Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B090601.10ON1671677057e-96
ZYRO0F18370g1.10ON2201633331e-38
NDAI0A001901.10ON1711573012e-34
TDEL0C069301.10ON1841663012e-34
KNAG0C002701.10ON1741652446e-26
SAKL0C00572g1.10ON3381662345e-23
KAFR0D001901.10ON1851642186e-22
TPHA0E039601.10ON1771581802e-16
KLLA0C00594g1.10ON1941641803e-16
KLTH0F00572g1.10ON1951651733e-15
Kwal_33.130231.10ON1931661593e-13
Kpol_2002.131.10ON1641581487e-12
TBLA0A049701.10ON1811691358e-10
Ecym_10121.10ON177147936e-04
NDAI0H025407.76ON75772710.72
Kthe_YGOB_YNL040Wna 1ON44234637.1
NOTE: 4 genes in the same pillar as NCAS0B09060 were not hit in these BLAST results
LIST: Skud_3.8 Smik_3.19 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B09060
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....   276   7e-96
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   132   1e-38
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   120   2e-34
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   120   2e-34
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    99   6e-26
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    95   5e-23
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    89   6e-22
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    74   2e-16
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    74   3e-16
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    71   3e-15
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    66   3e-13
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    62   7e-12
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    57   8e-10
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    40   6e-04
NDAI0H02540 Chr8 (619510..621783) [2274 bp, 757 aa] {ON} Anc_7.76      32   0.72 
Kthe_YGOB_YNL040W Chr4 (1286782..1287582,1287585..1288112) [1329...    29   7.1  

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score =  276 bits (705), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 143/167 (85%), Positives = 143/167 (85%)

Query: 1   MTGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXX 60
           MTGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFG             
Sbjct: 1   MTGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSK 60

Query: 61  XXXXXXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLEL 120
                      IRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLEL
Sbjct: 61  KLITRLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLEL 120

Query: 121 LQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167
           LQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL
Sbjct: 121 LQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  132 bits (333), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 100/163 (61%), Gaps = 2/163 (1%)

Query: 5   EDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXXXX 64
           ED ++  LESIC +FDNVY  K++G++SE N+LYR LNKG++G                 
Sbjct: 58  EDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFS 117

Query: 65  XXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQTM 124
                   ++K+K+E+ E   E DED  LV  +LR K   +L KC  II++ VLELLQT+
Sbjct: 118 RLLKIMKAKSKLKEEMKELRTEGDED--LVKQVLRNKFTDALKKCSIIIKDVVLELLQTL 175

Query: 125 MYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167
            YL+I  I VFK+ V QK   +LE LS+ I +IR+F +GY++L
Sbjct: 176 AYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTL 218

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 98/157 (62%), Gaps = 1/157 (0%)

Query: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXXX 63
           +ED+++  LE ICNIFDNVY  KS+G++SE N+LYR LNKG+FG                
Sbjct: 5   MEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKLV 64

Query: 64  XXXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQT 123
                    R ++ KE  ++ K    +++LV+S+L EKL++ + KC  +I + +LEL QT
Sbjct: 65  HQLIRAVKARIRLVKE-RKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123

Query: 124 MMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVF 160
           ++YL +  IN+FK+K   K  ++LE LSN++ +IR+F
Sbjct: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMF 160

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 96/166 (57%), Gaps = 3/166 (1%)

Query: 2   TGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXX 61
           T  EDN++  LES+C+ FDNVYF KS+G++ E N LYR LNKG +G              
Sbjct: 20  TSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRK 79

Query: 62  XXXXXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELL 121
                      R ++K EI    K     K L+N +L+EK+ L L K   ++R  +L+LL
Sbjct: 80  CLRQIFQIVRNRIRLKTEIKGMDKNG---KGLMNDVLKEKILLMLQKSNAMMRETLLDLL 136

Query: 122 QTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167
           Q  +YL I  I+VFK+ +P++ + +LE LSN +TI+R F  G+SS+
Sbjct: 137 QNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFSSV 182

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 98.6 bits (244), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 95/165 (57%), Gaps = 3/165 (1%)

Query: 5   EDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXXXX 64
           ED +L  LESIC+IFDN+Y  KS+G++S++N LYR LNKG+ G                 
Sbjct: 10  EDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLK 69

Query: 65  XXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQTM 124
                   R K+  EI++  ++   D SLVN+++  KL  +L KC  +I +  L+L Q +
Sbjct: 70  RLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQLL 129

Query: 125 MYLSIAFINVFKVKVPQ--KWKHLLEQLSNIITIIRVFISGYSSL 167
           +YL I   + F +  P+  K+K  L  +SN++TI+R+ +S Y+++
Sbjct: 130 IYLFIVSGDCFNIP-PRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 94.7 bits (234), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 88/166 (53%), Gaps = 3/166 (1%)

Query: 2   TGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXX 61
              ED ++  LES+ N+FD+VY  K+ G++ E N +YR LNKG  G              
Sbjct: 174 ASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRK 233

Query: 62  XXXXXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELL 121
                      R  ++KE   +P +  +       ++ +K    + +    I++ +L++L
Sbjct: 234 SLGQLFRLARARHMLQKERRSTPHKCSKT---FAKIIADKFTQKIGQLDRQIKDVLLDVL 290

Query: 122 QTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167
           Q + YL +  ++VFK+K+P +W+ LLE +S+++T+ R F +G+S++
Sbjct: 291 QNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTI 336

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 88.6 bits (218), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 93/164 (56%), Gaps = 5/164 (3%)

Query: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXXX 63
           LED +++ LE IC +FDN+YF K++GV+ E N +Y+ LNKG+ G                
Sbjct: 19  LEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCF 78

Query: 64  XXXXXXXXIRAKIKKEIDESPKENDE--DKSLVNSLLREKLELSLAKCMDIIRNNVLELL 121
                    R K   E+    K+ ++  +  LVN +L++KL  SL KC  IIR+ +LE L
Sbjct: 79  KNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEFL 138

Query: 122 QTMMYLSIAFINVFKVKVPQKW-KHL--LEQLSNIITIIRVFIS 162
           Q ++YL I  I VFKVK  +++ K +  LE LSN+IT+ R+  +
Sbjct: 139 QVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIITA 182

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 4/158 (2%)

Query: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXX 62
           G E  +LN LESI NIFD V+F +S G++ E N  YR LN+ + G               
Sbjct: 16  GFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKL 75

Query: 63  XXXXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQ 122
                    + + +K E+ +  K ND    L + ++ +K++ +       I+N ++EL+Q
Sbjct: 76  YKNILKSTKLLSLLKTELTKIEKNND----LTSDIILQKIQNNNTILKKKIKNFIIELIQ 131

Query: 123 TMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVF 160
             +YL I  + +FK+ + +K  H LE LSN +++++ F
Sbjct: 132 DFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFF 169

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 88/164 (53%), Gaps = 7/164 (4%)

Query: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXX 62
            LED ++++L S+ + FD++Y  +S G++S+ N LY+ LNKGD G               
Sbjct: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLLSIRRS 91

Query: 63  XXXXXXXXXIRAKIKKE-IDESPKENDEDKSLVN-SLLREKLELSLAKCMDIIRNNVLEL 120
                    ++ K++KE ++ +   +   K LV   +L E  +LSL      IR+  ++L
Sbjct: 92  LTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLK-----IRSLCMDL 146

Query: 121 LQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGY 164
           LQ ++Y+ I  I++FK+ +  K+K  LE +S+  T+++   S Y
Sbjct: 147 LQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 84/165 (50%), Gaps = 5/165 (3%)

Query: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXXX 63
           +E  +++ LE+I  IFD++   +S GV+ E N+ Y+ LNK  F                 
Sbjct: 33  IESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNA 92

Query: 64  XXXXXXXXIRAKIKKEIDESPKEN-DEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQ 122
                    R+++K+E  E  +   +  + ++N+ +  +++    K + +     LEL+Q
Sbjct: 93  SDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILV----ALELIQ 148

Query: 123 TMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167
            + YL++   +V    + +KWK LLE++S+I  I R+  SG+SSL
Sbjct: 149 NIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFSSL 193

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 65.9 bits (159), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 84/166 (50%), Gaps = 10/166 (6%)

Query: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXX 62
            +E+  ++ +ES+  +FD+++  KS G++SE N +YR LNK  F                
Sbjct: 32  AIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKC 91

Query: 63  XXXXXXXXXIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNV---LE 119
                     R++++KE      E        NSL R   +    K  D+ R  +   LE
Sbjct: 92  IRDLNNLWMSRSRLRKE------EVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVALE 145

Query: 120 LLQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIR-VFISGY 164
           ++Q + YL I   +VF + + ++WK+LLE+ S+++T+++ +F+S Y
Sbjct: 146 IMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIY 191

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
           complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 88/158 (55%), Gaps = 2/158 (1%)

Query: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXX 62
           G ED VL+ LE IC++FD++YF K++G++++K+ LYR + + +F                
Sbjct: 5   GWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLIIKKL 64

Query: 63  XXXXXXXXXIRAKIKKEIDESPKENDEDKSLVN--SLLREKLELSLAKCMDIIRNNVLEL 120
                    I   +K E+ +    N+ +    +  S+L EKL   + +  + I+ N+L+L
Sbjct: 65  VVKLFQNYKILRFLKIELKQHINNNNNNNKNNHINSILLEKLNKKINQHYNFIKLNLLDL 124

Query: 121 LQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIR 158
           +Q ++Y +I  I + K+K+ +K K +LE L+N ITI++
Sbjct: 125 IQNLLYCAIVIIELLKLKISKKSKFILELLANSITIVK 162

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {ON}
           Anc_1.10 YCL056C
          Length = 181

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 92/169 (54%), Gaps = 13/169 (7%)

Query: 7   NVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXXXXXXX 66
           ++L  LESIC++FDN+YF +SIG++S+ N+ YR LN+ + G                   
Sbjct: 12  DILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRKDTLEL 71

Query: 67  XXXXXIRAKIKKEID--------ESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVL 118
                ++ KI  E++        E      +D +L+   +++KL+ SL    + I++ + 
Sbjct: 72  LKLLKLKTKISDELEFQLTKLKMEKIGNYSKDVTLI---IKDKLQNSLKIINNSIKDRIF 128

Query: 119 ELLQTMMYLSIAFINV--FKVKVPQKWKHLLEQLSNIITIIRVFISGYS 165
           +L+Q ++YL I  IN+     K  Q++KH+LE +SN++ + RVF + ++
Sbjct: 129 DLIQNLIYLLILLINIGGHYYKSLQRFKHILEIISNMLIVSRVFSTNFN 177

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 17/147 (11%)

Query: 2   TGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGXXXXXXXXXXXXXX 61
           T  ED +   L S    +D +Y F+SIG++ + N++Y+ L  G                 
Sbjct: 31  TTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLVARK 90

Query: 62  XXXXXXXXXXIRAKIKKEIDESP--KENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLE 119
                     +   +K  +  +   K+ +E KS V    R  L LS            ++
Sbjct: 91  TFLKLLRLVRLWYALKNVLPPASIKKKYNETKSRVK---RSILRLS------------VD 135

Query: 120 LLQTMMYLSIAFINVFKVKVPQKWKHL 146
           LL T++YL +  I++FK KV    + L
Sbjct: 136 LLDTLVYLIVVLIDLFKFKVSDSTRKL 162

>NDAI0H02540 Chr8 (619510..621783) [2274 bp, 757 aa] {ON} Anc_7.76
          Length = 757

 Score = 32.0 bits (71), Expect = 0.72,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 11/72 (15%)

Query: 73  RAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRN--NVL----ELLQTMMY 126
           +AK+++E+DE P +N EDK ++   L EK +LS  K +   +   NVL     +L  +++
Sbjct: 15  KAKLRQEVDEIPSDN-EDKEVI---LNEKEDLSKVKPILTPKKKCNVLLRLESILMPLIF 70

Query: 127 LSIA-FINVFKV 137
             +A FI ++K+
Sbjct: 71  TGLAIFIRMYKI 82

>Kthe_YGOB_YNL040W Chr4 (1286782..1287582,1287585..1288112) [1329
           bp, 442 aa] {ON} ANNOTATED BY YGOB - Artificial
           frameshift in K. thermotolerans gene
          Length = 442

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 95  NSLLREKLELSLAKCMDIIRNNV--LELLQTMMY 126
           NS LRE  E ++ KC   ++N +  +ELL T+++
Sbjct: 19  NSFLREGFETTVLKCGKALKNEIYEIELLDTILF 52

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,418,052
Number of extensions: 540360
Number of successful extensions: 2639
Number of sequences better than 10.0: 37
Number of HSP's gapped: 2618
Number of HSP's successfully gapped: 37
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)