
Sbjct: 272 PENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKE 331

Query: 350 XXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGM 409
                     D E      D +YYIWDHRYYDNK L +N+NVDLE+ISEY+PLE+TI GM
Sbjct: 332 LQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITGM 391

Query: 410 LGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYS 469
           L IYETL  LKF++   P+ K VWHEDVKQLAVW MDD K+P FIGWIYFDLHPRDGKY 
Sbjct: 392 LQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYG 451

Query: 470 HAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLV 529
           HAANFG+SSS++  D  RS+PVTALVCNFSKST  KPSLLKHNEI TFFHELGHGIHDLV
Sbjct: 452 HAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLV 511

Query: 530 GKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIAT 589
           G+NK +RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL+SLS HY+TGE+I E L+DSLI T
Sbjct: 512 GQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKT 571

Query: 590 KHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSF 649
           KHVNGALF LRQLHFGLFDM VHT K++E+L++   WN+LR++I L+ NG  L+KGYDSF
Sbjct: 572 KHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSF 631

Query: 650 GHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKL 709
           GHIMSDSYSAGYYGY+WAEVFA DMY+TKFA DPLN++ GVQYRDIVLA GGLY+I D L
Sbjct: 632 GHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNL 691

Query: 710 KEFLGREPTNDAFLKELGLHN 730
           KEFLGREP+ DAFLKELGL +
Sbjct: 692 KEFLGREPSKDAFLKELGLQS 712

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/707 (57%), Positives = 536/707 (75%), Gaps = 7/707 (0%)

Query: 22  ISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNL 81
           +S ++LPA A    R         N   L++P   AP+W ++ + I++  ++ ID  T  
Sbjct: 17  VSFLLLPALAIAGNRS--VHNQERNMSSLLSPK-LAPSWDFAADEIVSLAQKAIDEGTKF 73

Query: 82  YDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFS 141
           YDS+A++E P +E+ V   + +E++    ++QLTFLQHVSADK +RDAS+EAT+L+Q++ 
Sbjct: 74  YDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWG 133

Query: 142 IEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVK 201
           IE S R DL+ QF K+W Q KDD++LK  D E Y ++E V+KDY+  G+ LPEE RN++K
Sbjct: 134 IETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIK 193

Query: 202 DIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFK 261
           +IKKK+A+NSL +S NLGEQ +Y++FTK++L GVSE+ + QFEK ++     EKYK+TFK
Sbjct: 194 EIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKVIEDGV--EKYKMTFK 251

Query: 262 YPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLD 321
           YPDI PVL TA+ P+TRK AYI DQNKVPQNE + +ETLKLRN+LA++ G+ TYA+Y L+
Sbjct: 252 YPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLE 311

Query: 322 IKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYD 381
           +KMAK QETVF+F+ +LKDKL P G+            + +ELGL Y+  +  WD+RYYD
Sbjct: 312 MKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYNGSFNSWDYRYYD 371

Query: 382 NKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLA 441
           +K+LK+N++VD E++++Y+PL+ TI GML IY+ L  LKFV+ET    K+VWHEDVKQ A
Sbjct: 372 DKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFA 431

Query: 442 VWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKS 501
           VW +D + NPEF+GWIYFDLHPR+GKY HAANFG+ S Y+T++G R +PVT LVCNFSK 
Sbjct: 432 VWDLD-KCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKP 490

Query: 502 TDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWN 561
           +  +P+LLKH E+ TFFHELGHGIH LVGK++    NGP + PWDFVEAPSQMLEFW WN
Sbjct: 491 SSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWN 550

Query: 562 KNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLN 621
           K+++L LS HY+TGE+I ++L+DSLI TKHVN  L  LRQLHF LFDMTVHT K ++ L+
Sbjct: 551 KDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLD 610

Query: 622 LLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFAS 681
           +  LWN LRE++ L+ NG+ LTKGYDSF HIMS  YSAGYYGYMW+EVFAADMY+T FA 
Sbjct: 611 IKSLWNNLREEVTLISNGDVLTKGYDSFSHIMS-GYSAGYYGYMWSEVFAADMYHTMFAP 669

Query: 682 DPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728
           +PL++  G +YRDI+LA GGL +I D L+EFLGREP N AFLKELGL
Sbjct: 670 NPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/678 (49%), Positives = 475/678 (70%), Gaps = 4/678 (0%)

Query: 51  VAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLI 110
           + P   AP+W +S + +++ + ++I+    +Y ++   + P++++ + P +++E +  L+
Sbjct: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66

Query: 111 VNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSK 170
            NQL FL++VS D  IR+AS  AT +L D+ I  + + DL+Q FD++W Q KDD+  K +
Sbjct: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFKKE 126

Query: 171 DFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKE 230
           +FE Y+++EK    Y R+G+ +P E R ++ ++K KIA+  L +S NLGE+ EY++FTKE
Sbjct: 127 NFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKE 186

Query: 231 QLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVP 290
           +L+GV ++V+ QFEK ++     EK+KVTFKYPDI PVL+ A  P+TR+ A ++D+N+V 
Sbjct: 187 ELEGVPDTVLNQFEKIIEGGV--EKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244

Query: 291 QNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXX 350
            NE L  ETL+LR +LA LLG+  +A YNLD KMAKN+ETV  F+N+L +KL P+G+   
Sbjct: 245 ANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304

Query: 351 XXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGML 410
                    D +   L +D  +Y WD  YY NK L++ YNV+ + +++Y+P+ES I+GML
Sbjct: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364

Query: 411 GIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSH 470
            IY TL +LKFV+ T+   K VWHEDVKQ AVW +DDE NP+F GW+YFDLHPRDGKY H
Sbjct: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424

Query: 471 AANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVG 530
           AANFG+ S+Y  +DG +S+PVT LV NFSK T  +P+LLK  E+TTFFHELGHGIHDLVG
Sbjct: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484

Query: 531 KNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATK 590
            N     NGPG+ PWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKI + LLD+  +  
Sbjct: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544

Query: 591 HVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFG 650
            +N  L  L QL  GLFDM VH T++ +   + KLWN+L  +I L+   N  + GYDSFG
Sbjct: 545 GLNSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFG 603

Query: 651 HIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLK 710
           HIM+   +  YYGY+W++VFAADMY TKF  +P N+  GV+YRD +LA GGLY++ D L+
Sbjct: 604 HIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLR 662

Query: 711 EFLGREPTNDAFLKELGL 728
           +FLGR+P N AFL+ LGL
Sbjct: 663 KFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/680 (47%), Positives = 463/680 (68%), Gaps = 4/680 (0%)

Query: 51  VAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSL-AAIEEPSVESLVKPYMHYENDEGL 109
           + P    P W ++   ++     +   +  +Y+S+ +  +E ++++ + P ++ + +  L
Sbjct: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           + NQL FL++VS D  +R+AS+   ++L  +    S + DL+  F+ IW Q KDD++ K 
Sbjct: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKV 131

Query: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTK 229
            ++E YK++EK    Y RN  NL   +  ++  + +KI+ ++L +S NLGE+ EY++FT+
Sbjct: 132 TNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFTE 191

Query: 230 EQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKV 289
           E+L+GVS  V++QFE+ ++     +K KVTFKYPDI PVL+TA  P+TR+ AY++DQN+V
Sbjct: 192 EELEGVSPLVLDQFERIIEGGV--KKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249

Query: 290 PQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXX 349
             NE L  ETL LR ++AQL GY  YA YNL  KMAKN+ETV  F+ +L ++L P+G+  
Sbjct: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309

Query: 350 XXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGM 409
                     D +   L +D   Y WD+ YY+NK L++ Y +D E +++Y+P+ES I+GM
Sbjct: 310 REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGM 369

Query: 410 LGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYS 469
           L  Y+TL +LKFV+ T+P  K+VWHEDVKQ AVW +DDE  PEF GWIYFDL+PRDGKYS
Sbjct: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429

Query: 470 HAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLV 529
           HAANFG++S++  +DG +S+PVT LVCN +K T  + ++L+  EITT FHELGHGIH LV
Sbjct: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489

Query: 530 GKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIAT 589
             NK A  N  G+ PWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKI   LLD+   +
Sbjct: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNS 549

Query: 590 KHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSF 649
             +   L+ L QL  GLFDM VH T+    L + KLWN++R +I L+ + N  + GY++F
Sbjct: 550 SGLGSGLYYLGQLRLGLFDMYVH-TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608

Query: 650 GHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKL 709
           GHIM+ SYSAGYYGY+W++VFAADMY TKF S+P NS  G QYRD +LA GGLY++ D L
Sbjct: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668

Query: 710 KEFLGREPTNDAFLKELGLH 729
           ++FLGREP N AFL+ LG +
Sbjct: 669 RKFLGREPNNRAFLRGLGFN 688

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  390 bits (1003), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 198/415 (47%), Positives = 270/415 (65%), Gaps = 9/415 (2%)

Query: 316 ANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIW 375
           A Y L++K AKN + V  F+N+L++KLKP               +C+ELG  YD   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 376 DHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHE 435
           D  YY+ K L+DN++VD E+ ++Y+PLE TIK ML  Y TL +  FV+ET P  ++VWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 436 DVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALV 495
           D KQ +VWKMDD   P+F GW+YFDLHPRDGK+ H A F    + ++++G R +PVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 496 CNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNK-CARFNGPGATPWDFVEAPSQM 554
           CNFS  + +KP+LLKH E+  FFHELGHG H L+   + C         P DF+EAPSQM
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELCC---SSSWVPRDFIEAPSQM 285

Query: 555 LEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHT- 613
           LE+W W K+ +  LS H +TGE+I E L+D ++ +K  N A+  L Q+   L DM VH  
Sbjct: 286 LEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKH 343

Query: 614 TKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAAD 673
             + E L+L  LWN L E + L++N  E T+ Y SF HI+ + Y+AGYYGY W++VFAAD
Sbjct: 344 VGSYETLDLNALWNNLCEDVILIKNP-EPTRAYCSFSHIV-EGYAAGYYGYQWSKVFAAD 401

Query: 674 MYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728
           MY+++F    L+   G  Y D ++A GGLYE+ D L EFL REP N+A+L++ GL
Sbjct: 402 MYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 57 APTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVES 95
          AP+W  SP  I  K +  +++A  ++  LA ++ P+VE+
Sbjct: 10 APSWDLSPAQINDKVQTALESAARMFAELANVKLPTVET 48

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 164/642 (25%), Positives = 295/642 (45%), Gaps = 67/642 (10%)

Query: 115 TFLQHVSADKLIRDAS-----VEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           T  + +   + IR A      +EA +   +   E    L+  ++  ++ N+   D+ + S
Sbjct: 135 TLCRVIDLCEFIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDRELCELLNETLQDEQVLS 194

Query: 170 KDFETYKFIEKVH-KDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGE-QKEYVSF 227
           K  E  K +  +  +D++++G+ +   K++Q   + + I+     Y  N+ +  + ++  
Sbjct: 195 KLSEEEKKVGYILLQDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKV 254

Query: 228 TKEQL--KGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISD 285
            + +L   G+   V  Q  K +  K     YK+       F +LK    P+ RK  +++ 
Sbjct: 255 KRSELDNAGIEFDVACQLGKDITGKY----YKIPTYGHLPFLILKACTDPEIRKKIWVAM 310

Query: 286 QNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKP- 344
            +   Q        +K+R  LA  +G   YA Y +D KMAKN + V +F+ +L D LKP 
Sbjct: 311 HDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPK 370

Query: 345 -------LGQXXXXXXXXXXXXDCEELGLA---YDDHYYIWDHRYYDNKFLKDNYNVDLE 394
                  +              D +E+  A   +D  YY   HR      L D+Y +D+ 
Sbjct: 371 AAKELKFISDLIHNEKGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDV- 429

Query: 395 QISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFI 454
               YYPL + I+G+  I+E++  ++F      K  + W  DV++L V      +    I
Sbjct: 430 ----YYPLGNVIQGLSDIFESIYGIRFEPAVAGK-GETWSSDVRRLNVV----SEKEGLI 480

Query: 455 GWIYFDLHPRDGKYSHAANFGISSSY---------------ITQDGDR-SFPVTALVCNF 498
           G IY DL  R GK ++AA+F I  S                   DG +   P+ +L+CNF
Sbjct: 481 GIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNF 540

Query: 499 SK---STDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQML 555
           +    ++ +   LL  NEI T FHE+GH IH ++G+ +    +G   +  DFVE PS ++
Sbjct: 541 NTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGTRCST-DFVELPSVLM 599

Query: 556 EFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH--- 612
           E +  +   L  +  HY+TG+++   LL+  +             Q    + D  ++   
Sbjct: 600 EHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKN 659

Query: 613 TTKNVEDLNLLKLWNELREKI-CLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFA 671
             +N++ ++++K+++EL +++  LV++ +        FGH+    Y A YY Y++    A
Sbjct: 660 IVQNIDSVDVVKIYHELEKELEVLVDDESNWCA---KFGHLF--GYGATYYCYLFDRAIA 714

Query: 672 ADMYYTKFASDPLNSQAGVQYRDIVLANGGLYE----IADKL 709
           + ++   F  DP +   G ++++ VL  GGL E    +AD L
Sbjct: 715 SKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLREPWNCVADVL 756

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  180 bits (457), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 159/638 (24%), Positives = 289/638 (45%), Gaps = 53/638 (8%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++ V  DK    A+ +  E + +F    +  ++L    DK+   + D++ L  
Sbjct: 137 VIDLCEFIRSVHPDKEFLSAAQQCHEEMFEFMNTLNTDVELC---DKLKTLLHDNEILSK 193

Query: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQK-EYVSFT 228
              E  K    + +D+ ++G+ +    R Q  ++ ++I+    ++  N  + K  Y+   
Sbjct: 194 LSEEEIKVGRILLEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVN 253

Query: 229 KEQLK--GVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQ 286
             +L+  G++  ++   +K        E YK+    P  + VLK  +  + R   + +  
Sbjct: 254 ASKLESAGLNRLLLNSLKK----DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALH 309

Query: 287 NKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLG 346
           +   +        +KLR  LA L+G  +++ Y L  K+AK  + V +F+  L   ++P  
Sbjct: 310 SCSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNT 369

Query: 347 QXXXXXXXXXXXXDCEELGLAYDDHYYI----WDHRYYDNKFLKDNYNVD---LEQISEY 399
           +            D  ++     D        WD  YY + + K     +    E +S Y
Sbjct: 370 EKELKFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSY 429

Query: 400 YPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYF 459
           + L    +G+  +   +  +K ++   P   + W  DV+++ V  + +E+    IG IYF
Sbjct: 430 FTLGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINV--ISEEEG--IIGIIYF 484

Query: 460 DLHPRDGKYSHAANFGISSSY----------ITQDGDR------SFPVTALVCNFSKST- 502
           DL  R GK S+ A+F +  S           I Q G +        P+ +LVCNFS+ T 
Sbjct: 485 DLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTF 544

Query: 503 --DKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTW 560
             DK   LL  +EI T FHE+GH IH ++G+      +G      DFVE PS ++E +  
Sbjct: 545 QSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFAS 603

Query: 561 NKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTK---NV 617
           +   L  +S HY+TGEKI+E  L   +       +     Q    + D  +H+ K   N+
Sbjct: 604 DTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNL 663

Query: 618 EDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYT 677
           ++LN+++++  L  ++ ++ +      G   FGH+    Y A YY Y++    A  ++  
Sbjct: 664 DNLNVVEIYQNLERRLQVLVDDRSNWCG--KFGHLF--GYGATYYSYLFDRAIARKVWNH 719

Query: 678 KFASDPLNSQAGVQYRDIVLANGGLYE----IADKLKE 711
            FA+DP N   G ++++ +L  GG  +    IAD L E
Sbjct: 720 LFANDPFNKTNGEKFKESLLKWGGSKDPWQCIADVLDE 757

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  180 bits (456), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 147/563 (26%), Positives = 264/563 (46%), Gaps = 51/563 (9%)

Query: 183 KDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFTKEQL--KGVSESV 239
           +D+ ++G+++  E R Q   + ++I+    ++  N    +  Y+    E+L   G+++ V
Sbjct: 198 EDFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGINKIV 257

Query: 240 MEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVE 298
           + Q  K +  +     YK+ TF Y   + +L++      R   + +  +   +  A   +
Sbjct: 258 LNQLSKDIKGR----HYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIARLDQ 312

Query: 299 TLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXX 358
            +KLR+ LA ++G  ++A+Y L+ KMAK  E V  F+ +L D  KP              
Sbjct: 313 LIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLKA 372

Query: 359 XDCEELGLAYDDHYYI-----WDHRYYDN-KFLKDNYNVDLEQISEYYPLESTIKGMLGI 412
                   A   H  +     WD  +Y +   L+     + EQIS Y+ L   I+G+  +
Sbjct: 373 KHVPGNKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQGLSNL 432

Query: 413 YETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAA 472
           ++ +  + +++   PK  + W  +V+++ V      +    IG +Y DL  R GK ++ A
Sbjct: 433 FKQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQGKTANPA 487

Query: 473 NFGISSSYITQDGDR----------------SFPVTALVCNFSKST---DKKPSLLKHNE 513
           +F +  S    DG+                   PV +LVCNFS +T   ++   LL+ +E
Sbjct: 488 HFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLSE 547

Query: 514 ITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQ 573
           I T FHE+GH +H ++G+ K    +G      DFVE PS ++E +  +   L  ++ HY 
Sbjct: 548 IETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHYS 606

Query: 574 TGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH---TTKNVEDLNLLKLWNELR 630
           TGE I E LL S  +         A  Q    + D  +H     K ++ L+++KL++ L 
Sbjct: 607 TGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNLE 666

Query: 631 EKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGV 690
            ++ ++ +      G   FGH+    Y A YY Y++    A+ ++   FA+DP   ++G 
Sbjct: 667 RQLEVLSDDKSNWCG--RFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGE 722

Query: 691 QYRDIVLANGGLYE----IADKL 709
           ++++ VL  GG  +    IAD L
Sbjct: 723 KFKNSVLKWGGSRDPWECIADAL 745

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  180 bits (456), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 147/557 (26%), Positives = 258/557 (46%), Gaps = 58/557 (10%)

Query: 183 KDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKN---LGEQKEYVSFTKEQLKGVSESV 239
           +D+ ++G+ +  E R Q   + + I+     +  N   + +    VS  +    G+   +
Sbjct: 217 EDFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPEL 276

Query: 240 MEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVE 298
           + Q EK +  K     YK+ T+ Y   F +LK+    + R+  +++  N   +      +
Sbjct: 277 LSQIEKDIAGKN----YKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTD 331

Query: 299 TLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLG---------QXX 349
            +KLR  L+QLLG  +YA Y L+ KMAKN + V +F+  L D  KP+          +  
Sbjct: 332 LVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKL 391

Query: 350 XXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDL---EQISEYYPLESTI 406
                      C+ L          WD  YY     +     +L   E++ +Y+ L + +
Sbjct: 392 TIKSNGSNLSVCDILKTVRP-----WDRDYYSAIEREQTSAKNLYGSEEVLKYFTLGNVM 446

Query: 407 KGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDG 466
           +G+  +++ +  +K   +  PKI + W  +V+++ V   D+      IG IY DL  R G
Sbjct: 447 QGLSNLFQKIYGIKLELDV-PKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERSG 501

Query: 467 KYSHAANFGISSS-----YITQD----------GDR-SFPVTALVCNFSK---STDKKPS 507
           K S+AA+F I  S     Y T+D          G R   P+ +LVCNFSK   S      
Sbjct: 502 KTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVC 561

Query: 508 LLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLS 567
            L   E+ T FHE+GH +H ++G+ K    +G      DFVE PS ++E++  +   L +
Sbjct: 562 FLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLET 620

Query: 568 LSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH---TTKNVEDLNLLK 624
           +  HY T E +  ++L+  +             Q    + D T+H    + +++ L+++K
Sbjct: 621 IGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVK 680

Query: 625 LWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPL 684
           L+ +L  ++ ++ +      G   FGH+    YSA YY Y++    A+ ++   F  +P 
Sbjct: 681 LYQDLERQLGVLVDDKSNWCG--KFGHLFG--YSAVYYSYLFDRAIASKIWGALFERNPF 736

Query: 685 NSQAGVQYRDIVLANGG 701
           +  +G +YR+ VL  GG
Sbjct: 737 SRASGDKYRNSVLQWGG 753

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  177 bits (449), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 150/570 (26%), Positives = 267/570 (46%), Gaps = 62/570 (10%)

Query: 183 KDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFTKEQL--KGVSESV 239
           +D+ ++G+ +  + R++  ++ + I+    ++  N    + E++    E+L   GVS  +
Sbjct: 221 EDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPIL 280

Query: 240 MEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVET 299
           + Q    V        YKV       + +L++ +    RK  + +  +   +        
Sbjct: 281 LRQLTTTV----RGTHYKVPAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINRLTHM 336

Query: 300 LKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXX 359
           +K+R+ L+ ++G   +A Y L  KMAK+ E V +F+  L +  KP+              
Sbjct: 337 VKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLANMKLN 396

Query: 360 DCEELGLAYDDH-------YYIWDHRYYDNKFLKD----NYNVDLEQISEYYPLESTIKG 408
           D   LGL   +           WD  YY  K  +     N   + E I+ Y+ L S ++G
Sbjct: 397 D---LGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQLTNHEPINAYFTLGSVLEG 453

Query: 409 MLGIYETLLKLKF-VDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGK 467
           +  +++++  +   V  + P   + W  +V+++ V      +N   IG +Y DL  R  K
Sbjct: 454 LSNLFKSIYGISLEVVASIPG--ETWSSEVRRVNV----KTENNNIIGVVYCDLFERKAK 507

Query: 468 YSHAANFGISSSY----------ITQDGDRS------FPVTALVCNFSKSTDKKPSLLKH 511
            S  A+F +  S           I Q G  S       P+ +LVCNF++++D +  LL+ 
Sbjct: 508 TSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQL 567

Query: 512 NEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGH 571
           +EI T FHE+GH +H ++G+ K    +G   T  DFVE PS ++E +  +   L  +  H
Sbjct: 568 SEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRH 626

Query: 572 YQTGEKISEDLL-DSLIATKHV-NGALFALRQLHFGLFDMTVHTTK---NVEDLNLLKLW 626
           Y T EK+ EDLL + L +T+++ N   FA  Q    + D  ++      +V DL++++L+
Sbjct: 627 YITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQRLYDNNIIFHVRDLDVVELY 684

Query: 627 NELREKI-CLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLN 685
           ++L   +  LV++    T     FGH+    Y A YY Y+     AA ++   F +DP +
Sbjct: 685 HDLERNLEVLVDDQ---TNWCGKFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFS 739

Query: 686 SQAGVQYRDIVLANGGLYE----IADKLKE 711
              G  +++ VL  GGL +    IAD L +
Sbjct: 740 RTGGENFKNAVLKWGGLRDPWECIADVLDQ 769

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  173 bits (438), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 164/647 (25%), Positives = 293/647 (45%), Gaps = 72/647 (11%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++    D+    A+ +  E  Q F     +  D+      I   V +D ++ S
Sbjct: 134 VIDLCEFIRSTHPDEAFVKAAQDCHE--QMFEFMNVLNTDVV--LCDILKHVLNDPNINS 189

Query: 170 K-DFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKE-YVSF 227
           K   E  K  + + +D+ ++G+ +    R Q   + ++I+    ++  N+   K  +V  
Sbjct: 190 KLTPEEIKVGKLLLEDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKI 249

Query: 228 TKEQL--KGVSESVMEQFEKFVDPKTNEEKYKVTFKYP--DIFPVLKTAQVPKTRKLAYI 283
              +L   GV+  +++Q      PK    KY   +K P     P+      P     A +
Sbjct: 250 KCSELNKSGVNSLLLKQL-----PKDITGKY---YKIPTSGYIPISLIRSCPDATIRAKV 301

Query: 284 -SDQNKVPQNEAL-FVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDK 341
            +  +  P ++       +KLR  LA LL   ++A Y L+ KMAK  + V DF+  L D 
Sbjct: 302 WASLHSCPNDQIRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDY 361

Query: 342 LKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYI-------WDHRYYDNKFLKDNYNVDLE 394
           ++P                C+EL +   D           WD  YY     K   +V+L 
Sbjct: 362 MRP---KAAQELKFMADLKCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAK-DVNLY 417

Query: 395 Q---ISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNP 451
           +   I+ Y+ + + +KG+  I++ +  ++ ++   P+  + W  +V++L V      +  
Sbjct: 418 ENHPINMYFTMGNIMKGLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVI----SETE 472

Query: 452 EFIGWIYFDLHPRDGKYSHAANFGISSSY---------------ITQDGDR-SFPVTALV 495
             IG +Y DL  R GK S+ A+F +  S                   DG     PV +LV
Sbjct: 473 GLIGVVYCDLFERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLV 532

Query: 496 CNFSK---STDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPS 552
           CNFS    S DK   LL+ NEI T FHE+GH +H ++G+++    +G      DFVE PS
Sbjct: 533 CNFSSTLTSNDKMICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPS 591

Query: 553 QMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH 612
            ++E +  +K  L  +  HY+T E++SE ++++ +             Q    + D  ++
Sbjct: 592 ILMEHFARDKRVLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELY 651

Query: 613 TTKNVEDL---NLLKLWNELREKI-CLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAE 668
           +   ++DL   +++K++  L E +  LV+N +        FGH+    Y A YY Y++  
Sbjct: 652 SENIIKDLDHVDVVKIYQTLEEDLKVLVDNKSNWC---GKFGHLF--GYGASYYSYLFDR 706

Query: 669 VFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYE----IADKLKE 711
             A+ ++   FA DP + + G ++++ VL  GGL +    IAD L++
Sbjct: 707 AIASKVWDQLFAKDPFSREGGEKFKNCVLKWGGLRDPWHCIADVLEQ 753

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  172 bits (436), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 162/645 (25%), Positives = 293/645 (45%), Gaps = 70/645 (10%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++    D     A+ +  E + +F    +  + L      + N  K    L  
Sbjct: 136 VIDLCEFIRSTHPDDAFVKAAQDCHEQMFEFMNVLNTDVSLCNMLKTVLNSPKISSKLSE 195

Query: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIA---SNSLNYSKNLGEQKEYVS 226
           ++ +  K +     D+ ++G+ +  + R +   + ++I+      +N++   G     +S
Sbjct: 196 EELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKIS 252

Query: 227 FTKEQLKGVSESVMEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISD 285
             +     VS  +++Q  K V      + YKV TF Y   + +LK+ +  + RK  + + 
Sbjct: 253 CRELDNSNVSAFLLKQLNKDV----KGQNYKVPTFGYA-AYALLKSCEKEQVRKKIWTAL 307

Query: 286 QNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFV----NNLKDK 341
            +   +        +KLR  LA L+   +YA Y L+ KMAKN + V DF+    N+  DK
Sbjct: 308 HSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDK 367

Query: 342 ----LKPLGQXXXXXXXXXXXXDCEE-LGLAYDDHYYIWDHRYYDNKFLKDNYN--VDLE 394
               LK + +              +E L L        WD  YY  K+L+ N +     +
Sbjct: 368 TATELKFIAELKAKDLKKPLATKTDEILKLVRP-----WDRDYYTGKYLQLNPSNAPSAK 422

Query: 395 QISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKD---VWHEDVKQLAVWKMDDEKNP 451
           +IS Y+ L + I+G+  +++ +  +K      P I D    W  DV++L V  + +E+  
Sbjct: 423 EISSYFTLGNVIQGLSDLFQHIYGIKL----EPAIADEGETWSPDVRRLNV--ISEEEG- 475

Query: 452 EFIGWIYFDLHPRDGKYSHAANFGISSSY-------------ITQDGDRSF---PVTALV 495
             IG IY DL  R GK S+ A+F +  S              + ++ D SF   PV +LV
Sbjct: 476 -IIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLV 534

Query: 496 CNFSK---STDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPS 552
           CNF+    ++ K    L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS
Sbjct: 535 CNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPS 593

Query: 553 QMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH 612
            ++E +  +   L  +  HY+TGE +  D+L S + T +         Q    + D + H
Sbjct: 594 ILMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFH 653

Query: 613 ---TTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEV 669
                 N+++ +++K +  L  ++ ++ +      G   FGH+    Y A YY Y++   
Sbjct: 654 DEEVISNIDNYDVVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRT 709

Query: 670 FAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYE----IADKLK 710
            A+ ++Y  F  DP + + G +++  +L  GGL +    IAD L+
Sbjct: 710 IASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKDPWKCIADVLQ 754

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  171 bits (434), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 172/686 (25%), Positives = 299/686 (43%), Gaps = 62/686 (9%)

Query: 63  SPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGL---IVNQLTFLQH 119
           SPE +     + +  AT L  +L   E+ S E LV+  +  +    +   +++   FL+ 
Sbjct: 96  SPEGLRKFANKSLTEATALVRNLR--EDSSQEGLVRYIIRLDQLSDILCRVIDLCEFLRA 153

Query: 120 VSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSK-DFETYKFI 178
              D+    A+ E  E  Q F I   +  D+     K   QV  D+++ SK   E  +  
Sbjct: 154 AHPDEQFVAAAQECHE--QMFEIMNILNTDVV--LCKRLKQVLSDENISSKLSSEEIRVG 209

Query: 179 EKVHKDYVRNGLNLPEEKRNQVKDIKKKIA---SNSLNYSKNLGEQKEYVSFTKEQLKGV 235
             + +D+ + G     E R Q   + + I+    + +N +++L      +     +  G 
Sbjct: 210 HILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLESSGT 269

Query: 236 SESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEAL 295
           S  V+ Q  K  D   N  K   +   P  + +L        R+  + +  +   +    
Sbjct: 270 SHLVLRQLTK--DTMGNNYKIPTSGYAP--YTLLNACPSEAIRRQVWTAMFSCSEKQVKR 325

Query: 296 FVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPL--GQXXXXXX 353
               L+LR +LA ++G + Y +Y L+ KMAK+ E V +F+N L D  KPL  G+      
Sbjct: 326 LKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEELAK 385

Query: 354 XXXXXXDCEELGLAYDDHYYIWDHRYYDN---KFLKDNYNVD-LEQISEYYPLESTIKGM 409
                 +  E           WD  YY +    F + N+ VD    I+ Y+ L   ++G+
Sbjct: 386 LKRNVENLSETNTL--KLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGI 443

Query: 410 LGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYS 469
             ++  +  +  +     +  + W  DV++L V      +    IG IY DL  R GK +
Sbjct: 444 SDLFRDIYGIS-LKPVVAQAGETWAPDVRKLQVIS----ETEGIIGLIYCDLLERPGKTT 498

Query: 470 HAANFGISSSYI---------------TQDGDR-SFPVTALVCNFSKST---DKKPSLLK 510
             ++F +  S                   DG R   PV +L+CNF  +    +K   LL+
Sbjct: 499 SPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLCLLE 558

Query: 511 HNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSG 570
            +++ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  ++  LL +S 
Sbjct: 559 LSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLLRISS 617

Query: 571 HYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNEL- 629
           +Y TGE I E+LL +     +         Q+   + D  +H+  + +D  ++ +++ L 
Sbjct: 618 NYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQDD--IIAVYHGLE 675

Query: 630 REKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAG 689
           RE   LV++    T     FGH+    Y A YY Y+     AA ++   F  DP +  +G
Sbjct: 676 REMEVLVDDQ---TNWCGRFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSSG 730

Query: 690 VQYRDIVLANGGLYE----IADKLKE 711
            ++++ VL  GG  +    IAD L E
Sbjct: 731 EKFKEGVLKWGGSRDAWQCIADALDE 756

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 151/623 (24%), Positives = 292/623 (46%), Gaps = 67/623 (10%)

Query: 131 VEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSK-DFETYKFIEKVHKDYVRNG 189
           V A +L  +   E    L+      +I  +V  DD + SK   E  K  + + +D+ ++G
Sbjct: 151 VRAAQLCHEEMFEFMNVLNTDSTLCEILKRVLSDDLIASKLSEEELKVGKILLEDFEKSG 210

Query: 190 LNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFTKEQLK--GVSESVMEQFEKF 246
           +++  E   Q  ++ ++I+     +  N    + EYV  +  +L+  G+S  ++    + 
Sbjct: 211 IDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLLLNHLSR- 269

Query: 247 VDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQ 305
               T  + YKV T+ Y   F +L++      R   + +  +   +        +KLR  
Sbjct: 270 ---DTKGQNYKVPTYGYI-AFSILRSCPSENIRMKVWTAVHSCPEKQITRLKHLVKLRGL 325

Query: 306 LAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXXDCEELG 365
           LAQ++G ++Y++Y L+ KMAK+   V  FV +L + +KPL                 +L 
Sbjct: 326 LAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLKSSHL-DLP 384

Query: 366 LAYDDHYYI-----WDHRYYDN--KFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLK 418
           +   D   +     WD  +Y       +    ++ EQI+ Y+ L + ++G+  + E +  
Sbjct: 385 IPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLSSLLEDIYG 444

Query: 419 LKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISS 478
           ++ ++    K+ + W  +V+++ V  + D++    IG +Y DL  R GK S+ A+F +  
Sbjct: 445 IR-LEPAVAKVGETWSPEVRRINV--VSDQEG--VIGVVYCDLFERQGKTSNPAHFTVCC 499

Query: 479 SY----------ITQDGDR-------SFPVTALVCNFSKSTDKKP--SLLKHNEITTFFH 519
           S             Q G +         PV +LVC+FS+++  K    LL+ +E+ T FH
Sbjct: 500 SRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFH 559

Query: 520 ELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKIS 579
           E+GH IH ++G+      +G      DFVE PS ++E +  +   L  +  HY T E + 
Sbjct: 560 EMGHAIHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFAHDSRVLSRIGKHYITNEPVP 618

Query: 580 EDLLDSLIATKHVNGALF-------ALRQLHFGLFDMTVHTTKNVED--LNLLKLWNELR 630
           ++LL       H+N              Q    + D  +H+ + + D  ++++++++E+ 
Sbjct: 619 DELL-------HLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVE 671

Query: 631 EKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGV 690
           +++ ++ +      G   FGH++   Y A YY Y++    A+ ++   FA+DP + ++G 
Sbjct: 672 KQMGVLTDDKSNWCG--RFGHLL--GYGASYYSYLFDRAIASKVWQHLFANDPFSRKSGE 727

Query: 691 QYRDIVLANGGLYE----IADKL 709
           ++++ VL  GG  +    IAD L
Sbjct: 728 KFKNSVLRWGGSRDPWNCIADAL 750

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  169 bits (427), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 158/624 (25%), Positives = 285/624 (45%), Gaps = 51/624 (8%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++    D      S E  EL+  F    ++  D+  Q       + +D+ + S
Sbjct: 154 VIDLCEFIRSAHPDDEYLKVSQECYELM--FEFMNTLNTDV--QLCYTLKHILEDEKICS 209

Query: 170 K-DFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSF 227
           K   E YK  + + +D+ ++G+ +    R +  ++ ++I+     +  N     K  +  
Sbjct: 210 KLTDEEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKNNILI 269

Query: 228 TKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQN 287
            +E L  +SE  +  F   +      + YK+    P  + +L        RK  +    +
Sbjct: 270 DRESL-NLSELELP-FTYQLKTDITGKHYKIPTTGPIPYSILTNCSNETIRKKIWTELHS 327

Query: 288 KVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQ 347
              +      + + LR +LA+LL   ++A Y L  KMAKN E V  F++ L D  KPL  
Sbjct: 328 CSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAI 387

Query: 348 XXXXXXXXXXXXDCEELGLAY-DDHYYI------WDHRYYD--NKFLKDNYNVDLEQISE 398
                       D   LGLA+ +D  +I      WD  YY   N++       DL ++  
Sbjct: 388 KELTSLAEVKAAD---LGLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPY 444

Query: 399 YYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIY 458
           Y+ L + I G+  ++  +  ++F +   PK+++ W  +V++L V      ++   IG +Y
Sbjct: 445 YFSLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVY 499

Query: 459 FDLHPRDGKYSHAANFGISSSYITQDGDR---------------SFPVTALVCNFSKS-- 501
            DL  R  K ++AA+F I  S     G+                  P+ +L+CNFSKS  
Sbjct: 500 CDLFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHL 559

Query: 502 -TDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTW 560
             +  P  L+ +EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  
Sbjct: 560 FEENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAK 618

Query: 561 NKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVE-- 618
           +   + S+S HY + E  S +LL + + +      L    Q    + D  +H+ +  E  
Sbjct: 619 DVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQ 678

Query: 619 -DLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYT 677
            D+N++K +N+L +K+ L  +      G   FGH+    Y A YY Y++    A+ ++ +
Sbjct: 679 KDINVVKSYNDLEKKLELFSDDQSNWCG--KFGHLF--GYGASYYSYLFDRAIASKVWES 734

Query: 678 KFASDPLNSQAGVQYRDIVLANGG 701
            F  +P +  +G++++D VL  GG
Sbjct: 735 LFKQNPFSRTSGLKFKDSVLRWGG 758

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 165/689 (23%), Positives = 302/689 (43%), Gaps = 83/689 (12%)

Query: 63  SPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSA 122
           SPE +   ++  + +A  L D +      S E L    M  +     +   +   + + +
Sbjct: 98  SPEGLRKFSRRSLTHAQGLLDDMR--NNKSFEGLTAYVMRLDQLSDTLCRVIDLCEFIRS 155

Query: 123 DKLIRDAS-VEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKV 181
                D+S +EA +   +   E    L+   +      QV  D ++K K       + K+
Sbjct: 156 SH--PDSSFIEAAQACHEEMFEFMNILNTDVELCDTLRQVLTDPEIKGKLSNEEITVGKI 213

Query: 182 H-KDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFTKEQL--KGVSE 237
             +D+ ++G+ +  E R+Q   + ++I+     +  N    +  Y+    E++   G+++
Sbjct: 214 LLEDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNSGINK 273

Query: 238 SVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFV 297
            ++ Q  K V  K     YK+       + +L++    + R   + +      +      
Sbjct: 274 LLISQLPKDVRGKY----YKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQINRLD 329

Query: 298 ETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXX 357
           + L+LR  LA+L+G  ++A Y L+ KMA+  + V DF+  L + ++P             
Sbjct: 330 QLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRP------------- 376

Query: 358 XXDCEELGLAYD--------------------DHYYIWDHRYYDNKF-LKDNYN-VDLEQ 395
               EEL   Y+                         WD  YY + + L+   + +D EQ
Sbjct: 377 -KTIEELKFIYELKSKQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQ 435

Query: 396 ISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIG 455
           IS Y+ L + I+G+  ++E++  ++ ++   PK  + +  +V++L V      +    IG
Sbjct: 436 ISSYFTLGNVIQGLSDLFESIYGIR-LEPVVPKTGETFSPEVRRLNVVC----EQEGVIG 490

Query: 456 WIYFDLHPRDGKYSHAANFGISSSY----------ITQDGDRS------FPVTALVCNFS 499
            +Y DL  R GK S+ ++F +  S             Q G  S       PV ALVCNFS
Sbjct: 491 VVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFS 550

Query: 500 KSTD---KKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE 556
            STD   K   LL+ NE+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E
Sbjct: 551 SSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILME 609

Query: 557 FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKN 616
            +  +   L  +  H++TG  ISE LL + +             Q    + D  +H  K 
Sbjct: 610 HFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKV 669

Query: 617 VED---LNLLKLWNEL-REKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAA 672
           ++D    ++   + +L R+   LV++ +        FGH+    Y A YY Y++    A+
Sbjct: 670 IKDFDHFDVTAAYQQLERDMKVLVDDKSNWC---GKFGHLF--GYGATYYSYLFDRAIAS 724

Query: 673 DMYYTKFASDPLNSQAGVQYRDIVLANGG 701
            ++ + F+SDP +   G ++++ VL  GG
Sbjct: 725 KVWDSLFSSDPYSRVNGEKFKECVLKWGG 753

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 159/689 (23%), Positives = 309/689 (44%), Gaps = 59/689 (8%)

Query: 63  SPESILAKTKEVIDNATNLYDSLAAIEEP-SVESLVKPYMHYENDEGLIVNQLTFLQHVS 121
           SP+ +   +++ ++ A  L + +   E P  +++ +       +    +++   F++   
Sbjct: 97  SPDGLRKFSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSH 156

Query: 122 ADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKV 181
            D    DA+ +  E + +F    +  ++L  +   + N  +    L S++ +  K +   
Sbjct: 157 PDSHFVDAAQDCHEEMFEFMNVLNTDVNLCNKLRTVLNTPEVVCKLSSEEVKVGKIL--- 213

Query: 182 HKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFTKEQL--KGVSES 238
            +D+ ++G+ +  E R Q   + ++I+    ++  N    +  Y++   E +   G+++ 
Sbjct: 214 LEDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQL 273

Query: 239 VMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVE 298
           ++ Q  K +  K     YK+       + VL+       RK  + +  +  P  + + ++
Sbjct: 274 ILSQLSKDIKGK----HYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIVRLD 328

Query: 299 TL-KLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKP-----LGQXXXXX 352
            L +LR  LA L+G  +YA Y L+ KMAK+ E V DF+++L    +P     LG      
Sbjct: 329 QLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFISDLK 388

Query: 353 XXXXXXXDCEELGLAYDDHYYIWDHRYYDNKF---LKDNYNVDLEQISEYYPLESTIKGM 409
                    E   L   D    WD  +Y   +    +    +D +QIS Y+ L + ++G+
Sbjct: 389 RKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVMQGL 448

Query: 410 LGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYS 469
             ++  +  ++ ++    +  + W  +V++L V  + DE+    IG +Y DL  RDGK S
Sbjct: 449 SDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNV--VSDEEG--VIGVVYCDLFERDGKTS 503

Query: 470 HAANFGISSSY---------------ITQDGDR-SFPVTALVCNFSKST---DKKPSLLK 510
           + ++F +  S                  +DG +   P+ +LVCNF+ S     +   LL 
Sbjct: 504 NPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLCLLH 563

Query: 511 HNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSG 570
            +EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +  
Sbjct: 564 ISEIETLFHEMGHAMHSMLGRTRLQNLSGTRCAT-DFVELPSILMEHFARDTRVLRQIGK 622

Query: 571 HYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH---TTKNVEDLNLLKLWN 627
           H  TGE + E LL + +             Q    + D  +H       ++ L+++ L+ 
Sbjct: 623 HCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVALYQ 682

Query: 628 EL-REKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNS 686
            L RE   LV++ +        FGH+    Y A YY Y++    A+ ++ + F  DP + 
Sbjct: 683 NLERELRVLVDDQSTWC---GRFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPFSR 737

Query: 687 QAGVQYRDIVLANGGLYE----IADKLKE 711
             G ++++ VL  GG  +    IAD L +
Sbjct: 738 AGGQRFKEYVLKWGGAKDPWQCIADVLDQ 766

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 145/566 (25%), Positives = 266/566 (46%), Gaps = 57/566 (10%)

Query: 184 DYVRNGLNLPEEKRNQVKDIKKKIA---SNSLNYSKNLGEQKEYVSFTKEQLKGVSESVM 240
           D+ ++G+ +  + R +  ++ ++I+      +N++   G     +         VS  ++
Sbjct: 204 DFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDLDNGNVSAFLL 263

Query: 241 EQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVET 299
           +Q  K V      + YK+ TF Y   + +LK+ +  + RK  + +  +   +        
Sbjct: 264 KQLNKDV----KGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHL 318

Query: 300 LKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXX 359
           +KLR  LA L+   +YA Y L+ KMAKN + V DF+  L +                   
Sbjct: 319 IKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTK 378

Query: 360 DCEE-LGLAYDDHYYI---WDHRYYDNKFLKDNYN--VDLEQISEYYPLESTIKGMLGIY 413
           D ++ L    DD   +   WD  YY  K+L+ N +   + ++IS Y+ L + I+G+  ++
Sbjct: 379 DLKKPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLF 438

Query: 414 ETLLKLKFVDETNPKIKD---VWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSH 470
           + +  ++      P+I D    W  DV++L V  + +E+    IG IY DL  R+GK S+
Sbjct: 439 QHIYGIRL----EPEIADEGETWSPDVRRLNV--ISEEEG--IIGIIYCDLFERNGKTSN 490

Query: 471 AANFGISSSY-------------ITQDGDRSF---PVTALVCNFSK---STDKKPSLLKH 511
            A+F +  S              + ++ D S+   PV +LVCNF+    ++ K    L+ 
Sbjct: 491 PAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQL 550

Query: 512 NEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGH 571
           +E+ T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +S H
Sbjct: 551 SEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKH 609

Query: 572 YQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH---TTKNVEDLNLLKLWNE 628
           Y+TGE I   +L S + T +         Q    + D + H      ++++ +++K +  
Sbjct: 610 YETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQA 669

Query: 629 LREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQA 688
           L  ++ ++ +      G   FGH+    Y A YY Y++    A+ ++Y  F  DP + + 
Sbjct: 670 LERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKN 725

Query: 689 GVQYRDIVLANGGLYE----IADKLK 710
           G +++  +L  GGL +    IAD L+
Sbjct: 726 GDKFKKHLLKWGGLKDPWKCIADVLE 751

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 149/625 (23%), Positives = 278/625 (44%), Gaps = 51/625 (8%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQD--FSIEASMRLDLFQQFDKIWNQVKDDDDL 167
           +++   FL+    D+    + VEA ++  +  F     +  D+    +K+   ++D + L
Sbjct: 123 VIDLCEFLRSAHPDQ----SYVEAAQMCHEEMFEFMNVLNTDVVL-CNKLKEVLEDPEIL 177

Query: 168 KSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVS 226
           K    E  K  E +  D+ ++G+ +    R Q  ++ ++I+     +  N     KE++ 
Sbjct: 178 KVLSEEERKVGEILLDDFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIK 237

Query: 227 FTKEQL--KGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYIS 284
             ++++   G+S  +  +  + +  K     YK+         +LK+      RK  + +
Sbjct: 238 VKRDEMDKSGISPLLTARLNRDLTGKY----YKIPTYGQIPLQILKSCPDEDIRKEVWAA 293

Query: 285 DQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKP 344
             N          + ++LR  L+ LLG  +Y++Y LD KMA + E V  F+  L +  KP
Sbjct: 294 LHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKP 353

Query: 345 LGQXXXXXXXXXXXXDCEELGLAYDDHYYI---WDHRYYDNKFLKDNYNVDL--EQISEY 399
           L                +   ++ ++   I   WD  Y+ +K+  DN    +  EQ+  Y
Sbjct: 354 LAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYY 413

Query: 400 YPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYF 459
           + L + I G+  +++ +  +  +  +  +  + W  DV++L V  + +E+    +G IY 
Sbjct: 414 FSLGNVINGLSELFKRIYGIT-LQPSRTENGETWSPDVRRLDV--ISEEEG--LVGVIYC 468

Query: 460 DLHPRDGKYSHAANFGISSSY----------ITQDGDRS------FPVTALVCNFSK--- 500
           DL  R GK S+ A+F +  S             Q G  S       PV +LVCNFS    
Sbjct: 469 DLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVAL 528

Query: 501 STDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTW 560
               +   L  NEI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  
Sbjct: 529 PNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFAR 587

Query: 561 NKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTT---KNV 617
           +   L ++  HY+T E   E LL+  +             Q    + D  +H +    ++
Sbjct: 588 DIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDI 647

Query: 618 EDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYT 677
           E ++  K++ +L  ++ ++ +      G   FGH+    Y A YY Y++    A+ ++ +
Sbjct: 648 ERIDSAKIYQKLETRLQVLADDESNWCG--RFGHLF--GYGATYYSYLFDRAIASKVWDS 703

Query: 678 KFASDPLNSQAGVQYRDIVLANGGL 702
            F  DP N   G ++++ VL  GGL
Sbjct: 704 LFKDDPFNRTGGEKFKERVLKWGGL 728

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  163 bits (413), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 149/529 (28%), Positives = 246/529 (46%), Gaps = 64/529 (12%)

Query: 235 VSESVMEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNE 293
           VS  +++Q  K V      + YKV TF Y   F +LK+ ++   RK  + +  +   +  
Sbjct: 258 VSTFLLKQLNKDV----KGQNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQI 312

Query: 294 ALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFV----NNLKDK----LKPL 345
                 +KLR  LA L+   +YA Y L+ KMAKN + V DF+    NN  DK    LK +
Sbjct: 313 KRLDRLIKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFI 372

Query: 346 GQXXXXXXXXXXXXDCEE-LGLAYDDHYYIWDHRYYDNKFLKDN-YNV-DLEQISEYYPL 402
                         + +E L L        WD  YY  K+++ N  NV   ++IS Y+ L
Sbjct: 373 ADLKAKDLKKPLTTNTDEILKLVRP-----WDRDYYTGKYIQLNPSNVPSAKEISYYFTL 427

Query: 403 ESTIKGMLGIYETLLKLKFVDETNPKIKD---VWHEDVKQLAVWKMDDEKNPEFIGWIYF 459
            + I+G+  +++ +  ++      P I D    W  DV++L V  + +E+    IG IY 
Sbjct: 428 GNVIQGLSDLFQQIYGIRL----EPAIADEGETWSPDVRRLNV--ISEEEG--IIGIIYC 479

Query: 460 DLHPRDGKYSHAANFGISSSY----------ITQDGDR------SFPVTALVCNFSK--- 500
           DL  R+GK S+ A+F +  S             Q G+         PV +LVCNFS    
Sbjct: 480 DLFERNGKTSNPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPI 539

Query: 501 STDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTW 560
           ++ K    L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS ++E +  
Sbjct: 540 ASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAK 598

Query: 561 NKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTK---NV 617
           +   L  +  HY+TGE I + +L   + T +         Q    + D + H  K   ++
Sbjct: 599 DIRVLTRIGKHYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDI 658

Query: 618 EDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYT 677
           ++ N++  +  L   + ++ +      G   FGH+    Y A YY Y++    A+ ++YT
Sbjct: 659 DNFNVVDNYQALERHLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYT 714

Query: 678 KFASDPLNSQAGVQYRDIVLANGGLYE----IADKLKEFLGREPTNDAF 722
            F  DP +   G +++  +L  GGL +    IAD L+  +  +  +DA 
Sbjct: 715 LFDDDPYSRNNGDKFKKHLLKWGGLKDPWKCIADVLECPMLEKGGSDAM 763

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 160/659 (24%), Positives = 295/659 (44%), Gaps = 74/659 (11%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++    D     A+ +  E + +F    +  + L      + N  +    L +
Sbjct: 133 VIDLCEFIRSTHPDDAFVRAAQDCHEQMFEFMNVLNTDVSLCNILKSVLNNPEVSSKLSA 192

Query: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIA---SNSLNYSKNLGEQKEYVS 226
           ++ +  K +     D+ ++G+ +  + R +   + ++I+      +N++   G     + 
Sbjct: 193 EELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKIP 249

Query: 227 FTKEQLKGVSESVMEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISD 285
                   VS  +++Q  K V      + YKV TF Y   + +LK+ +    RK  + + 
Sbjct: 250 CKDLDNSKVSTFLLKQLNKDV----KGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTAL 304

Query: 286 QNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFV----NNLKDK 341
            +   +        +KLR  LA L+  ++YA Y L+ KMAKN + V DF+    NN  +K
Sbjct: 305 HSCSDKQVKRLSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEK 364

Query: 342 ----LKPLGQXXXXXXXXXXXXDCEE-LGLAYDDHYYIWDHRYYDNKFLKDN--YNVDLE 394
               LK + +            + +E L L        WD  YY  K+ + N   + + +
Sbjct: 365 TANELKFIAELKAKDLKKPLTTNTDEILKLVRP-----WDRDYYTGKYFQLNPSNSPNAK 419

Query: 395 QISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKD---VWHEDVKQLAVWKMDDEKNP 451
           +IS Y+ L + I+G+  +++ +  ++      P I D    W  DV++L V  + +E+  
Sbjct: 420 EISYYFTLGNVIQGLSDLFQQIYGIRL----EPAITDEGETWSPDVRRLNV--ISEEEG- 472

Query: 452 EFIGWIYFDLHPRDGKYSHAANFGISSSY-------------ITQDGDRSF---PVTALV 495
             IG IY DL  R+GK S+ A+F +  S              + ++ D ++   PV +LV
Sbjct: 473 -IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLV 531

Query: 496 CNFSK---STDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPS 552
           CNFS    ++ K    L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS
Sbjct: 532 CNFSPILIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPS 590

Query: 553 QMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH 612
            ++E +  +   L  +  HY TGE I  D+L   + + +         Q    + D + H
Sbjct: 591 ILMEHFAKDIRILTKIGKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFH 650

Query: 613 TTKNVEDLNLLKLWN-----ELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWA 667
             K + D++   +       E R K+ + +  N   +    FGH+    Y A YY Y++ 
Sbjct: 651 DEKIISDIDNFDVVENYQALERRLKVLVDDQSNWCGR----FGHLF--GYGATYYSYLFD 704

Query: 668 EVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYE----IADKLKEFLGREPTNDAF 722
              A+ ++Y  F  DP + + G +++  +L  GGL +    IAD L+  +  +  +DA 
Sbjct: 705 RTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKDPWKCIADVLECPMLEKGGSDAM 763

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  159 bits (401), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 136/520 (26%), Positives = 242/520 (46%), Gaps = 73/520 (14%)

Query: 234 GVSESVMEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQN 292
           GVS+ V++Q  K +  K     YK+ T+ Y   + +++T      RK  + +  +   + 
Sbjct: 265 GVSQMVLQQLSKDLSGKF----YKIPTYGYLP-YSIIRTCPSEYIRKKVWTAMYSCPEKQ 319

Query: 293 EALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXX 352
                + ++LR QLA ++G   YA Y L+ KMAK+ + V +F+N L +  KPL       
Sbjct: 320 IKRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAM----- 374

Query: 353 XXXXXXXDCEEL----GLAYDDH----------YYIWDHRYYDNKFL----KDNYNVDLE 394
                    EEL     + +D+H             WD  Y+ +  L    +    +  +
Sbjct: 375 ---------EELKPLADMKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQ 425

Query: 395 QISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFI 454
            ++ Y+ L   I+G+  +++++  ++ ++    K  + W  +V+++ V     E N   I
Sbjct: 426 SLNCYFSLGVVIQGLSDLFQSIYGIR-LEPVVAKTGETWDPEVRKIQVI---SEANG-VI 480

Query: 455 GWIYFDLHPRDGKYSHAANFGISSSY-------------ITQDGDRS---FPVTALVCNF 498
           G IY DL  R GK  + A+F +  S              +    D+S    PV +LVCNF
Sbjct: 481 GVIYCDLFERQGKTPNPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNF 540

Query: 499 S--KSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE 556
           S  ++ D    LL+ +E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E
Sbjct: 541 SHTQADDDSICLLQLSEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILME 599

Query: 557 FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHT-TK 615
            +  +   L  +S HY TGE++ +++L +               Q+   + D  +H+ T 
Sbjct: 600 HFAKDLRVLSRISSHYATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD 659

Query: 616 NVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMY 675
           N ED  ++ +++ L +++ ++ +      G   FGH+    Y A YY Y+     AA ++
Sbjct: 660 NSED--IVTVYHGLEKELQVLVDDRSNWCG--RFGHLF--GYGASYYSYLMDRAIAAKVW 713

Query: 676 YTKFASDPLNSQAGVQYRDIVLANGGLYE----IADKLKE 711
              F  DP +   G ++++ VL  GG  +    IAD L E
Sbjct: 714 NHLFQHDPFSRAGGEKFKNSVLKWGGSRDPWRCIADALDE 753

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  155 bits (393), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 129/551 (23%), Positives = 250/551 (45%), Gaps = 49/551 (8%)

Query: 183 KDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFTKEQL--KGVSESV 239
           +D+ ++G+++  +   Q  +I ++I+     +  N    + +YV    ++L   GVS  +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 240 MEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVET 299
           + Q  +        + YKV       F +L++      R   + +  +   +  +   + 
Sbjct: 263 LNQLSR----DLKNQNYKVPAYGYAAFSILRSCPNENVRMKIWTAMHSCPEKQISRLKQL 318

Query: 300 LKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQXXXXXXXXXXXX 359
           + LR  LA ++G  +YA Y L  KMAK+   V  FV +L D  KPL              
Sbjct: 319 VMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSG 378

Query: 360 DCEELGLAY-----DDHYYI--WDHRYYD--NKFLKDNYNVDLEQISEYYPLESTIKGML 410
               LG+       D   ++  WD  +Y   N   +    ++ E IS Y+ L + ++G+ 
Sbjct: 379 ---HLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLS 435

Query: 411 GIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSH 470
            ++E +  ++ ++    K  + W  +V+++ V      +    IG +Y DL  R GK S+
Sbjct: 436 RLFEDIYGIR-LEPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLFERQGKTSN 490

Query: 471 AANFGISSSYITQDGDR----------------SFPVTALVCNFSKSTDKKP--SLLKHN 512
            A+F +  S     G+                   PV +LVC+F++++  +    LL+ +
Sbjct: 491 PAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLS 550

Query: 513 EITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHY 572
           ++ T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +  HY
Sbjct: 551 DVDTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFARDSRVLSRIGRHY 609

Query: 573 QTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVED--LNLLKLWNELR 630
            T + I  +LL       +         Q    + D  +H++K + D  L+++KL++ + 
Sbjct: 610 ATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVE 669

Query: 631 EKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGV 690
           + + ++   ++ +     FGH++   Y A YY Y++    A+ ++   FA DP N + G 
Sbjct: 670 KDMEVL--ADDQSNWCGRFGHLLG--YGASYYSYLFDRAIASKIWQHLFAEDPFNRENGE 725

Query: 691 QYRDIVLANGG 701
           ++++ VL  GG
Sbjct: 726 KFKESVLKWGG 736

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  155 bits (391), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 150/627 (23%), Positives = 286/627 (45%), Gaps = 59/627 (9%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++    +K    A+ E  E +  F    +  + L    D++   + + + LK 
Sbjct: 137 VIDLCEFIRSCHPEKSFVQAAQECHEHMYAFMNTLNTDIALC---DRLRTVLDNKEVLKR 193

Query: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFT 228
              E  K  + + +D+ ++G+ +  E R++   + + I+    ++  N    +K+Y+   
Sbjct: 194 LTDEEIKVGKLLLEDFEKSGIQMSPEIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIK 253

Query: 229 KEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRK---LAYISD 285
            ++     +    +++   D      K     K P  +  L   +  + RK   +A+ S 
Sbjct: 254 CDEFDKACDYPALKYKLSKDLSGKYYKIPTYGKIP--YTALLKCKDEELRKKLWVAFHSC 311

Query: 286 QNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPL 345
            NK  Q E L  + +K R +LA+LL  S+Y+ Y L+ KMAK  + V +F+N L   LK +
Sbjct: 312 SNK--QIERL-TKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNAL---LKSI 365

Query: 346 GQXXXXXXXXXXXXDCEELGLAYD-------DHYYIWDHRYYDNKFLKDNYNVDLEQISE 398
                          C   G + +       ++   WD  YY N     +       I E
Sbjct: 366 LPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYY-NPIQATSEGAYQMLIME 424

Query: 399 YYPLESTIKGMLGIYETLLKLKFVDETNPKIKD--VWHEDVKQLAVWKMDDEKNPEFIGW 456
           Y+ L + I G+  ++ ++  ++F      KI+D   W +DV++L V   D+      IG 
Sbjct: 425 YFTLGNIIHGLSNLFNSIYGIRF---EPGKIEDGETWSKDVRKLNVISEDEG----LIGV 477

Query: 457 IYFDLHPRDGKYSHAANFGISSS--YITQDGDRS---------------FPVTALVCNFS 499
           IY DL  R+GK    +++ I  S    +++ D S                P+ +LVCNF 
Sbjct: 478 IYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQ 537

Query: 500 KSTDK---KPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE 556
            +  K   +   L+H+EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E
Sbjct: 538 VTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILME 596

Query: 557 FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHT--T 614
           F+  N   L+ +S HY +GE I  ++L+  +       A     Q    L D  +H    
Sbjct: 597 FFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLHAENA 656

Query: 615 KNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADM 674
            ++++++++++++ L +++ ++ +      G   FGH+    Y A YY Y++    A  +
Sbjct: 657 NSLDNIDVVEIYHNLEKELSVLPDTESNWCG--RFGHLY--GYGALYYCYLFDRAIATKI 712

Query: 675 YYTKFASDPLNSQAGVQYRDIVLANGG 701
           + + F +DP + + G  +++ +L  GG
Sbjct: 713 WESLFQNDPFSRKGGNIFKEQLLKWGG 739

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 147/632 (23%), Positives = 275/632 (43%), Gaps = 63/632 (9%)

Query: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169
           +++   F++    DK     + +  E +  F I   +  D+  +   +  Q   + D+  
Sbjct: 136 VIDLCEFIRATHPDKKFVQTAQQCHEKM--FEIMNILNTDV--RLCDLLTQCLRESDVLG 191

Query: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLG-EQKEYVSFT 228
            D E  +  + + +D+ ++G+ +  E R +   + ++I+    ++  N    +  Y+  +
Sbjct: 192 LDSEEIRTGKILLEDFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKIS 251

Query: 229 KEQLKG-VSESVMEQFEKFVDPKTNEEKYKV-TFKYPDIFPVLKTAQVPKTRKLAYISDQ 286
            E +   V++ V  Q +K +      E YKV T+ Y     +L+T      R   +    
Sbjct: 252 CELMDAHVNKMVCSQMKKDI----TGEYYKVPTYGYIP-HTLLRTCSDEVIRMKIWTEMH 306

Query: 287 NKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNL-------- 338
           +          + + LR +LA+LLG   +A Y L  KMAK  E V  F+ +L        
Sbjct: 307 SCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKA 366

Query: 339 KDKLKPLGQXXXXXXXXXXXXDCEELGLAYDDHYYIWDHRYYDN-KFLKDNYNVDL---E 394
             +LKPL                EE+     +    WD  YY + + L    +  L   E
Sbjct: 367 ASELKPLAVLKSELTGTQTPHTSEEVL----ELMKPWDRDYYGSIQALAQRRSSSLDNGE 422

Query: 395 QISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFI 454
            IS  + L   ++G+  ++E +  +K V  T PK  + W  DV+++ V     +++   I
Sbjct: 423 SISSSFSLGVVMQGLSDLFEKIYGIKLVPAT-PKTGETWSPDVRRIDVV----DEHDGLI 477

Query: 455 GWIYFDLHPRDGKYSHAANFGISSSY---------------ITQDGDR-SFPVTALVCNF 498
           G +Y DL  R+GK  + A+F +  S                +  +G +   PV +LVC+F
Sbjct: 478 GVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDF 537

Query: 499 -------SKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAP 551
                       ++  LL+ NEI T FHE+GH +H ++G+ +    +G      DFVE P
Sbjct: 538 RWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELP 596

Query: 552 SQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTV 611
           S ++E +  +   L S+S HY+TG+ +  ++L +               Q+     D  +
Sbjct: 597 SILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQEL 656

Query: 612 HTTKNVED--LNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEV 669
           H   +  D  ++++ +++ L  ++ ++ +      G   FGH+    Y A YY Y++   
Sbjct: 657 HNLDHTTDGSIDVIAIYHRLERRLAVLPDDQSNWCG--KFGHLF--GYGASYYSYLFDRA 712

Query: 670 FAADMYYTKFASDPLNSQAGVQYRDIVLANGG 701
            A+ ++   F  DP N   G ++++ +L  GG
Sbjct: 713 IASKIWDHLFEQDPFNRTNGTKFKEGLLQWGG 744

>Kwal_33.14125 s33 (539186..540130) [945 bp, 314 aa] {ON} YKR046C -
           Hypothetical ORF [contig 105] FULL
          Length = 314

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 221 QKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKY 262
           Q+EY+  TK+++ G  E + E++ +F+ PK N     V+ KY
Sbjct: 206 QQEYIEPTKDKINGTREFMTEKYGEFIKPKYNAAYQTVSEKY 247

>KLTH0F06182g Chr6 (544018..544980) [963 bp, 320 aa] {ON} similar to
           uniprot|P36139 Saccharomyces cerevisiae YKR046C PET10
           Protein of unknown function that co-purifies with lipid
           particles expression pattern suggests a role in
           respiratory growth computational analysis of large-scale
           protein-protein interaction data suggests a role in
           ATP/ADP exchange
          Length = 320

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 221 QKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKY 262
           Q+EY+  TK+++ G  E + E++ +F+ PK N     V+ KY
Sbjct: 212 QQEYIEPTKDKINGTREFMTEKYGEFIKPKYNAAYQTVSEKY 253

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 33/84 (39%), Gaps = 19/84 (22%)

Query: 510 KHNEITTFFHE----LGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNEL 565
           K +E+T F  E      H  ++        R  GPG  P DFV                +
Sbjct: 173 KSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFVS---------------I 217

Query: 566 LSLSGHYQTGEKISEDLLDSLIAT 589
           + +S  Y TG  + ED+L+  + T
Sbjct: 218 VDISTGYATGSDVKEDILNCNLPT 241

>CAGL0H07821g Chr8 (761870..764755) [2886 bp, 961 aa] {ON} highly
           similar to uniprot|P33307 Saccharomyces cerevisiae
           YGL238w CSE1
          Length = 961

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 9/80 (11%)

Query: 360 DCEELGLAYDDHYY----IWDHRY--YDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIY 413
           +C+++   ++DH      +W HRY  Y+N  L+DN+  D E  S    ++++I+ ++ +Y
Sbjct: 217 NCQDIPEFFEDHIREGMGMW-HRYLSYENPLLEDNF--DTETASTLIKVKTSIQELVQLY 273

Query: 414 ETLLKLKFVDETNPKIKDVW 433
            T  +  F    N  I+  W
Sbjct: 274 TTRYEEFFEPMINEFIQITW 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,450,523
Number of extensions: 4107469
Number of successful extensions: 15291
Number of sequences better than 10.0: 220
Number of HSP's gapped: 15851
Number of HSP's successfully gapped: 225
Length of query: 730
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 613
Effective length of database: 40,065,477
Effective search space: 24560137401
Effective search space used: 24560137401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)