Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B086001.52ON1117111753750.0
NDAI0A006601.52ON1022113430180.0
TDEL0C064901.52ON1153118229490.0
Kpol_2002.461.52ON1123117129070.0
KAFR0D041001.52ON1117117128630.0
ZYRO0F17402g1.52ON1189121328360.0
Suva_2.6871.52ON1128117527670.0
Smik_4.7891.52ON1136118527640.0
YDR507C (GIN4)1.52ON1142118527450.0
Skud_4.7831.52ON1135118127190.0
KLLA0C01650g1.52ON1112116327150.0
KNAG0F002901.52ON1125117027000.0
SAKL0C01716g1.52ON1215122926700.0
KLTH0F01672g1.52ON1164118126670.0
TPHA0E036401.52ON1137118426290.0
CAGL0K05709g1.52ON1103116725300.0
AFR696C1.52ON1142119624730.0
Skud_3.391.52ON1017114220430.0
Ecym_10581.52ON116459318580.0
TBLA0A071501.52ON139152618150.0
Kwal_33.132251.52ON96499117670.0
Smik_3.541.52ON103259116030.0
Smik_11.1392.479ON153439310561e-122
Ecym_73922.479ON143435310481e-121
SAKL0E02860g2.479ON137735310451e-121
YKL101W (HSL1)2.479ON151839010481e-120
Skud_11.1262.479ON151841910431e-120
TDEL0A025502.479ON136939310361e-120
Suva_11.1232.479ON152639210381e-119
NCAS0A057702.479ON146138310331e-119
ABL034W2.479ON142535510281e-118
KLTH0D05566g2.479ON112835510131e-118
Kwal_26.77882.479ON126742410161e-118
KLLA0F13552g2.479ON126735410151e-117
KNAG0A065402.479ON143238010151e-116
TBLA0I011502.479ON174539010211e-116
KAFR0D032002.479ON144838310081e-115
ZYRO0G03366g2.479ON161640310051e-114
Kpol_431.92.479ON155240210021e-114
CAGL0K08514g2.479ON14893879881e-113
TPHA0G032002.479ON15344309371e-105
NDAI0D027502.479ON15152988602e-95
Kwal_33.13222singletonOFF1481206256e-75
Suva_3.1901.52ON10246836766e-73
CAGL0M08910g5.611ON6122736291e-69
Kpol_1018.655.611ON6012736254e-69
TPHA0C004705.611ON6312786248e-69
Smik_4.7545.611ON6322736231e-68
YDR477W (SNF1)5.611ON6332736232e-68
Suva_2.6515.611ON6332736213e-68
NCAS0A080805.611ON6232736203e-68
Skud_4.7515.611ON6342736204e-68
KLLA0A03806g5.611ON6022746174e-68
Kpol_495.145.611ON6242736186e-68
TBLA0E033605.611ON6542736189e-68
KNAG0B032305.611ON6412786161e-67
TPHA0D028405.611ON6342726161e-67
TDEL0A047805.611ON6212736151e-67
KAFR0C058605.611ON6442736116e-67
NDAI0H009405.611ON6852736121e-66
KLTH0G05698g5.611ON5972706024e-66
ZYRO0A05544g5.611ON6312736044e-66
SAKL0G06952g5.611ON5992706017e-66
Kwal_47.182335.611ON5982706007e-66
AEL230W5.611ON6082735982e-65
Ecym_55885.611ON6132735982e-65
Kwal_26.87098.654ON8292915162e-53
NDAI0J012508.279ON11763505197e-53
ZYRO0F06842g8.654ON8433235128e-53
TPHA0G017108.654ON8052885119e-53
CAGL0M02519g8.654ON7563055099e-53
KLTH0D10714g8.654ON8722915092e-52
KNAG0J015908.654ON8053265073e-52
TDEL0A060008.654ON7902905045e-52
Kpol_1072.298.654ON8932915051e-51
SAKL0H07084g8.654ON9192905051e-51
NDAI0E023208.654ON9323305023e-51
YPL141C (FRK1)8.654ON8652984995e-51
Suva_16.1698.654ON8582984986e-51
NCAS0C015908.654ON8642984942e-50
Ecym_42918.279ON11452924992e-50
TPHA0D011408.654ON6222994824e-50
Kpol_1012.68.654ON6282964824e-50
KAFR0H025408.654ON8173364904e-50
KAFR0A037308.654ON7883264877e-50
NDAI0B020708.279ON12583624948e-50
Skud_16.1408.654ON8652954881e-49
TPHA0J008208.279ON12183464921e-49
Smik_4.3678.279ON10662854911e-49
Smik_6.3398.654ON8652954843e-49
Suva_2.2838.279ON10892854874e-49
KAFR0B028008.279ON10952884874e-49
CAGL0M11396g8.279ON11922904884e-49
AGR058W8.279ON10712914874e-49
NCAS0B037408.279ON10492904864e-49
CAGL0J03872g8.654ON6612954764e-49
CAGL0M02299g8.668ON8932824828e-49
SAKL0H16632g8.279ON10622944841e-48
Skud_4.3838.279ON10652854831e-48
YDR122W (KIN1)8.279ON10642854831e-48
Smik_15.4178.654ON8062934771e-48
NDAI0E012908.654ON7292954742e-48
NCAS0B050908.279ON12102944822e-48
Suva_10.1808.279ON11592904812e-48
KLTH0G13288g8.279ON11423464812e-48
KNAG0G021108.279ON11923044812e-48
KLLA0F19536g8.279ON11042894794e-48
TBLA0B039708.654ON12083074795e-48
Ecym_83398.654ON9202884765e-48
TBLA0C046008.279ON13152844796e-48
ACR119W8.654ON9312884756e-48
NCAS0B014708.654ON7273064697e-48
KNAG0A030408.654ON6442934658e-48
Suva_8.2848.654ON8082934718e-48
Skud_15.3998.654ON8073504701e-47
Kpol_1066.468.279ON12252844752e-47
Skud_12.1648.279ON11602894742e-47
TDEL0F040608.279ON11262844733e-47
YOR233W (KIN4)8.654ON8002934664e-47
SAKL0H06754g8.668ON8842794674e-47
YLR096W (KIN2)8.279ON11472894696e-47
TBLA0C017508.654ON9813024678e-47
CAGL0B01925g8.279ON9442924651e-46
KNAG0J016708.668ON10093694652e-46
ZYRO0D06776g8.279ON12042854653e-46
KLLA0D07348g8.654ON9092884623e-46
Smik_12.1558.279ON11622894643e-46
TDEL0A061408.668ON8613734595e-46
NDAI0E023908.668ON8833734523e-45
NCAS0C016708.668ON8962794514e-45
KNAG0H031408.279ON9362904517e-45
Kwal_26.87518.668ON8482784452e-44
KLTH0D11044g8.668ON8493834443e-44
ZYRO0F07194g8.668ON9382924463e-44
TBLA0B038608.668ON9882824445e-44
Kpol_1072.198.668ON8962794427e-44
TPHA0G016308.668ON8712794372e-43
KLLA0F11319g8.668ON8432924292e-42
YPL150W8.668ON9012954302e-42
Skud_16.1328.668ON9242954302e-42
ACR133C8.668ON8512824283e-42
Smik_6.3478.668ON9172954266e-42
Suva_16.1608.668ON9182944259e-42
NDAI0G053001.374ON4372754061e-41
Ecym_24058.668ON8552824231e-41
Kwal_56.224766.31ON6972294191e-41
KLTH0C10912g6.31ON6972294172e-41
NCAS0D021006.31ON7262074092e-40
YCL024W (KCC4)1.52ON10374954143e-40
Kwal_56.237178.279ON8581874113e-40
CAGL0F04741g1.374ON4422753944e-40
Ecym_30356.31ON7402094075e-40
KNAG0I014801.374ON4402793936e-40
NCAS0D006301.374ON4272793927e-40
YFR014C (CMK1)1.374ON4462773929e-40
KAFR0C044801.374ON4352753901e-39
KLTH0H11396g1.374ON4372773901e-39
ACL006W6.31ON7082094022e-39
KAFR0G026906.31ON7132234012e-39
NCAS0A088801.374ON4222753873e-39
TPHA0J004206.31ON7072944003e-39
CAGL0J11638g6.31ON7462084004e-39
Kpol_1069.131.374ON4272793864e-39
SAKL0D07656g1.374ON4322723864e-39
KNAG0E008506.31ON7112183985e-39
AAR009W1.374ON4532723875e-39
TBLA0B004906.31ON7872553996e-39
Kpol_1037.206.31ON7042353977e-39
TDEL0G043806.31ON7222293977e-39
Suva_6.781.374ON4452773857e-39
NDAI0H035201.374ON4582733859e-39
Smik_7.3191.374ON4462793849e-39
Kpol_1023.266.31ON7393363951e-38
SAKL0E01584g6.31ON6952313922e-38
NDAI0C026806.31ON7502003933e-38
KNAG0D010906.222ON3722893753e-38
Suva_13.1636.31ON7052413905e-38
Kwal_26.87968.676ON7962803916e-38
Skud_6.891.374ON4462793787e-38
Kwal_0.961.374ON4272733768e-38
Skud_13.1546.31ON7052093888e-38
Smik_13.1596.31ON7052093889e-38
TDEL0B063201.374ON4442873761e-37
CAGL0L07326g2.352ON5063123801e-37
KNAG0J017008.676ON8202853901e-37
YMR001C (CDC5)6.31ON7052093871e-37
CAGL0M02233g8.676ON7672973881e-37
KLLA0C06138g6.31ON7082363861e-37
KAFR0H024308.676ON7842833882e-37
KAFR0H025108.668ON8793473892e-37
KLTH0D11242g8.676ON7952803882e-37
ZYRO0C07480g6.31ON7742293872e-37
Suva_15.1551.374ON4523863742e-37
TPHA0F024306.31ON7982803862e-37
Suva_16.1578.676ON8322953863e-37
Smik_6.3508.676ON8222903854e-37
Skud_15.1441.374ON4492753715e-37
KLLA0F11143g8.676ON8132783837e-37
TBLA0A020306.214ON4032773677e-37
YPL153C (RAD53)8.676ON8212903837e-37
KAFR0K003306.214ON3732803657e-37
Smik_15.1531.374ON4422753681e-36
KLLA0F23155g1.374ON4272653671e-36
Ecym_12751.374ON4512713681e-36
YOL016C (CMK2)1.374ON4472753671e-36
Skud_16.1298.676ON8272903802e-36
CAGL0I09504g1.336ON5283153712e-36
CAGL0K10604g1.374ON4462793662e-36
TBLA0D050101.374ON4342783652e-36
KAFR0B054108.279ON5392833712e-36
Skud_16.766.214ON3822803613e-36
TPHA0O011201.374ON4292753643e-36
TPHA0E028206.222ON3842113613e-36
YPL203W (TPK2)6.214ON3802803603e-36
Smik_6.4086.214ON3812803604e-36
KLTH0H04180g6.214ON3532553584e-36
Kpol_1033.506.214ON3842653595e-36
TDEL0G028202.352ON4972993665e-36
SAKL0E05984g2.352ON5053093666e-36
NCAS0B082801.182ON4092653607e-36
KNAG0D011406.214ON3952803598e-36
Skud_10.501.182ON3972733571e-35
KAFR0I020101.374ON4322793591e-35
Kpol_1065.36.222ON3762763551e-35
YJL164C (TPK1)1.182ON3972733562e-35
NDAI0E021108.676ON9032893722e-35
Suva_16.1046.214ON3832803542e-35
KAFR0C042801.336ON5343203632e-35
Smik_10.661.182ON3972733543e-35
CAGL0G09020g6.214ON3612713514e-35
Kwal_47.172638.140ON11273153705e-35
Kwal_56.240596.214ON3532553495e-35
YDL101C (DUN1)2.352ON5132973596e-35
ZYRO0E05588g1.374ON4712793566e-35
Kwal_56.240916.222ON3812143508e-35
TBLA0A020506.222ON4342743531e-34
Suva_6.2451.182ON3942733501e-34
NCAS0A011006.214ON3542783471e-34
NDAI0F016006.222ON4122143511e-34
ZYRO0E07018g6.222ON3672143471e-34
ACR142W8.676ON8372873641e-34
SAKL0A04466g6.214ON3732773471e-34
KAFR0K002806.222ON3602143462e-34
ZYRO0G08844g6.214ON3622983462e-34
Suva_4.1452.352ON5143203552e-34
KAFR0F018001.182ON4242993492e-34
NDAI0A009601.182ON4082603482e-34
Kwal_33.138461.182ON3752653462e-34
TPHA0E028406.214ON4022653473e-34
SAKL0A04246g6.222ON4002143473e-34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B08600
         (1117 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...  2075   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52   1167   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...  1140   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...  1124   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...  1107   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...  1097   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1070   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1069   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1061   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1051   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...  1050   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...  1044   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...  1033   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...  1031   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...  1017   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   979   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   957   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   791   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   720   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   703   0.0  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   685   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   622   0.0  
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   411   e-122
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   408   e-121
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   407   e-121
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   408   e-120
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   406   e-120
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   403   e-120
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   404   e-119
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   402   e-119
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   400   e-118
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   394   e-118
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   395   e-118
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   395   e-117
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   395   e-116
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   397   e-116
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   392   e-115
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   391   e-114
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   390   e-114
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   385   e-113
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   365   e-105
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   335   2e-95
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   245   6e-75
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   265   6e-73
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   246   1e-69
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   245   4e-69
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   244   8e-69
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   244   1e-68
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   244   2e-68
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   243   3e-68
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   243   3e-68
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   243   4e-68
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   242   4e-68
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   242   6e-68
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   242   9e-68
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   241   1e-67
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              241   1e-67
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   241   1e-67
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   239   6e-67
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   240   1e-66
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   236   4e-66
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   237   4e-66
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   236   7e-66
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   235   7e-66
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   234   2e-65
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   234   2e-65
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   203   2e-53
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   204   7e-53
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   201   8e-53
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   201   9e-53
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   200   9e-53
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   200   2e-52
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   199   3e-52
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   198   5e-52
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   199   1e-51
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   199   1e-51
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              197   3e-51
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   196   5e-51
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   196   6e-51
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    194   2e-50
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   196   2e-50
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   190   4e-50
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   190   4e-50
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   193   4e-50
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   192   7e-50
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             194   8e-50
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   192   1e-49
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   194   1e-49
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   193   1e-49
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   191   3e-49
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   192   4e-49
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   192   4e-49
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   192   4e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   192   4e-49
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   191   4e-49
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   187   4e-49
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   190   8e-49
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   191   1e-48
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   190   1e-48
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   190   1e-48
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   188   1e-48
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   187   2e-48
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             190   2e-48
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   189   2e-48
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   189   2e-48
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   189   2e-48
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   189   4e-48
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   189   5e-48
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   187   5e-48
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   189   6e-48
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   187   6e-48
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    185   7e-48
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   183   8e-48
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   186   8e-48
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   185   1e-47
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   187   2e-47
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   187   2e-47
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   186   3e-47
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   184   4e-47
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   184   4e-47
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   185   6e-47
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   184   8e-47
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   183   1e-46
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   183   2e-46
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   183   3e-46
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   182   3e-46
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   183   3e-46
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   181   5e-46
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   178   3e-45
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   178   4e-45
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   178   7e-45
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   176   2e-44
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   175   3e-44
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   176   3e-44
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   175   5e-44
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   174   7e-44
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   172   2e-43
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   169   2e-42
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   170   2e-42
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   170   2e-42
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   169   3e-42
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   168   6e-42
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   168   9e-42
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   160   1e-41
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   167   1e-41
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   166   1e-41
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   165   2e-41
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     162   2e-40
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   164   3e-40
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   162   3e-40
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   156   4e-40
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   161   5e-40
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   155   6e-40
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   155   7e-40
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   155   9e-40
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   154   1e-39
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   154   1e-39
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   159   2e-39
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   159   2e-39
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   153   3e-39
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   158   3e-39
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   158   4e-39
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   153   4e-39
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   153   4e-39
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   157   5e-39
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   153   5e-39
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   158   6e-39
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   157   7e-39
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   157   7e-39
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   152   7e-39
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              152   9e-39
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   152   9e-39
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   156   1e-38
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   155   2e-38
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   155   3e-38
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   149   3e-38
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   154   5e-38
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   155   6e-38
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   150   7e-38
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   149   8e-38
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   154   8e-38
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   154   9e-38
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   149   1e-37
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   150   1e-37
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             154   1e-37
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   153   1e-37
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   154   1e-37
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   153   1e-37
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   154   2e-37
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   154   2e-37
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   154   2e-37
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   153   2e-37
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   148   2e-37
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   153   2e-37
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   153   3e-37
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   152   4e-37
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   147   5e-37
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   152   7e-37
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   145   7e-37
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   152   7e-37
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   145   7e-37
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   146   1e-36
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   145   1e-36
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   146   1e-36
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   145   1e-36
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   150   2e-36
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   147   2e-36
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   145   2e-36
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   145   2e-36
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   147   2e-36
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   143   3e-36
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   144   3e-36
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   143   3e-36
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   143   3e-36
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   143   4e-36
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   142   4e-36
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   142   5e-36
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   145   5e-36
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   145   6e-36
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   143   7e-36
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              142   8e-36
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   142   1e-35
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   142   1e-35
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   141   1e-35
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   141   2e-35
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   147   2e-35
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   140   2e-35
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   144   2e-35
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   140   3e-35
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   139   4e-35
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   147   5e-35
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   139   5e-35
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   142   6e-35
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   141   6e-35
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   139   8e-35
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              140   1e-34
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   139   1e-34
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              138   1e-34
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   139   1e-34
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   138   1e-34
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   144   1e-34
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   138   1e-34
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   137   2e-34
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   137   2e-34
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   141   2e-34
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   139   2e-34
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   138   2e-34
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   137   2e-34
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   138   3e-34
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   138   3e-34
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   137   3e-34
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   136   3e-34
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   139   5e-34
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   139   6e-34
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   137   6e-34
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   142   6e-34
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    136   7e-34
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    135   9e-34
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   137   9e-34
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   142   9e-34
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   142   9e-34
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   139   9e-34
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   137   9e-34
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   142   1e-33
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   139   1e-33
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   141   1e-33
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   135   1e-33
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              139   1e-33
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   137   1e-33
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   138   2e-33
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   138   2e-33
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   134   2e-33
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   135   2e-33
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   140   2e-33
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   141   2e-33
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   138   2e-33
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   135   2e-33
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   134   3e-33
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   134   3e-33
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   134   4e-33
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   140   4e-33
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   136   4e-33
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   139   5e-33
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   140   5e-33
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   140   6e-33
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   135   7e-33
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   136   8e-33
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   135   1e-32
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   132   1e-32
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   134   1e-32
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   138   1e-32
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   133   1e-32
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   134   2e-32
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   133   2e-32
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   135   2e-32
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   134   2e-32
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   138   2e-32
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   132   3e-32
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   131   3e-32
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   131   4e-32
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   130   4e-32
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   137   4e-32
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   133   5e-32
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      131   5e-32
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   130   5e-32
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   134   5e-32
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   130   6e-32
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   131   6e-32
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   136   7e-32
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   130   8e-32
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   134   8e-32
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   131   9e-32
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   135   1e-31
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   132   1e-31
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   132   1e-31
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   130   1e-31
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   135   2e-31
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   130   2e-31
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   135   2e-31
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   133   2e-31
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   128   3e-31
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   131   3e-31
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   131   3e-31
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   130   3e-31
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   131   4e-31
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   134   4e-31
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   134   5e-31
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   131   5e-31
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   128   6e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   129   7e-31
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   133   9e-31
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   130   1e-30
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   129   1e-30
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             131   1e-30
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   132   1e-30
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   129   2e-30
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   132   2e-30
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   132   2e-30
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   130   2e-30
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   132   2e-30
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   132   2e-30
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   125   2e-30
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   130   3e-30
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   129   3e-30
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             130   3e-30
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   130   3e-30
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   131   3e-30
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   129   4e-30
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   129   4e-30
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   129   5e-30
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   130   5e-30
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   127   6e-30
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   130   6e-30
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   127   6e-30
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   130   6e-30
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   127   6e-30
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   130   7e-30
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   129   7e-30
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   130   8e-30
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   129   8e-30
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   128   8e-30
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   129   8e-30
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   129   9e-30
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   129   1e-29
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   127   1e-29
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   128   1e-29
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   128   1e-29
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   127   1e-29
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   129   2e-29
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   126   2e-29
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   129   2e-29
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   125   2e-29
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   125   2e-29
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   128   2e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   127   2e-29
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   127   2e-29
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   124   3e-29
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   125   3e-29
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   125   3e-29
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   126   3e-29
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   125   3e-29
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   127   3e-29
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   125   3e-29
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   128   3e-29
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   126   3e-29
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   128   4e-29
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   126   4e-29
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   127   4e-29
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    126   4e-29
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   127   4e-29
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              127   5e-29
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   125   5e-29
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   124   5e-29
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   127   6e-29
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   124   6e-29
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   125   6e-29
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   127   7e-29
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   125   7e-29
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   126   7e-29
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   123   7e-29
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   126   9e-29
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   122   9e-29
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   126   1e-28
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   126   1e-28
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   125   1e-28
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   121   1e-28
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   125   1e-28
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   125   1e-28
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   123   1e-28
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   126   2e-28
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   124   2e-28
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   125   2e-28
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   120   2e-28
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   126   2e-28
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   122   2e-28
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   126   2e-28
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    120   2e-28
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   125   2e-28
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   125   2e-28
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   122   2e-28
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   125   2e-28
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   123   2e-28
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   125   2e-28
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   122   2e-28
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   125   2e-28
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   125   3e-28
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   124   3e-28
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   125   3e-28
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   123   3e-28
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   124   3e-28
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   124   3e-28
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   122   3e-28
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   124   3e-28
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   124   3e-28
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   124   3e-28
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   125   3e-28
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   125   3e-28
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   125   3e-28
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   124   3e-28
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   124   4e-28
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   124   4e-28
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   124   4e-28
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   125   4e-28
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   124   4e-28
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   123   5e-28
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   124   5e-28
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   120   5e-28
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   123   5e-28
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   123   5e-28
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   123   5e-28
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   120   5e-28
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   123   5e-28
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   124   5e-28
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   124   5e-28
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   123   6e-28
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   124   6e-28
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   124   6e-28
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   120   6e-28
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   122   8e-28
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   122   8e-28
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   120   8e-28
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   122   8e-28
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   122   8e-28
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   124   9e-28
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   122   9e-28
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   123   1e-27
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   119   1e-27
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   123   1e-27
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   123   1e-27
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   119   1e-27
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    123   1e-27
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   122   1e-27
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   123   1e-27
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   123   1e-27
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   123   1e-27
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   122   1e-27
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   122   1e-27
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   122   1e-27
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   119   1e-27
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   120   2e-27
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   123   2e-27
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   122   2e-27
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   122   2e-27
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   122   2e-27
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   122   2e-27
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   122   2e-27
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   122   2e-27
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   122   2e-27
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   119   2e-27
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   120   2e-27
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   122   2e-27
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   122   2e-27
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   121   2e-27
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   119   2e-27
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   122   2e-27
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   122   2e-27
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   118   3e-27
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   118   3e-27
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   121   3e-27
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   120   3e-27
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   122   3e-27
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   121   3e-27
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   118   3e-27
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   121   3e-27
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   117   3e-27
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   121   3e-27
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   122   3e-27
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   122   3e-27
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   120   4e-27
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   117   4e-27
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   118   4e-27
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   120   4e-27
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   121   4e-27
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   121   5e-27
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   120   5e-27
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            120   5e-27
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   120   5e-27
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   117   5e-27
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   118   5e-27
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   120   5e-27
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   120   5e-27
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   120   6e-27
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   120   6e-27
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   120   6e-27
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   121   6e-27
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    120   6e-27
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   120   6e-27
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   120   6e-27
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   120   7e-27
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   118   7e-27
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   118   7e-27
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   120   7e-27
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   120   7e-27
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   118   7e-27
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   120   7e-27
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   120   7e-27
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   120   8e-27
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   120   8e-27
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   119   8e-27
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   119   9e-27
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   117   9e-27
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   120   9e-27
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   116   9e-27
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   120   9e-27
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   119   1e-26
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   120   1e-26
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   119   1e-26
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   119   1e-26
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   119   1e-26
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   119   1e-26
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             119   1e-26
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   120   1e-26
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   119   1e-26
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   119   1e-26
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   118   1e-26
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   117   1e-26
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   113   1e-26
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   119   1e-26
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   119   1e-26
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   118   1e-26
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   119   1e-26
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   119   1e-26
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   113   1e-26
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   119   1e-26
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   119   1e-26
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   119   2e-26
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   119   2e-26
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   116   2e-26
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   119   2e-26
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   119   2e-26
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   118   2e-26
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   118   2e-26
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   119   2e-26
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   118   2e-26
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   117   2e-26
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   115   3e-26
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   118   3e-26
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   119   3e-26
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   119   3e-26
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   118   3e-26
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   117   3e-26
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   119   3e-26
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   116   3e-26
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   119   3e-26
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   116   3e-26
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   119   3e-26
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   118   3e-26
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   114   3e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   114   3e-26
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   117   3e-26
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   112   3e-26
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   117   3e-26
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   118   3e-26
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   118   4e-26
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   117   4e-26
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   116   4e-26
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   118   4e-26
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   117   4e-26
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   117   4e-26
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   116   4e-26
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   115   4e-26
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   113   4e-26
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   118   4e-26
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   114   5e-26
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   118   5e-26
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   118   5e-26
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   117   5e-26
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   117   5e-26
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   116   6e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   115   6e-26
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   115   6e-26
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    117   6e-26
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   115   7e-26
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   117   8e-26
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   117   8e-26
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   114   9e-26
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   116   9e-26
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   117   9e-26
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   116   9e-26
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   116   1e-25
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   116   1e-25
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   117   1e-25
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   114   1e-25
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   116   1e-25
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   116   1e-25
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   115   1e-25
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   117   1e-25
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   115   1e-25
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   117   1e-25
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   115   1e-25
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   117   1e-25
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   116   1e-25
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   116   1e-25
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   115   1e-25
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   114   1e-25
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   115   1e-25
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   116   1e-25
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   116   1e-25
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   115   1e-25
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   116   1e-25
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   116   1e-25
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   115   2e-25
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   114   2e-25
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   110   2e-25
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   116   2e-25
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   116   2e-25
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   115   2e-25
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   115   2e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   114   2e-25
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   115   2e-25
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   115   2e-25
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   109   2e-25
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   114   2e-25
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   113   2e-25
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   116   2e-25
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   115   2e-25
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   115   2e-25
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   115   2e-25
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   116   2e-25
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   112   2e-25
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   115   2e-25
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   115   2e-25
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   112   2e-25
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   113   2e-25
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   115   2e-25
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   113   3e-25
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   115   3e-25
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   115   3e-25
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   115   3e-25
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   115   3e-25
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   113   3e-25
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   115   3e-25
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   114   3e-25
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   113   3e-25
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   115   3e-25
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   113   3e-25
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   112   3e-25
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   114   3e-25
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   115   4e-25
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   112   4e-25
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   111   4e-25
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   111   4e-25
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   112   4e-25
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   114   4e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   112   4e-25
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   110   4e-25
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   112   5e-25
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   114   5e-25
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                111   5e-25
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   114   5e-25
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   108   5e-25
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   115   5e-25
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   114   5e-25
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              113   5e-25
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   114   6e-25
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   114   6e-25
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   112   6e-25
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   112   6e-25
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   114   7e-25
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   114   7e-25
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   112   7e-25
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   114   8e-25
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   108   8e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   107   8e-25
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   113   9e-25
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   111   9e-25
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   114   1e-24
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     114   1e-24
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   113   1e-24
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   113   1e-24
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   107   1e-24
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   112   1e-24
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   111   1e-24
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   113   1e-24
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   112   1e-24
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   111   1e-24
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   113   1e-24
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   113   2e-24
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   113   2e-24
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   113   2e-24
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   110   2e-24
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   110   2e-24
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   113   2e-24
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   112   2e-24
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   112   2e-24
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   112   2e-24
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   113   2e-24
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   112   2e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   112   2e-24
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   112   2e-24
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   106   2e-24
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   110   2e-24
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   106   2e-24
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   110   2e-24
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   112   2e-24
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   111   2e-24
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      112   2e-24
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   111   2e-24
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   112   2e-24
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   106   2e-24
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   112   3e-24
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   110   3e-24
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   112   3e-24
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   112   3e-24
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   110   3e-24
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   112   3e-24
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   110   3e-24
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   112   3e-24
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   111   3e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   110   4e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   110   4e-24
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   111   4e-24
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   111   4e-24
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   111   4e-24
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   110   4e-24
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   109   4e-24
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   110   4e-24
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   111   5e-24
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   111   5e-24
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   108   5e-24
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   110   5e-24
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   106   5e-24
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   111   5e-24
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   111   5e-24
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   111   5e-24
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   109   5e-24
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   108   5e-24
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   109   5e-24
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   110   6e-24
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   110   6e-24
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   105   7e-24
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   105   7e-24
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   110   7e-24
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   108   7e-24
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   110   7e-24
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   110   7e-24
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   110   7e-24
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   110   8e-24
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   110   8e-24
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   108   8e-24
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              109   8e-24
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   108   8e-24
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   110   8e-24
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   110   9e-24
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   109   1e-23
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   109   1e-23
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   110   1e-23
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   110   1e-23
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   109   1e-23
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   110   1e-23
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    109   1e-23
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    105   1e-23
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   109   2e-23
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   108   2e-23
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   109   2e-23
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   107   2e-23
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   109   2e-23
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   108   2e-23
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   108   2e-23
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   109   2e-23
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   107   2e-23
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   107   2e-23
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   107   2e-23
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   107   2e-23
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   108   2e-23
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   106   3e-23
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   103   3e-23
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   108   3e-23
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   107   3e-23
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   108   3e-23
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   108   3e-23
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   108   3e-23
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   107   3e-23
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   105   4e-23
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   108   4e-23
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   106   4e-23
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   108   4e-23
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   106   4e-23
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   106   4e-23
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   108   4e-23
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    106   4e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   106   4e-23
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   102   4e-23
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   106   4e-23
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   108   5e-23
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652    105   5e-23
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...   102   5e-23
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              107   5e-23
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   103   6e-23
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   104   6e-23
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   102   6e-23
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   106   6e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   107   6e-23
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   106   6e-23
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   107   7e-23
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   107   7e-23
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   107   7e-23
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   103   7e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   107   8e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   105   9e-23
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   107   9e-23
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   107   9e-23
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             101   1e-22
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   106   1e-22
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   101   1e-22
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   105   1e-22
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   105   1e-22
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   102   1e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   106   1e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   105   1e-22
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   105   1e-22
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   105   1e-22
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...   101   1e-22
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   107   1e-22
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   106   2e-22
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...   104   2e-22
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...   101   2e-22
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   101   2e-22
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   105   2e-22
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   103   2e-22
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   104   2e-22
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   105   2e-22
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   104   2e-22
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   105   2e-22
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   102   3e-22
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   105   3e-22
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...   100   3e-22
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   101   3e-22
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   105   3e-22
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    99   3e-22
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   100   3e-22
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   103   3e-22
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...   100   4e-22
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...   102   4e-22
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   103   4e-22
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   101   4e-22
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   105   4e-22
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   103   4e-22
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   105   4e-22
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   105   5e-22
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...   100   5e-22
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...   103   5e-22
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   100   6e-22
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   104   7e-22
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   102   7e-22
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    99   7e-22
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    99   7e-22
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   103   7e-22
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...   100   8e-22
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   102   9e-22
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    103   9e-22
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   103   9e-22
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    99   9e-22
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   103   9e-22
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   104   9e-22
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   104   9e-22
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...   103   9e-22
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    99   9e-22
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   102   9e-22
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   102   1e-21
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...   102   1e-21
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...   103   1e-21
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   101   1e-21
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   103   1e-21
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   100   1e-21
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   102   1e-21
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    99   1e-21
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...   100   1e-21
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    99   1e-21
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   103   1e-21
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   100   1e-21
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   101   2e-21
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...   101   2e-21
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   103   2e-21
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   101   2e-21
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...   102   2e-21
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...   102   2e-21
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...   101   2e-21
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    99   2e-21
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   100   2e-21
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...   101   2e-21
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...   102   2e-21
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...   100   2e-21
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   101   2e-21
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...   101   2e-21
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   102   2e-21
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   101   2e-21
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   102   2e-21
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...   101   3e-21
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    97   3e-21
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    97   3e-21
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...   100   3e-21
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    99   3e-21
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...   101   3e-21
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   102   3e-21
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...   101   3e-21
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   102   3e-21
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...   101   3e-21
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   102   3e-21
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   102   3e-21
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    99   3e-21
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...   101   3e-21
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   102   3e-21
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...   100   3e-21
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...   102   4e-21
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    97   4e-21
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   100   4e-21
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    99   5e-21
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   101   5e-21
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   100   5e-21
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    97   6e-21
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    99   6e-21
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   100   6e-21
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...   100   6e-21
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   100   6e-21
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   101   6e-21
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   101   6e-21
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   100   6e-21
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   100   6e-21
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   100   6e-21
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    99   6e-21
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...   100   6e-21
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   101   7e-21
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...   100   7e-21
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    96   7e-21
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    98   7e-21
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    99   7e-21
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...   100   7e-21
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24       100   8e-21
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    99   8e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    95   8e-21
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    99   8e-21
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    99   8e-21
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    99   8e-21
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   100   9e-21
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    99   9e-21
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   100   9e-21
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    99   9e-21
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    96   1e-20
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    99   1e-20
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...   100   1e-20
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    99   1e-20
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   100   1e-20
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    96   1e-20
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    97   1e-20
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    99   1e-20
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    99   1e-20
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    99   1e-20
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   100   1e-20
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    99   1e-20
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    99   1e-20
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    99   1e-20
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    98   1e-20
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    99   1e-20
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...   100   1e-20
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    96   1e-20
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    99   1e-20
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   100   1e-20
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...   100   1e-20
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   100   1e-20
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   100   1e-20
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   100   1e-20
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   100   1e-20
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    99   2e-20
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   100   2e-20
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    99   2e-20
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    95   2e-20
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   100   2e-20
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   100   2e-20
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    96   2e-20
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    95   2e-20
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    99   2e-20
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    99   2e-20
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    99   2e-20
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     99   2e-20
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...   100   2e-20
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    99   2e-20
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    99   2e-20
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    97   2e-20
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    99   2e-20
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    95   2e-20
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    98   2e-20
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    95   2e-20
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    95   2e-20
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    99   2e-20
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    95   2e-20
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    98   3e-20
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    95   3e-20
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...   100   3e-20
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    98   3e-20
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    97   3e-20
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    97   3e-20
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    99   3e-20
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    97   3e-20
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    99   3e-20
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    99   3e-20
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    97   3e-20
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    98   3e-20
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    94   3e-20
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    98   4e-20
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    98   4e-20
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    94   4e-20
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    97   4e-20
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    97   4e-20
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    96   4e-20
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    99   4e-20
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    98   4e-20
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    98   4e-20
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    97   4e-20
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    92   4e-20
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    97   4e-20
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    94   4e-20
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    99   4e-20
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    95   5e-20
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    97   5e-20
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    97   5e-20
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    95   5e-20
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    99   5e-20
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    97   5e-20
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    94   5e-20
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    93   5e-20
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    97   6e-20
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    97   6e-20
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    98   6e-20
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    94   6e-20
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    97   6e-20
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    97   6e-20
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    96   7e-20
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    97   8e-20
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    97   8e-20
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    98   8e-20
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    96   8e-20
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    94   8e-20
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    96   9e-20
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    96   9e-20
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      97   1e-19
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    95   1e-19
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    96   1e-19
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    96   1e-19
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    97   1e-19
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    98   1e-19
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    96   1e-19
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    93   1e-19
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     96   1e-19
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    96   1e-19
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    96   1e-19
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    94   1e-19
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    96   1e-19
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    97   1e-19
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    96   1e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    96   1e-19
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    96   1e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    96   1e-19
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    97   1e-19
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    97   1e-19
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    96   1e-19
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    97   1e-19
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    95   1e-19
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    95   1e-19
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    95   1e-19
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    92   2e-19
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    97   2e-19
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    97   2e-19
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    96   2e-19
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    96   2e-19
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    96   2e-19
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    95   2e-19
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    96   2e-19
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    97   2e-19
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    96   2e-19
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    96   2e-19
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    95   2e-19
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    96   2e-19
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    96   2e-19
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    96   2e-19
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    96   2e-19
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    96   2e-19
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    96   2e-19
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    93   2e-19
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    95   2e-19
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    95   2e-19
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    93   2e-19
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    95   2e-19
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    94   2e-19
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    93   2e-19
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    96   2e-19
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    96   2e-19
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    93   2e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    93   3e-19
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    93   3e-19
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    96   3e-19
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    96   3e-19
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    96   3e-19
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    96   3e-19
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    96   3e-19
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    95   3e-19
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    96   3e-19
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              96   4e-19
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    95   4e-19
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     95   4e-19
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    92   4e-19
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    95   4e-19
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    95   4e-19
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    95   4e-19
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    92   4e-19
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    95   4e-19
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    96   4e-19
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    96   5e-19
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    94   5e-19
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    95   5e-19
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    92   5e-19
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       95   6e-19
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    94   6e-19
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    94   6e-19
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    94   6e-19
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    94   7e-19
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    95   7e-19
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    95   7e-19
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    92   7e-19
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    93   7e-19
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    93   7e-19
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    94   7e-19
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    89   8e-19
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    93   8e-19
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    93   8e-19
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    94   8e-19
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    94   8e-19
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    91   8e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    94   9e-19
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    91   9e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    92   9e-19
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    94   1e-18
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    92   1e-18
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    94   1e-18
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    94   1e-18
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              94   1e-18
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    94   1e-18
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    93   1e-18
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    93   1e-18
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    91   1e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    94   1e-18
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    92   1e-18
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    92   1e-18
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    92   1e-18
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    94   1e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    93   1e-18
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    93   1e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    94   1e-18
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    92   1e-18
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    92   2e-18
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    93   2e-18
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    93   2e-18
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    93   2e-18
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    93   2e-18
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    92   2e-18
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    92   2e-18
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    92   2e-18
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    91   2e-18
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     92   2e-18
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    93   2e-18
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    91   2e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    92   2e-18
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    92   3e-18
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    93   3e-18
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    90   3e-18
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              91   4e-18
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    92   4e-18
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    92   4e-18
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    92   5e-18
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    89   5e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    91   5e-18
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    91   5e-18
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    92   5e-18
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             92   5e-18
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    92   5e-18
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    91   6e-18
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    92   6e-18
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    91   6e-18
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    91   6e-18
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    92   6e-18
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    90   6e-18
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    91   6e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    91   7e-18
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    89   7e-18
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    90   7e-18
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    91   7e-18
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    88   8e-18
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    88   8e-18
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    91   8e-18
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    89   9e-18
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    90   9e-18
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    91   9e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    90   9e-18
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    91   1e-17
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    91   1e-17
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    91   1e-17
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    89   1e-17
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    88   1e-17
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    88   1e-17
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    91   1e-17
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    91   1e-17
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    91   1e-17
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    89   1e-17
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    91   1e-17
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    89   1e-17
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    89   2e-17
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    91   2e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    89   2e-17
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    90   2e-17
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    89   2e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    89   2e-17
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    90   2e-17
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    90   2e-17
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    90   2e-17
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    88   2e-17
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    89   2e-17
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    90   2e-17
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    89   2e-17
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    89   2e-17
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    89   3e-17
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    90   3e-17
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    89   3e-17
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    89   3e-17
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     87   3e-17
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    87   3e-17
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    89   3e-17
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    89   3e-17
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    89   3e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    89   3e-17
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    89   4e-17
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    89   4e-17
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    89   4e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    89   4e-17
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    89   4e-17
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    86   4e-17
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    89   4e-17
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    88   4e-17
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    86   4e-17
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    88   4e-17
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    89   5e-17
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    89   5e-17
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      88   5e-17
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    87   5e-17
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    87   5e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    87   5e-17
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    89   5e-17
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    88   5e-17
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    88   5e-17
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    87   6e-17
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    87   6e-17
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    88   6e-17
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    89   6e-17
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    87   6e-17
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    88   7e-17
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    86   8e-17
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    87   8e-17
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    88   8e-17
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    87   8e-17
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    86   8e-17
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    86   8e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    86   9e-17
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    84   9e-17
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    87   9e-17
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    88   1e-16
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    87   1e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    87   1e-16
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    85   1e-16
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    87   1e-16
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    85   1e-16
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    87   1e-16
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    87   1e-16
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    87   1e-16
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    87   1e-16
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    86   1e-16
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    85   1e-16
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    88   1e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    85   1e-16
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    87   1e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    86   1e-16
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               87   1e-16
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    86   1e-16
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    87   1e-16
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    86   1e-16
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    87   1e-16
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    85   1e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    86   1e-16
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    87   1e-16
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    87   2e-16
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    86   2e-16
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    86   2e-16
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    87   2e-16
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     86   2e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     85   2e-16
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    86   2e-16
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    86   2e-16
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    86   2e-16
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    86   2e-16
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    84   2e-16
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    85   2e-16
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    86   2e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    86   2e-16
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    86   2e-16
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    86   2e-16
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    84   2e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    86   2e-16
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    86   3e-16
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    86   3e-16
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    86   3e-16
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    84   3e-16
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    86   3e-16
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    86   3e-16
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    84   3e-16
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    86   4e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    84   4e-16
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    86   4e-16
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    86   4e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    86   4e-16
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     84   4e-16
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    86   4e-16
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    85   4e-16
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    86   4e-16
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    84   4e-16
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    85   4e-16
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    84   4e-16
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    84   5e-16
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    84   5e-16
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    84   5e-16
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    85   5e-16
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    83   5e-16
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    83   6e-16
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    84   6e-16
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    84   6e-16
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    83   7e-16
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    84   7e-16
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    81   7e-16
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    84   7e-16
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    85   8e-16
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    84   8e-16
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    84   9e-16
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    82   9e-16
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    84   1e-15
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      84   1e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    82   1e-15
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    83   1e-15
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    84   1e-15
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    84   1e-15
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    84   1e-15
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    84   1e-15
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    83   1e-15
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    82   1e-15
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    83   1e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    83   1e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    82   1e-15
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    84   1e-15
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    82   1e-15
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    83   1e-15
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    82   1e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    82   1e-15
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    82   2e-15
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    83   2e-15
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    83   2e-15
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    83   2e-15
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    83   2e-15
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    84   2e-15
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    82   2e-15
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    83   2e-15
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    81   2e-15
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    83   2e-15
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    84   2e-15
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    82   2e-15
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    82   2e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     83   2e-15
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    83   2e-15
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    82   2e-15
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    83   2e-15
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    83   2e-15
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    83   3e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    81   3e-15
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    82   3e-15
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    83   3e-15
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    82   3e-15
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    80   3e-15
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    82   3e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    82   4e-15
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    82   4e-15
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    80   4e-15
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    82   4e-15
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    80   4e-15
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    82   4e-15
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    82   4e-15
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    81   4e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    82   4e-15
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    80   5e-15
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    80   5e-15
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    82   5e-15
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    81   5e-15
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    80   5e-15
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    80   5e-15
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    82   5e-15
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    82   6e-15
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     81   6e-15
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    81   7e-15
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    80   7e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    79   8e-15
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    79   8e-15
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    81   8e-15
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               81   9e-15
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    79   9e-15
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    81   1e-14
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    81   1e-14
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    80   1e-14
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    80   1e-14
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    80   1e-14
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    80   1e-14
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    80   1e-14
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    79   1e-14
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    79   1e-14
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    80   1e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    80   1e-14
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    79   1e-14
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    78   1e-14
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    79   1e-14
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    80   1e-14
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              80   2e-14
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    79   2e-14
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    80   2e-14
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    80   2e-14
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    78   2e-14
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    78   2e-14
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    78   2e-14
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    80   2e-14
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    80   2e-14
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    78   2e-14
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    79   2e-14
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    78   2e-14
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    80   2e-14
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    78   2e-14
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    78   2e-14
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    77   2e-14
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    79   3e-14
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    79   3e-14
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    79   3e-14
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    77   3e-14
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    79   3e-14
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    77   3e-14
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    79   3e-14
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    79   3e-14
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     79   3e-14
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    79   3e-14
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    79   3e-14
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    79   3e-14
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    79   3e-14
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    77   4e-14
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    78   4e-14
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    79   4e-14
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    77   4e-14
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    79   4e-14
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    78   4e-14
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    77   4e-14
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    79   5e-14
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    78   5e-14
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             77   5e-14
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    78   5e-14
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    77   5e-14
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    78   5e-14
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    78   5e-14
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    78   6e-14
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    79   6e-14
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    79   6e-14
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    76   7e-14
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    76   7e-14
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    77   7e-14
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    78   7e-14
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    78   7e-14
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    76   8e-14
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     78   8e-14
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    78   8e-14
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    76   8e-14
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    75   9e-14
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    76   9e-14
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    76   1e-13
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    78   1e-13
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    76   1e-13
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    78   1e-13
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    77   1e-13
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    76   1e-13
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    77   1e-13
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    76   1e-13
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    77   1e-13
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    77   1e-13
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    75   1e-13
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    75   1e-13
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    77   1e-13
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    77   1e-13
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    75   1e-13
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    75   1e-13
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    77   1e-13
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               75   1e-13
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    77   2e-13
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    77   2e-13
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    76   2e-13
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    76   2e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    77   2e-13
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    75   2e-13
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    75   2e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    77   2e-13
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    77   2e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    75   2e-13
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    77   2e-13
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    77   2e-13
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    76   2e-13
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    77   2e-13
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    75   2e-13
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    77   2e-13
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    74   2e-13
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    76   3e-13
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    74   3e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   3e-13
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    76   3e-13
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    74   4e-13
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    75   4e-13
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    75   4e-13
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    76   4e-13
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    76   4e-13
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    74   4e-13
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    75   4e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    74   5e-13
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    75   5e-13
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    75   5e-13
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    75   5e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    75   6e-13
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      75   6e-13
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    75   6e-13
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    74   6e-13
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    75   6e-13
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    75   6e-13
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    75   6e-13
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    75   7e-13
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    74   7e-13
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    75   7e-13
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    74   7e-13
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    75   7e-13
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    74   8e-13
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    74   8e-13
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    74   9e-13
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    74   9e-13
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    74   9e-13
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    74   1e-12
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               73   1e-12
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    73   1e-12
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    73   1e-12
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    74   1e-12
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    74   1e-12
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    73   1e-12
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    74   1e-12
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    74   1e-12
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    73   1e-12
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    74   1e-12
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    74   1e-12
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    72   2e-12
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    74   2e-12
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    74   2e-12
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    72   2e-12
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    74   2e-12
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    74   2e-12
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    74   2e-12
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    74   2e-12
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    74   2e-12
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    73   2e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    73   2e-12
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    73   3e-12
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    73   3e-12
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    73   3e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    72   3e-12
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    72   3e-12
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               73   3e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    73   3e-12
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    73   3e-12
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    73   4e-12
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    72   4e-12
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    72   4e-12
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     72   4e-12
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    72   4e-12
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    72   4e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    72   5e-12
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    72   5e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    72   5e-12
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    72   5e-12
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      72   6e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     72   6e-12
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    70   6e-12
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    72   6e-12
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    72   7e-12
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    71   7e-12
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    71   8e-12
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    72   9e-12
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    70   1e-11
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               70   1e-11
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    71   1e-11
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    71   1e-11
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    70   1e-11
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    71   1e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    71   1e-11
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    71   1e-11
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    71   1e-11
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    71   1e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       71   1e-11
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    71   1e-11
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    69   2e-11
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    71   2e-11
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    70   2e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    70   2e-11
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    70   2e-11
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    69   2e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   2e-11
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    70   2e-11
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    70   3e-11
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    70   3e-11
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    68   4e-11
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    69   4e-11
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    69   4e-11
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    69   5e-11
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    69   5e-11
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    69   6e-11
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    69   6e-11
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    69   6e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     68   6e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    68   6e-11
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    69   7e-11
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    69   7e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    68   7e-11
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    67   7e-11
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    68   7e-11
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    68   7e-11
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    69   7e-11
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    68   8e-11
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    69   8e-11
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    67   8e-11
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    68   8e-11
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    67   8e-11
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    68   8e-11
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    69   8e-11
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    69   8e-11
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    67   9e-11
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    68   1e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    68   1e-10
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    68   1e-10
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    68   1e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    68   1e-10
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    67   1e-10
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    68   1e-10
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    66   1e-10
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    68   1e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    67   1e-10
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    67   2e-10
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    66   2e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    67   2e-10
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    67   2e-10
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    67   2e-10
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    67   2e-10
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    67   2e-10
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    67   2e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    66   2e-10
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    67   2e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    66   2e-10
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    67   2e-10
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    67   3e-10
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    67   3e-10
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    66   3e-10
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    66   3e-10
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    66   3e-10
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    65   4e-10
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    66   4e-10
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    66   5e-10
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    66   5e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    65   5e-10
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    65   5e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   6e-10
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    65   6e-10
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    64   6e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    65   7e-10
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    65   7e-10
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    65   7e-10
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               65   8e-10
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    65   8e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    64   8e-10
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    65   9e-10
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    64   1e-09
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    64   1e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    64   1e-09
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    64   1e-09
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    63   1e-09
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    64   1e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    63   1e-09
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    64   2e-09
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    64   2e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    63   2e-09
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    64   2e-09
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    64   2e-09
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    64   2e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    64   2e-09
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    64   2e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    63   2e-09
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    64   2e-09
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    64   2e-09
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    64   2e-09
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    64   2e-09
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    63   2e-09
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    63   2e-09
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    63   2e-09
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    63   3e-09
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    63   3e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    63   3e-09
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    63   3e-09
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    63   3e-09
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    63   3e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   4e-09
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    62   4e-09
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    63   4e-09
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    63   4e-09
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    62   4e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    62   5e-09
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    62   5e-09
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    63   5e-09
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    62   5e-09
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    62   5e-09
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    63   5e-09
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    62   5e-09
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    62   5e-09
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    61   5e-09
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    62   5e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    62   6e-09
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    62   6e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    62   6e-09
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    62   6e-09
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    62   6e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    62   6e-09
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    62   7e-09
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    61   7e-09
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    62   8e-09
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    62   9e-09
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    61   9e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    62   9e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    61   1e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    61   1e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    61   1e-08
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    61   1e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    60   1e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    61   1e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    60   1e-08
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    61   1e-08
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    61   1e-08
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    61   2e-08
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    60   2e-08
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    61   2e-08
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    60   2e-08
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    60   2e-08
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    59   2e-08
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    60   2e-08
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    60   3e-08
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    60   3e-08
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               60   3e-08
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    60   3e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    60   3e-08
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    60   3e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    60   3e-08
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    60   3e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    59   4e-08
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    59   4e-08
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    60   4e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    59   4e-08
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    59   5e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    58   7e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    58   7e-08
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    59   8e-08
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    59   9e-08
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    58   1e-07
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    58   1e-07
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    57   1e-07
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    58   2e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    57   2e-07
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    57   2e-07
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    56   2e-07
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    57   2e-07
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    56   3e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    57   3e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    57   3e-07
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    57   3e-07
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    55   5e-07
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    55   6e-07
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    55   6e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    55   7e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    55   7e-07
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    54   8e-07
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    55   9e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    55   1e-06
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    55   1e-06
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    55   1e-06
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    54   1e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    54   1e-06
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    54   1e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    54   1e-06
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    54   2e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    54   2e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    54   2e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    54   2e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    54   2e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    54   2e-06
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    54   3e-06
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    53   3e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    53   3e-06
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    53   4e-06
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    52   4e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    53   4e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    53   4e-06
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    53   4e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    52   6e-06
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    52   7e-06
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    52   8e-06
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    51   8e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    51   1e-05
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    51   2e-05
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    50   2e-05
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    50   2e-05
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    50   3e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    49   3e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    49   3e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    50   4e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    49   4e-05
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    49   6e-05
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    49   6e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    48   7e-05
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    49   7e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    49   7e-05
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    46   8e-05
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    49   9e-05
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    49   1e-04
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    48   1e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    48   1e-04
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     48   1e-04
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    48   2e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    47   2e-04
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    47   2e-04
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    47   2e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    47   3e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    47   3e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    46   4e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    47   4e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    46   4e-04
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    47   4e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    46   5e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    46   5e-04
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    45   6e-04
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    45   7e-04
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     45   7e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    45   8e-04
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    45   8e-04
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    45   8e-04
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    45   9e-04
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    45   0.001
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    45   0.001
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    45   0.001
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    45   0.001
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    45   0.001
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    44   0.001
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    45   0.001
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    43   0.002
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    44   0.002
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    44   0.002
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    44   0.002
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     44   0.003
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    43   0.003
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    44   0.003
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    44   0.003
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    43   0.004
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    43   0.004
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.004
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    43   0.004
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    43   0.004
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    43   0.004
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    43   0.004
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    43   0.004
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    43   0.004
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    43   0.004
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    43   0.005
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    43   0.005
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    43   0.005
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.006
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    43   0.006
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    43   0.006
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.007
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.007
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    42   0.007
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    42   0.007
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    42   0.008
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    42   0.008
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    42   0.008
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    42   0.008
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    42   0.009
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    42   0.009
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    42   0.009
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    42   0.009
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.009
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    42   0.010
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    42   0.010
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    42   0.011
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    42   0.011
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    42   0.011
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    42   0.011
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    41   0.012
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    41   0.013
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    42   0.013
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     41   0.014
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    41   0.015
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    39   0.015
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    41   0.021
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    41   0.022
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    40   0.023
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    40   0.026
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    40   0.026
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    41   0.027
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    40   0.027
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    40   0.029
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    40   0.032
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    40   0.035
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    40   0.037
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    40   0.038
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    40   0.040
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    40   0.042
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    39   0.054
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    39   0.058
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    39   0.058
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    39   0.060
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    39   0.066
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    39   0.066
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    39   0.067
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    39   0.075
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    39   0.083
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    39   0.083
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    39   0.091
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    39   0.093
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.097
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    39   0.097
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    39   0.099
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    39   0.10 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    38   0.15 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    38   0.16 
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    38   0.16 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    38   0.17 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    38   0.17 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    38   0.19 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    38   0.20 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    37   0.20 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    38   0.21 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    38   0.21 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     37   0.24 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    37   0.26 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    37   0.30 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    37   0.33 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    37   0.34 
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    37   0.35 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    37   0.35 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    37   0.41 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    36   0.45 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.47 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    36   0.47 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    36   0.62 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    36   0.63 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    36   0.70 
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    36   0.75 
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    35   0.88 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   0.89 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   0.98 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   1.6  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    34   2.2  
Kpol_316.1 s316 complement(395..2935,2937..5180) [4785 bp, 1594 ...    34   2.4  
YGL083W Chr7 (353058..355472) [2415 bp, 804 aa] {ON}  SCY1Putati...    34   3.0  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    33   3.3  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    33   3.7  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    33   3.9  
NCAS0D03690 Chr4 (688360..690804) [2445 bp, 814 aa] {ON} Anc_6.1...    33   4.5  

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score = 2075 bits (5375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1032/1117 (92%), Positives = 1032/1117 (92%)

Query: 1    MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNT 60
            MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNT
Sbjct: 1    MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNT 60

Query: 61   KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120
            KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE
Sbjct: 61   KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120

Query: 121  LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180
            LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM
Sbjct: 121  LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180

Query: 181  AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240
            AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN
Sbjct: 181  AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240

Query: 241  IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300
            IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD
Sbjct: 241  IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300

Query: 301  SKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY 360
            SKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY
Sbjct: 301  SKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY 360

Query: 361  ALLYRFKIEAENLSAKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFN 420
            ALLYRFKIEAENLSAKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFN
Sbjct: 361  ALLYRFKIEAENLSAKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFN 420

Query: 421  RLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSPT 480
            RLPTISNGKTNNIIPNGRNGDSNNTTPKSNKR               VQGHSNGNSNSPT
Sbjct: 421  RLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGNSNSPT 480

Query: 481  PSRSKRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITTKLL 540
            PSRSKRISLINLDNSTAPPIPVNVLKDY               LTFLGNGKRGSITTKLL
Sbjct: 481  PSRSKRISLINLDNSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNGKRGSITTKLL 540

Query: 541  STYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXXXXX 600
            STYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL           
Sbjct: 541  STYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVREAKEGE 600

Query: 601  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYENPRSVS 660
                                         NHIDQEISNLKADLANETKGAEPYENPRSVS
Sbjct: 601  ARERREQESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKGAEPYENPRSVS 660

Query: 661  APLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEID 720
            APLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEID
Sbjct: 661  APLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEID 720

Query: 721  REKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVADKAAIGVI 780
            REKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVADKAAIGVI
Sbjct: 721  REKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVADKAAIGVI 780

Query: 781  PLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNL 840
            PLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNL
Sbjct: 781  PLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNL 840

Query: 841  ASEANNTTTSKASTEPEFQFESVNEGTANKLYELQEEPEYTDVNKEDGKPKKNVKLPTLP 900
            ASEANNTTTSKASTEPEFQFESVNEGTANKLYELQEEPEYTDVNKEDGKPKKNVKLPTLP
Sbjct: 841  ASEANNTTTSKASTEPEFQFESVNEGTANKLYELQEEPEYTDVNKEDGKPKKNVKLPTLP 900

Query: 901  PLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQ 960
            PLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQ
Sbjct: 901  PLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQ 960

Query: 961  ATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVY 1020
            ATKKIN               LNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVY
Sbjct: 961  ATKKINKPKQRQPKKEEERKPLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVY 1020

Query: 1021 VNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESK 1080
            VNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESK
Sbjct: 1021 VNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESK 1080

Query: 1081 GKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVLSA 1117
            GKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVLSA
Sbjct: 1081 GKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVLSA 1117

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/1134 (57%), Positives = 776/1134 (68%), Gaps = 153/1134 (13%)

Query: 14   IKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANT 73
            +KGDTIGPWKLG+TLGLGSTGKV+LA+NETT+QQAAIKIISKSIF ++    E+SMV+N+
Sbjct: 10   MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIF-SQGTVGESSMVSNS 68

Query: 74   -PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP 132
             PD+LPYGIEREIIIMKLLRH NVLSLYDVWETNS LYMILEYAEKGELFNLLVE+GPLP
Sbjct: 69   SPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP 128

Query: 133  EKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 192
            EKEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK NIKIADFGMAALET+DK+LET
Sbjct: 129  EKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLET 188

Query: 193  SCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ 252
            SCGSPHYAAPEIVSG+PYHGF+SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG+
Sbjct: 189  SCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE 248

Query: 253  FEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDT 312
            +EMPDDDE+S++AQDLI RILTVDP +RIKTR+ILKHPLLQKYPSIKDS+SIKNLPREDT
Sbjct: 249  YEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDT 308

Query: 313  YLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAEN 372
            YL+PLS+NNS+ID SILQNLV LWHGRDK+ IA KL+ESGA+AEKT+YALLYRFK+EAE 
Sbjct: 309  YLYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAEK 368

Query: 373  LSAKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFNRLPTISNGKTNN 432
            +                   N  + PR+KNRIS +SVSSS KRPVS  ++ T+       
Sbjct: 369  M-------------------NTCSSPRRKNRISMISVSSSHKRPVSMKKISTV------- 402

Query: 433  IIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSPTPSRSKRISLINL 492
                       N TP SN+R               +  H+N   +SPTPSR+KRIS+IN+
Sbjct: 403  ----------QNNTPPSNRRLSISLSSTQRKRMSGILQHTN---SSPTPSRTKRISVINI 449

Query: 493  DNS---TAPPIPVNVLKDYXXXXXXXXXXXXXX-------XLTFLGNGKRGSITTKLLST 542
            D+S     PP+P+ +L+DY                      LT + N KR SITTKLLST
Sbjct: 450  DDSENKAPPPVPMEMLEDYKNNSKNVRRTIKKKKKKKNNYRLTLV-NNKRVSITTKLLST 508

Query: 543  YAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXXXXXXX 602
            YAKLSEDDNWEYIE+ETKRTSSDFATLIDE+FEHEKYE+IRKEKEEL             
Sbjct: 509  YAKLSEDDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEEL----------ERK 558

Query: 603  XXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYENPRSVSAP 662
                                         ID+EIS LK D       A   +N RSVSAP
Sbjct: 559  VRETRVREQRREEEERAELQREQLKLQQKIDEEISKLKED-------ALEKDNFRSVSAP 611

Query: 663  LERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLL----SDIDQE 718
            ++    E      N+L  RR  SLQTRP SRLDPGILYSAPAE  S   +    S     
Sbjct: 612  IKENEDEDENE--NELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYERVVVNESGNKSS 669

Query: 719  IDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVADKAAIG 778
              +++KILETIRRS+FLGSS+NI +ELEF+++  L  T +         Q +  D+  + 
Sbjct: 670  AQQQRKILETIRRSKFLGSSFNIQQELEFSQRNVLVPTKE---------QVVDVDEVKL- 719

Query: 779  VIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGV 838
                   E GLRKISE+K+PQFTRKSRHFS+SN+RLSVLSMYSTKQSYTNLG ILK+G  
Sbjct: 720  -------EGGLRKISEVKIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDG-- 770

Query: 839  NLASEANNTTTSKASTEPEFQFESVNEGTANKLYELQEEPEYTDVNKEDGKPKKNVKLPT 898
                      +  A   PE  FES   G  ++LYE+ EEPE  +  ++     + V LP 
Sbjct: 771  -------TEESEPAKKTPELLFES---GRDDRLYEVSEEPEIQEEKED----IETVTLPQ 816

Query: 899  LPPLHEKTN--------QANGLAIYQSSS----DDDKKPTEPQPKSQSMIPERQDSINNS 946
            LPPL +  N        + NGLAI++       +D  K  +    SQ    ++  +INN 
Sbjct: 817  LPPLKQSANTNANANETEINGLAIFRPKENIELEDITKEVKEVIPSQDHGKDKPIAINNP 876

Query: 947  ASVKKTPVVEPESQATKKINXXXXXXXXXXXXXXXLNEMPPN----VEKKRNVSFFRKFS 1002
               K+   V+PE Q                     L+E+ PN     EKKRNVSFFRKFS
Sbjct: 877  ---KQRLEVKPERQ---------------------LDEIAPNKVGTTEKKRNVSFFRKFS 912

Query: 1003 KSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSN 1062
             +SA    T  G+D+E+YVN+ + QLY GL +LL+GW++YGLKDV+S +  MK+TGKL+N
Sbjct: 913  NNSA----TIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDNTAMKITGKLAN 968

Query: 1063 DNILSLRSTVFEMIVESKG-KQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            DNILSLRST+FE++VE KG K S++GF K+ GSSK VRRLF EIEKVL +EGVL
Sbjct: 969  DNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKVVRRLFTEIEKVLNKEGVL 1022

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1153

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1182 (54%), Positives = 793/1182 (67%), Gaps = 105/1182 (8%)

Query: 5    AENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNS 64
            A + +++PT+KG+ IGPWKLGETLGLGSTGKVQLA++E+TNQQAAIK+ISK+IFN K + 
Sbjct: 3    AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62

Query: 65   NETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
             ++S+ A+TPDSLPYGIEREIIIMKLL H NVL LYDVWETNSNLYM+LEYA+KGELFNL
Sbjct: 63   KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122

Query: 125  LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
            LVE+GPLPEKEA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE
Sbjct: 123  LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182

Query: 185  TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
            TEDKLLETSCGSPHYAAPEIVSGIPYHGF SDVWSCGVILFALLTGRLPFD+EDGNIRNL
Sbjct: 183  TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242

Query: 245  LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSI 304
            LL+VQSG++EMP DDE+S DAQDLI+RILTVDP +RIK R+ILKHPLLQKYPSI DSKSI
Sbjct: 243  LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302

Query: 305  KNLPREDTYLFPLSDNNSV-IDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363
            +NLPREDTYL PLS+  S  ID +ILQNLVVLWHGR++ +I  KL+E GANAEKT+YALL
Sbjct: 303  RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362

Query: 364  YRFKIEAENLSAKQEQVKRKQSII--------KKSTANVST--PPRKKNRISTMSVSSSR 413
             RFK + EN S K  Q K++ S I        KK+ +   T   P+++NR S +SVSSS 
Sbjct: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422

Query: 414  KRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTP--------KSNKRXXXXXXXXXXXXX 465
            KRPVSFN+L        +N++  G    SN+ TP         SNKR             
Sbjct: 423  KRPVSFNKL--------SNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYT------- 467

Query: 466  XXVQGHSNGNSNSPTP-SRSKRISLINLDN---STAPPIPVNVLKDYXXXXXXXXXXXXX 521
                     NS SPTP SR KR+S+++L+    +  PP+P+ +LKDY             
Sbjct: 468  ---------NSGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNN 518

Query: 522  XXLTFLGNGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQ 581
              L+F  + KRGSITTKL+STYAKLSEDD+WEYIEKETKRTSSDFATL D+IFEHEK+EQ
Sbjct: 519  MRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQ 578

Query: 582  IRKEKEELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKA 641
            IR+EKEEL                                          +D+E++NL  
Sbjct: 579  IRREKEELERKVRETKEREERERREKEIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGK 638

Query: 642  DL---ANETKGAEPYE-----NPRSVSAPLERE--NPEA-IERDINDLFARRNVSLQTRP 690
            +L    N  + A+  +     N RSVS PL+++  +P A ++ +I+DL  +R  SLQTRP
Sbjct: 639  ELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRP 698

Query: 691  KSRLDPGILYSAPAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKK 750
             SRLDPG+  S  +E       S+   +++ +K ILETIRRS+FLGSS++INKEL    K
Sbjct: 699  VSRLDPGVFSSDSSEK-DQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKEL----K 753

Query: 751  TALAETSKKEKRSKVTSQNIVA---DKAAIGVIPLNDT----------EAGLRKISEIKV 797
             A    +KK+++SK TS  I++   D+    ++P N T          +A  RKIS+IKV
Sbjct: 754  RAADNEAKKQRQSKATSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKV 813

Query: 798  PQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTEPE 857
            PQFTRKSR F +SN+RLSVLSMYS+KQSYTNL D+L E   N A    ++   ++  EPE
Sbjct: 814  PQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASN-AKGNRDSPNDQSGHEPE 872

Query: 858  FQFESVNE-----GTANKLYELQEEPEYTDVNKE-------------DGKPK----KNVK 895
            F FE+V E     G ++    L E PE +++ KE             +G+ +    KNV+
Sbjct: 873  FLFENVQEDGEVTGDSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVR 932

Query: 896  LPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVV 955
            LPTLPPL  K  +A GL IYQSSS+   +P +   KS     E Q S        K    
Sbjct: 933  LPTLPPLDGK--EAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNA 990

Query: 956  EPESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNG- 1014
            + E Q    +N                       EKKRN SFFRKFSKSS   T   NG 
Sbjct: 991  QVERQQEAPLNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKT---NGE 1047

Query: 1015 FDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFE 1074
            FD E+Y +V+A QL+ GL  LLQGW KYGLK VKS  + + LTGKLS++NILSLRST+FE
Sbjct: 1048 FDAELYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFE 1107

Query: 1075 MIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVLS 1116
            M+V S+GK S+VGF K SGS+KT++RL  EIEKVL +E VL+
Sbjct: 1108 MVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLT 1149

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
            (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/1171 (54%), Positives = 784/1171 (66%), Gaps = 108/1171 (9%)

Query: 4    LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63
            ++ NK  I ++KGDTIGPWKLGETLGLGSTGKVQLA+NE+TNQQAAIK+ISKS+F++   
Sbjct: 2    ISSNKGNI-SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSM-- 58

Query: 64   SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
             N +SMV++TPDSL YGIEREIIIMKLL H NVL LYDVWETN+NLYM+LEYAEKGELFN
Sbjct: 59   GNNSSMVSSTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118

Query: 124  LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
            LLVEKGPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAAL
Sbjct: 119  LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178

Query: 184  ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243
            ETEDKLLETSCGSPHYAAPEIVSG+PYHG E+DVWSCGVILFALLTGRLPFDEEDGNIRN
Sbjct: 179  ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238

Query: 244  LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303
            LLLKVQ G+FEMP DDE+S++AQDL+ +IL VDP KRIK+REILKHPLLQKYPSIKDSK+
Sbjct: 239  LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKT 298

Query: 304  IKNLPREDTYLFPLSDN---NSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY 360
            I+NLPREDTYL PL  N   ++ ID +ILQNLVVLWHGR+++ IA KL+E GANAEKT+Y
Sbjct: 299  IRNLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLY 358

Query: 361  ALLYRFKIEAENLSAKQEQVKRKQSII-----KKSTANVSTPPRKKNRISTMSVSSSRKR 415
            ALLYRFK+++E  + K  Q+K++QSII     K    N +TP +KKNR S +SVSSS KR
Sbjct: 359  ALLYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKR 418

Query: 416  PVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGN 475
            PVS NRL TI NGK    +P+     S+NTTP S+KR                      N
Sbjct: 419  PVSLNRLSTIQNGKDVISVPS-----SSNTTPGSSKRISMSLSSNKGSKIL-----PQSN 468

Query: 476  SNSPTPS-RSKRISLINLDNST-APPIPVNVLKDYXXXXXXXXXXXXXX----XLTFLGN 529
            S SPTP+ R+KR+S+ NL+ S+  PPIPV++LKDY                   L+ L N
Sbjct: 469  SGSPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPN 528

Query: 530  GKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589
             KRGSITTK++STYAKLSEDD+WE+IEKETKR SSDFATLIDEIFEHEKYEQIRKEKEEL
Sbjct: 529  AKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEEL 588

Query: 590  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKG 649
                                                      I +E   L+ D  N  + 
Sbjct: 589  ERKVRENKEREERQKRQKEVELAAIAREREELQRRLEEEETQITKE---LQQDTKNFQED 645

Query: 650  AEPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSN 709
               ++N RS+S+P+E  N    E D +    +R+ SLQTRP S+LDPGI   +       
Sbjct: 646  EVVHKNVRSISSPVENGNEAKSEEDAS---GQRSFSLQTRPVSKLDPGIKCGSNKPVQME 702

Query: 710  PLLSD-IDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTA-LAETSKKEKRSKVTS 767
             ++ D +D+ ID +K ILETIRRS+FLGSS+NI+KEL+  KK A +    K +K  +  S
Sbjct: 703  EIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVS 762

Query: 768  QNIVA---DKAAIGVIPLNDTEAGL----------RKISEIKVPQFTRKSRHFSNSNRRL 814
              IV+   ++    V+P N T  G           RKIS+I+VPQFTRKS+ F++SN+RL
Sbjct: 763  GRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRL 822

Query: 815  SVLSMYSTKQSYTNLGDILKEGGVNLA-SEANNTTTSKASTEPEFQFESV---------- 863
            SVLS+YS+ QSYTNL ++LKEGGV++  +E +N    + S EPEFQFE+V          
Sbjct: 823  SVLSIYSSTQSYTNLANVLKEGGVDIGVNEGSNNV--EVSEEPEFQFETVGTEIENNKYE 880

Query: 864  -----------NEGTANKLYELQEEPEYTDVNKEDGKPKKNVKLPTLPPLHEKTNQANGL 912
                       ++G   KL          +VN+        VKLPTLPPL +    ++GL
Sbjct: 881  EEKEIENENNLSQGANIKLNYADRFDTAGNVNE--------VKLPTLPPLGD-DKVSDGL 931

Query: 913  AIYQSSSDDDKKPTEPQP-----KSQSMIPERQDSINNSASVKKTPV--VEPESQATKKI 965
             IY S S  +   ++P P     KS+  + E+           K P+  V P+++ TKK 
Sbjct: 932  GIYSSKSGSEGNESKPVPSIKENKSEETLKEKNVE-------PKPPLNDVVPKTRDTKKT 984

Query: 966  NXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSA 1025
            N                N    + +K R+ SFFRK SK   V   T  G+D +++ NVS 
Sbjct: 985  NVVQN------------NNAKHSSDKPRSTSFFRKISKGLTVQNDT-TGYDVKLFSNVSV 1031

Query: 1026 PQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSV 1085
             QLY GL  LL+GW  YGLK++KS      ++ +LS+DNILSLRST  +M+V S+GK SV
Sbjct: 1032 TQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSV 1091

Query: 1086 VGFNKISGSSKTVRRLFVEIEKVLRQEGVLS 1116
            +GF K SGSSKT++RL  E+EKVLR+EGVL+
Sbjct: 1092 IGFRKKSGSSKTLKRLTSEVEKVLRKEGVLA 1122

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1171 (54%), Positives = 777/1171 (66%), Gaps = 128/1171 (10%)

Query: 11   IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70
            +P+IKGD +GPWKLGETLGLGSTGKVQLA N+TT +QAAIK+ISKS+FN   N++  S  
Sbjct: 7    LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN---NNSAQSSS 63

Query: 71   ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130
              TPD+LPYGIEREIIIMKLL H NVL LYDVWETNSNLYM+LEYAEKGELFNLLVEKGP
Sbjct: 64   LTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGP 123

Query: 131  LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 190
            L E+EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALETEDKLL
Sbjct: 124  LQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLL 183

Query: 191  ETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250
            ETSCGSPHYAAPEIVSGIPYHGF SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS
Sbjct: 184  ETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 243

Query: 251  GQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
            G+FEMP DDE+S +AQDL+++ILTVDP KRI+ R+ILKHPLLQKYPSIKDSKSI+NLPRE
Sbjct: 244  GEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRE 303

Query: 311  DTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370
            DTYL PLSDNNS ID +ILQNLVVLWHGRD  +I +KLKE GANAEKT+YALL RFKI++
Sbjct: 304  DTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDS 363

Query: 371  ENLSAKQEQVKRKQSI---IKKSTA-NVSTPPRKKNRISTMSVSSSRKRPVSFNRLPTIS 426
            E  + K EQ++++QSI   + +S A   STP R+KNRIS +SVSSS K+P SFNRL ++ 
Sbjct: 364  EKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVV 423

Query: 427  NGKTNNIIPNGRNGDSNNTTPKS-NKRXXXXXXXXXXXXXXXVQGHSNGNSNSPTPS-RS 484
            +   NN+  +     +  +   S NK+               +   SN N++SPTP+ R+
Sbjct: 424  H---NNLSASSSTTTTPASKKFSMNKK------------LSMIADKSNSNNSSPTPAHRN 468

Query: 485  KRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITTKLLSTYA 544
            KR S+IN D  +                           L+ + N KRGSITTKL++TYA
Sbjct: 469  KRTSMINTDRQSI-------------LSKNKRASRSSKRLSVMANMKRGSITTKLIATYA 515

Query: 545  KLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXXXXXXXXX 604
            KLSEDD+WEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL               
Sbjct: 516  KLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVRLAKEREEEER 575

Query: 605  XXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPY--ENPRSVSAP 662
                                       +D+EI NL+ADL  + +  +    +N RSVS P
Sbjct: 576  RRREEEELHKLNEEKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVP 635

Query: 663  LERENPEAIERDIND-LFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSD---IDQE 718
            L +E        +ND L  +RN SLQTRP SRLDPG+ +S  + T   P+  D    +++
Sbjct: 636  LSKET-------VNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKK 688

Query: 719  IDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVAD---KA 775
            +D EK ILETIRRS+FLGSS++IN+EL+ A+K  +   + +    K+T++N  +D   K 
Sbjct: 689  LDTEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQ----KLTTENKSSDELPKH 744

Query: 776  AIGVIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILK- 834
            A+G   LN + A + KIS+I+VPQFTRKSRHF+ SNRRLSVLSMYST+QS++NL DILK 
Sbjct: 745  AVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKN 804

Query: 835  -EGGVNLASEANNTTTSKASTEPEFQFESVNE--------GTANKLYEL-----QEEPEY 880
             E G  L      T T  ++ + EF FE+VNE           +KLYE+      E+P  
Sbjct: 805  TEAGTEL---GQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSG 861

Query: 881  TDVNKED---------GKPKKNV--KLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQ 929
              +N  D          +P +++  KLP LPPL  K     GL IYQ+SS     P EPQ
Sbjct: 862  MKLNFADRFNKKEEDSTEPSRDIQNKLPVLPPLDGKA----GLGIYQTSS-----PIEPQ 912

Query: 930  ---------------------PKSQ--SMIPERQDSINNSASVKKTPVVEP-ESQATKKI 965
                                 P+ +  SMIPE        A +++   V P E Q T+K 
Sbjct: 913  LLERPVKGDKFMETISSDNEKPEKEIKSMIPE--------AVIEEPKNVSPIEVQKTRKD 964

Query: 966  NXXXXXXXXXXXXXXXL-NEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVS 1024
                               +   + EKKR+VSFFRKFS SS  S  +K   +  +  N++
Sbjct: 965  QEHDKRPVMEKKPEVVAPKQRESDQEKKRSVSFFRKFSGSSISSNKSKAETEKVLVTNIA 1024

Query: 1025 APQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQS 1084
            A Q++ GL RLL GWSKYGLK+V+S S+ M ++GKLS+DNILSLRST FE+ V S G+ S
Sbjct: 1025 ARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESS 1084

Query: 1085 VVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
             V   K SGSSK V RL  EIE +  +EGVL
Sbjct: 1085 SVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
            {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507C
          Length = 1189

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1213 (51%), Positives = 769/1213 (63%), Gaps = 132/1213 (10%)

Query: 7    NKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNE 66
            NK++ PT++GD +GPWKLGETLG GSTGKVQLA NE T Q AA+K ISK+IF+ K     
Sbjct: 5    NKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGN 64

Query: 67   TSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLV 126
            +S+ A+TPD LPYGIEREIIIMKLL H NVL LYDVWETN +LYM+LEYAEKGELFNLLV
Sbjct: 65   SSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLV 124

Query: 127  EKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 186
            E GPLPE EAV FFRQIIIG+SYCHALGIVHRDLKPENLLLDH  NIKIADFGMAALETE
Sbjct: 125  ENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALETE 184

Query: 187  DKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 246
            DKLLETSCGSPHYAAPEIVSGIPYHGF SD+WSCGVI FALLTGRLPFDEEDGNIRNLLL
Sbjct: 185  DKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLL 244

Query: 247  KVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKN 306
            KVQSG+FEMPDDDE+S +AQDL+++ILTVDP  RIK REILKHPLLQKYP++ D+KSI+N
Sbjct: 245  KVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRN 304

Query: 307  LPREDTYLFPLSDNNSV-IDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYR 365
            LPREDTYL PLSD+ S  +D +ILQNLVVLWHGR   +IAAKLK+ GANAEKT+YALL R
Sbjct: 305  LPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLAR 364

Query: 366  FKIEAENLSAKQEQVKRKQSI--IKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFNRLP 423
            FK + E  +A+Q+Q+K++ S+        N    P+K+NR ST++ SSS KRPVS  +L 
Sbjct: 365  FKNDTEREAARQKQIKKRSSLNGTGAGVNNNHVSPKKRNRASTINASSSHKRPVSLIKLS 424

Query: 424  TISNGKTNNIIPNGRNGDSNNTTP--KSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSPTP 481
              SN  +N+   +         +    SNKR                   + GN  SPTP
Sbjct: 425  GSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVK--------------TQGNGGSPTP 470

Query: 482  -SRSKRISLINLD-NSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITTKL 539
             SRSKR+S+I  D N  APP+P+++LKDY               L+F    KRGS+TTKL
Sbjct: 471  ASRSKRVSIIESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKL 530

Query: 540  LSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXXXX 599
            +STYAKLSE+D+WEYIEKETKRTSSDFATLIDEIFEHEK+EQIRKEK EL          
Sbjct: 531  ISTYAKLSEEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKER 590

Query: 600  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYENPRSV 659
                                               + ++ ++D+ +  +        RSV
Sbjct: 591  EERERKEREEKELNEKLENDARQKREMEAQEAQGDDGTDTESDVHSNNQAPNGV---RSV 647

Query: 660  SAPLERENPEA---IERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDID 716
            SAPLER+  ++   ++ DI ++F +R +SLQTRP SRLDPG+ Y   AE  + P   D +
Sbjct: 648  SAPLERKKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFY---AEESNEPEAGDTE 704

Query: 717  QE--IDREKKILETIRRSRFLGSSYNINKEL---EFAKKTALAETSKKEKRSKVTSQNIV 771
            +E  +  +K ILETIRRS+FLGSS++I KEL   E  KK +     +   ++       V
Sbjct: 705  EEKKLRTQKNILETIRRSKFLGSSFDIGKELQNEELKKKASQPHRDRTVSQTNEPYDTRV 764

Query: 772  ADKAAIGVIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGD 831
                A+   PL D E   RKISEI VPQFTRKSR FS+SN+RLSVLSMYSTK SY NL +
Sbjct: 765  LPTQAVATAPLRDQEP--RKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSN 822

Query: 832  IL-----KEGGVNLASEANNTTTSKASTEPEFQFESVNEGT--ANKLYELQEEPE----Y 880
            +L      +G +N A+E ++    K   EPEFQFE+V E +   N +  L    E     
Sbjct: 823  LLNDSDASDGRLNSAAEYSDV---KGKKEPEFQFEAVREASDEDNGISRLSNNDERLRNV 879

Query: 881  TDVNKEDGKPK---------------------------------KNVKLPTLPPLHEKTN 907
            +  +   G P                                  KNVKLPTLPPL + T+
Sbjct: 880  SGTSGGSGVPHDNLSSKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPTLPPL-DGTS 938

Query: 908  QANGLAIYQSSSDDDKKPTEPQPKSQ----SMIPER---QDSINNSASVKKTPV---VEP 957
            +ANGL IYQSSS+  +   EP PKS+    S  PE+   ++      SVK + +    + 
Sbjct: 939  EANGLGIYQSSSESFRDIVEPTPKSKLQDNSSNPEQEVEEEVAGREGSVKHSAIDTASKE 998

Query: 958  ESQATKKINXXXXXXXXXXXXXXXLNEMPP------------------------------ 987
             S+ T +I+                ++ PP                              
Sbjct: 999  RSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKRRNEDPRNGSTAAKGENGRAPLK 1058

Query: 988  ----NVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYG 1043
                N +KKRNVSFFRKFSKS+   T    GFD E+   VSA QL+ GL  LL GW++YG
Sbjct: 1059 DITTNSDKKRNVSFFRKFSKSNEKDT---TGFDGEINTTVSAKQLFLGLQNLLHGWTQYG 1115

Query: 1044 LKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGFNKISGSSKTVRRLFV 1103
            LKDV+S    M LTGKL+++NILSLRST+FEM+V S+GK SVVGF K SGSSK +RRL  
Sbjct: 1116 LKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRGKVSVVGFRKKSGSSKAMRRLVS 1175

Query: 1104 EIEKVLRQEGVLS 1116
            E+EKVL +EGV+S
Sbjct: 1176 EVEKVLLKEGVIS 1188

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/1175 (52%), Positives = 777/1175 (66%), Gaps = 112/1175 (9%)

Query: 4    LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63
            +A N  +I  IK +TIGPWKLGETLGLGSTGKVQLA N++T Q+AA+K+ISK++FN+   
Sbjct: 1    MAVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNV 60

Query: 64   SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
            S  + + +NTPD+LPYGIEREIIIMKLL H NVL LYDVWETN++LY++LEYAEKGELFN
Sbjct: 61   SGTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 124  LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
            LLVE+GPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 184  ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243
            ETE KLLETSCGSPHYAAPEIVSGIPY GF SDVWSCGVILFALLTGRLPFDEEDGNIR 
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRA 240

Query: 244  LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303
            LLLKVQ G+FE+P DDE+SR+AQDLIS+ILTVDP +RIK R+ILKHPLLQKYPSI+DSKS
Sbjct: 241  LLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKS 300

Query: 304  IKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363
            I++LPREDTYL PLS++NS ID +ILQNLV+LWHGRD + I AKL+E GANAEKT+YALL
Sbjct: 301  IRDLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALL 360

Query: 364  YRFKIEAENLSAKQEQVKRKQSI----IKKSTANVSTPPRKKNRISTMSVSSSRKRPVSF 419
            YRFK + +    KQ+Q++++QSI    I       +TP R++NR S +SVSSSRK+P+SF
Sbjct: 361  YRFKCDTQKELIKQQQIRKRQSIGSVSISPPKRTSTTPQRRRNRESIISVSSSRKKPISF 420

Query: 420  NRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSP 479
            N+  T S+  ++N+           TTP S+KR                      N +SP
Sbjct: 421  NKF-TASSASSSNL-----------TTPGSSKRLSKNFSSKKKLSTIV-------NQSSP 461

Query: 480  TP-SRSKRISLINLD-NSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITT 537
            TP SR+KR S+ N+D N     I       +               ++ + + KR S+TT
Sbjct: 462  TPSSRNKRTSIANVDKNQKRASI-------FSTTKKNKRASKSTRRMSLIPSMKRESVTT 514

Query: 538  KLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXX 597
            KL+STYAKL+EDD+WEYIEKETKRTSS+FATLIDEIFE+EKY+QIRKEKEEL        
Sbjct: 515  KLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYDQIRKEKEELERKVKEAK 574

Query: 598  XXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYE 654
                                                 ID +IS+L+ +L N  +  E +E
Sbjct: 575  ALEELERRKRKQEEKERARKLLEKEELKRKQEELKKQIDIDISDLEHELINHRE--EKFE 632

Query: 655  -NPRSVSAPLERE--NPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVS--N 709
             N RS+SAP+E E  N   +E DI+++  RRN SLQTRP SRLDPGI++S+P ET     
Sbjct: 633  GNIRSISAPMENEENNINHLEADIDNILRRRNFSLQTRPVSRLDPGIIFSSPIETEDPVE 692

Query: 710  PLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKT--ALAETSKKEKRSKVTS 767
            P  ++ ++ +  EKKILETIRRS+FLGSS+NI+KEL+ ++     +A   +  +   V+ 
Sbjct: 693  PKKAE-NERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSD 751

Query: 768  QN-----IVADKAAIGVIPLNDTEA----------GLRKISEIKVPQFTRKSRHFSNSNR 812
             N     +V  K A GV  L D  A           LRKIS+I+VPQFTRKSRHFS SN+
Sbjct: 752  SNGKYESLVLPKDAKGVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNK 811

Query: 813  RLSVLSMYSTKQSYTNLGDILKEGGVNLASEANNTT-TSKASTEPEFQFESVNEG---TA 868
            RLSVLSMYSTK+S+TNL DILK G +++  + N    T +++ + EF FE+VNE    T 
Sbjct: 812  RLSVLSMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTG 871

Query: 869  N-----KLYELQE----EPEYTDVNKEDG-------KPKKNVKLPTLPPLHEKTNQANGL 912
            N     +LY++ +    +     +N  D        K  KN+ LPTLPPL+ K       
Sbjct: 872  NSSNDERLYDVGDSCIKDKNTLKLNFADRFNGSTNEKETKNLHLPTLPPLNGKDEAG--- 928

Query: 913  AIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKK------------TPVVEPESQ 960
               +   + +K+    QPK +SMIPE  DS++++   +K             P +    Q
Sbjct: 929  ---KQGEEQEKEDLHEQPKVKSMIPE-SDSLSHAEKEQKEREDQQRGGKDLEPPLNKSVQ 984

Query: 961  ATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVY 1020
             T++ N                 +  PN     N SFFRKFSKSS     T+      +Y
Sbjct: 985  KTREKNNDTQAKNQS-------TDPKPNKNVSGNGSFFRKFSKSSTSEKSTE------LY 1031

Query: 1021 VNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESK 1080
              VSA QL+ GL +LL+GW++YGLK+VKS  N + LTGKLS++N+ SLRST+FE+ +  K
Sbjct: 1032 AKVSAKQLFNGLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQK 1091

Query: 1081 GKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            GK SVV F KISGS KTV++L  E+E VL +EGVL
Sbjct: 1092 GKVSVVEFKKISGSFKTVKKLVKEVENVLNKEGVL 1126

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1185 (51%), Positives = 784/1185 (66%), Gaps = 124/1185 (10%)

Query: 4    LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63
            +A N  ++P IK +TIGPWKLGETLGLGSTGKVQLA N++T Q+AA+K+ISK++FNT   
Sbjct: 1    MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNV 60

Query: 64   SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
            S  + + + TPD+LPYGIEREIIIMKLL H NVL LYDVWETN++LY++LEYAEKGELFN
Sbjct: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFN 120

Query: 124  LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
            LLVE+GPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 184  ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243
            ETE KLLETSCGSPHYAAPEIVSGIPY GF SDVWSCGVILFALLTGRLPFDEEDGNIR 
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 244  LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303
            LLLKVQ G+FE+P DDE+SR+AQDLISRILTVDP +RIKTR+ILKHPLLQKYPSIKDSKS
Sbjct: 241  LLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKS 300

Query: 304  IKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363
            I+ LPREDTYL PLS++NS ID +ILQNLV+LWHGRD + I  KL+E+GANAEKT+YALL
Sbjct: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALL 360

Query: 364  YRFKIEAENLSAKQEQVKRKQSIIKKSTANV----STPPRKKNRISTMSVSSSRKRPVSF 419
            YRFK + +    KQ+Q+K++QSI   S +      +TP R+KNR S +SVSSSRK+P+SF
Sbjct: 361  YRFKCDTQKELVKQQQIKKRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRKKPISF 420

Query: 420  NRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSP 479
            N+  T S+  ++N+           TTP S+KR                      N +SP
Sbjct: 421  NKF-TASSASSSNL-----------TTPGSSKRLSKNFSSKKKLSTIV-------NQSSP 461

Query: 480  TP-SRSKRISLINLD-NSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITT 537
            TP SR+KR S+IN++ N     +       +               ++ + + KR S+TT
Sbjct: 462  TPASRNKRASVINIEKNQKRASV-------FSTAKKNKRTSKSIKRMSLIPSMKRESVTT 514

Query: 538  KLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXX 597
            KL+STYAKL+EDD+WEYIEKETKRTSS+FATLIDEIFE+EKYEQIRKEKEEL        
Sbjct: 515  KLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAK 574

Query: 598  XXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYE 654
                                                 I+ +IS+L+ +L+   K  +P  
Sbjct: 575  AREELERRRRRQEEKERTRKLLEKEELKMKQEELKKQIEMDISDLEQELSRH-KEEKPDG 633

Query: 655  NPRSVSAPLERE--NPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETV--SNP 710
            N RS+SAP+E E  N + +  DI+++  RRN SLQTRP SRLDPGI++S P ETV    P
Sbjct: 634  NIRSISAPMENEEKNIDHLGTDIDNILRRRNFSLQTRPVSRLDPGIVFSNPIETVYPVEP 693

Query: 711  LLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKK---TALAETSKKEKRSKVTS 767
              S+ ++ +  EKKILETIRRS+FLGSS+NI KEL+ +K    + LA         K++ 
Sbjct: 694  KRSE-NERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSVLAP-------EKLSG 745

Query: 768  QNIVAD-----------KAAIGVIPLND----------TEAGLRKISEIKVPQFTRKSRH 806
            + +V+D           K A GV  L D          ++  LRKISE++VPQFTRKSRH
Sbjct: 746  ERVVSDLNGKYESLILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRH 805

Query: 807  FSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLAS-EANNTTTSKASTEPEFQFESVNE 865
            FS SN+RLS+LSMYSTK+S+TNL DILK   +++ + ++    T +++ + EF FE+VNE
Sbjct: 806  FSESNKRLSLLSMYSTKESFTNLVDILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNE 865

Query: 866  G---TAN-----KLYELQEEP---------EYTDVNKEDGKPKK--NVKLPTLPPLHEKT 906
                T N     +LY++ +            + D   E  + K+  N+ LP+LPPL    
Sbjct: 866  EAEYTGNSSNDERLYDVGDSTIKDKTALKLNFADRFNESTEYKETDNLHLPSLPPL---- 921

Query: 907  NQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASV---------------KK 951
              +    + + +S++D   +  QPK +SMIP+  DS +++  V               K+
Sbjct: 922  --SGDDEMRKQNSEED---SLVQPKVKSMIPQ-SDSSSHTEKVEEKEGESQEVQEESEKE 975

Query: 952  TPVVEPE-SQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTL 1010
               +EP  +++ +K+                L E   +     N SFFRKFSKSSA   L
Sbjct: 976  AKDIEPPLNKSVQKLREKNPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSKSSASDKL 1035

Query: 1011 TKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRS 1070
                   E+Y  VSA QL+ GL +LL+GW+++GLK++KS  N + LTGKLS++NI SLRS
Sbjct: 1036 V------ELYAKVSARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRS 1089

Query: 1071 TVFEMIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            T+FE+ +  KG+ SVV F KISGS K V++L  E+E VL +EGVL
Sbjct: 1090 TLFEINIYPKGRMSVVQFKKISGSFKAVKKLVNEVENVLNKEGVL 1134

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1185 (51%), Positives = 770/1185 (64%), Gaps = 118/1185 (9%)

Query: 4    LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63
            +A N  +IP IK +TIGPWKLGETLGLGSTGKVQLA N +T Q+AA+K+ISK++FNT   
Sbjct: 1    MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60

Query: 64   SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
            S  + + + TPD+LPYGIEREIIIMKLL H NVL LYDVWETN++LY++LEYAEKGELFN
Sbjct: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 124  LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
            LLVE+GPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 121  LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 184  ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243
            ETE KLLETSCGSPHYAAPEIVSGIPY GF SDVWSCGVILFALLTGRLPFDEEDGNIR 
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 244  LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303
            LLLKVQ G+FEMP DDE+SR+AQDLI +ILTVDP +RIKTR+ILKHPLLQKYPSI+DSKS
Sbjct: 241  LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300

Query: 304  IKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363
            I+ LPREDTYL PLS++NS ID +ILQNLV+LWHGRD E I  KL+E GANAEKT+YALL
Sbjct: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360

Query: 364  YRFKIEAENLSAKQEQVKRKQ----SIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSF 419
            YRFK + +    KQ+QVK++Q      +  S    +TP R++NR S +SV+SSRK+P+SF
Sbjct: 361  YRFKCDTQKELIKQQQVKKRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPISF 420

Query: 420  NRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSP 479
            N+  T S+  ++N+           TTP S+KR                      N +SP
Sbjct: 421  NKF-TASSASSSNL-----------TTPGSSKRLSKNFSSKKKLSTIV-------NQSSP 461

Query: 480  TP-SRSKRISLINLD-NSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITT 537
            TP SR+KR S+IN++ N     I       +               ++ + + KR S+TT
Sbjct: 462  TPASRNKRASVINVEKNQKRASI-------FSTTKKNKRSSRSIKRMSLIPSMKRESVTT 514

Query: 538  KLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXX 597
            KL+STYAKL+EDD+WEYIEKETKRTSS+FATLIDEIFE+EKYEQIRKEKEEL        
Sbjct: 515  KLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAK 574

Query: 598  XXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYE 654
                                                 I+ +IS+L+ +L+   K  +   
Sbjct: 575  AREELERRRRKQEEKERARKLLEKEDLKRKQEELKKQIEIDISDLEQELSKH-KEEKLDG 633

Query: 655  NPRSVSAPLERE--NPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVS--NP 710
            N RS+SAP+E E  N   +E DI+++  RRN SLQTRP SRLDPGI++S+P E VS   P
Sbjct: 634  NIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEP 693

Query: 711  LLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKK---TALAETSKKEKR----S 763
              ++ ++ +  EKKILETIRRS+FLGSS+NI+KEL+ +K    + +A     E+R    S
Sbjct: 694  KRTE-NERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDS 752

Query: 764  KVTSQNIVADKAAIGVIPLNDTEAG--------LRKISEIKVPQFTRKSRHFSNSNRRLS 815
                ++++  K   GV  L D+ A         LRKISEI+VPQFTRKSRHFS SN+RLS
Sbjct: 753  NDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLS 812

Query: 816  VLSMYSTKQSYTNLGDILKEGGVNLAS-EANNTTTSKASTEPEFQFESVNEG---TAN-- 869
            VLSMYSTK+S+TNL DILK G +++ + ++    T +++ + EF FE+VNE    T N  
Sbjct: 813  VLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSS 872

Query: 870  ---KLYELQE----EPEYTDVNKED-------GKPKKNVKLPTLPPLHEKTNQANGLAIY 915
               +LY++ +    +     +N  D        K   N+ LP LPPL    N  N L   
Sbjct: 873  NDERLYDVGDSTIKDKSALKLNFADRFNGSNEAKQTDNLHLPILPPL----NGDNELRKQ 928

Query: 916  QSSSDDDKKPTEPQPKSQSMIPERQDSINNSASV--------------------KKTPVV 955
             S   D     +  PK +SMIPE   S +                         K+  VV
Sbjct: 929  NSQEGD-----QAHPKIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKVV 983

Query: 956  E----PESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKK-RNVSFFRKFSKSSAVSTL 1010
            +    P +++ +KI                L E   +      N SFFRKFSKSS  +  
Sbjct: 984  DDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFRKFSKSSDKT-- 1041

Query: 1011 TKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRS 1070
                   E+Y  +SA QL+ GL +LL+GW++YGLK++KS  N + LTGKLS+DNI SLRS
Sbjct: 1042 ------MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRS 1095

Query: 1071 TVFEMIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            T+FE+ +  +GK SVV F K+SGS K V++L  E+E VL +EGVL
Sbjct: 1096 TLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1181 (51%), Positives = 769/1181 (65%), Gaps = 117/1181 (9%)

Query: 4    LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63
            +A N  ++P IK +TIGPWKLGETLGLGSTGKVQLA N++T Q+AA+K+ISK++FN   N
Sbjct: 1    MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAG-N 59

Query: 64   SNETSMVAN-TPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELF 122
             + TS+V + TPD+LPYGIEREIIIMKLL H NVL LYDVWETN++LY++LEYAEKGELF
Sbjct: 60   MSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119

Query: 123  NLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 182
            NLLVE+GPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAA
Sbjct: 120  NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 183  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIR 242
            LETE KLLETSCGSPHYAAPEIVSGIPY GF SDVWSCGVILFALLTGRLPFDEEDGNIR
Sbjct: 180  LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 243  NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSK 302
             LLLKVQ GQFE+P DDE+SR+AQDLI +ILTVDP +RIK R+ILKHPLLQKYPSI+DSK
Sbjct: 240  TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSK 299

Query: 303  SIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYAL 362
            SI+ LPREDTYL PLS++NS ID +ILQNLV+LWHGRD + I  KLKE GANAEKT+YAL
Sbjct: 300  SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYAL 359

Query: 363  LYRFKIEAENLSAKQEQVKRKQSIIKKSTAN----VSTPPRKKNRISTMSVSSSRKRPVS 418
            LYRFK + +    +Q+Q+K++QSI   ST++     +TP R+KNR S +SV+SSRK+P+S
Sbjct: 360  LYRFKCDTQKELIRQQQIKKRQSISSVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIS 419

Query: 419  FNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNS 478
            FN+  T S+  ++N+           TTP S+KR                      N  S
Sbjct: 420  FNKF-TASSASSSNL-----------TTPGSSKRLSKNFSSKKRLSTIV-------NQAS 460

Query: 479  PTP-SRSKRISLINLD-NSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSIT 536
            PTP SR+KR S+IN+D N     +       +               L+ + + KR S+T
Sbjct: 461  PTPASRNKRTSIINVDKNQRRASV-------FSTAKRNKKTSRSTKKLSLIPSMKRESVT 513

Query: 537  TKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXX 596
            TKL+STYAKL+ DD+WEYIEKETKRTSS+FATLIDEIFE+EKYE+IRKEK+EL       
Sbjct: 514  TKLMSTYAKLAADDDWEYIEKETKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREA 573

Query: 597  XXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPY 653
                                                  I+ +IS+L+ +L+   K  +P 
Sbjct: 574  KAREELERRKRKQEEKEHSRKVLEKEELKRKQQELKKQIEIDISDLEHELSKH-KEEKPD 632

Query: 654  ENPRSVSAPLERE--NPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVS--N 709
             N RS+SAP+E E  N   +E DI+++  RRN SLQTRP SRLDPGI++S+P E  S   
Sbjct: 633  GNIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVE 692

Query: 710  PLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQN 769
            P  ++ ++ +  EKKILETIRRS+FLGSS+NI KEL+ +K     E        +++ + 
Sbjct: 693  PKRTE-NERLTTEKKILETIRRSKFLGSSFNIEKELKLSK----MEYPSMVPPQRLSEER 747

Query: 770  IVAD-----------KAAIGVIPLND----------TEAGLRKISEIKVPQFTRKSRHFS 808
            IV+D           K A G   L D          +   LRKISE++VPQFTRKSRHFS
Sbjct: 748  IVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFS 807

Query: 809  NSNRRLSVLSMYSTKQSYTNLGDILKEGGVNL-ASEANNTTTSKASTEPEFQFESVNEG- 866
             SN+RLSVLSMYS+K+S+TNL DILK G +++   ++    T K++ + EF FE+VNE  
Sbjct: 808  ESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEA 867

Query: 867  --TAN-----KLYELQE----EPEYTDVNKEDG-------KPKKNVKLPTLPPLHEKTNQ 908
              T N     +LY++ +    +     +N  D        K  +N+ LPTLPPL      
Sbjct: 868  EYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPL------ 921

Query: 909  ANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVV-------EPESQA 961
             NG        D+D      QPK +SMIP+   S +     +K           E +++ 
Sbjct: 922  -NGGDEVNKQKDEDVLGI--QPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKG 978

Query: 962  TKKIN---XXXXXXXXXXXXXXXLNEMPPNVEKKRNV----SFFRKFSKSSAVSTLTKNG 1014
             K I                   +   P   +K RN+    SFFRKFSKSS         
Sbjct: 979  AKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGSFFRKFSKSSTSDK----- 1033

Query: 1015 FDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFE 1074
               E+Y  VSA QL+ GL +LL+GW++YGLK++KS  N + LTGKLS++NI SLRST+FE
Sbjct: 1034 -SVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFE 1092

Query: 1075 MIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            + +  +GK SVV F K+SG+ K V++L  E+E VL +EGVL
Sbjct: 1093 ISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1163 (52%), Positives = 748/1163 (64%), Gaps = 110/1163 (9%)

Query: 7    NKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNE 66
            N   I T+KGDTIGPWKLG TLG+GSTGKV +A+NET  QQAA+KIISKSIFN +     
Sbjct: 2    NGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQ---GS 58

Query: 67   TSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLV 126
            T +  N PD LPYGIEREIIIMKLL H NVL LYDVWET+ +LYM+LEY EKGELFNLLV
Sbjct: 59   TMIGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLV 118

Query: 127  EKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 186
            E+GPLPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN+K+ADFGMAALE++
Sbjct: 119  ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESK 178

Query: 187  DKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 246
            DKLLETSCGSPHYAAPEIVSG+PYHGFESDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLL
Sbjct: 179  DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 238

Query: 247  KVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKN 306
            KVQSG+FEMP DDE+S +AQDLI+RILTVDP +RIKTREILKHPLL+KYPSIKDSKSI+N
Sbjct: 239  KVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRN 298

Query: 307  LPREDTYLFPLS--DNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLY 364
            LPREDTYL PLS    N  +D +ILQNLVVLWHGR+KE I  KL E GAN EKT YALL+
Sbjct: 299  LPREDTYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLH 358

Query: 365  RFKIEAENLSAKQEQVKRKQSIIK-------------KSTANVSTPPRKKNRISTMSVSS 411
            RFK +      KQ+++++KQS+               KS + V+TP  KK R S +  SS
Sbjct: 359  RFKHDNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTP--KKKRTSIIVASS 416

Query: 412  SRKRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGH 471
            S KRPVS  +L    + + ++ + NG  G   + T  SNKR                   
Sbjct: 417  SHKRPVSMQKL----SSQHSSPVKNGSIGKRLSKTFPSNKRISQLV-------------- 458

Query: 472  SNGNSNSPTPSRSKRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGK 531
               NS+SPTP+  KR+S IN  +S APP+P  +L+DY                + L N K
Sbjct: 459  --SNSSSPTPAAHKRVSRIN--DSAAPPVPKEMLRDY-----KRQSKRQSKRFSLLPNMK 509

Query: 532  RGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXX 591
            RGSITTKL++TYAKLSED  WEYIEKETKRTS DFATL+D+IFEHEKYEQIRKEKEEL  
Sbjct: 510  RGSITTKLIATYAKLSEDSEWEYIEKETKRTSQDFATLMDQIFEHEKYEQIRKEKEELER 569

Query: 592  XX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADL--AN 645
                                                      + ++ EI+ LKA+     
Sbjct: 570  KVNEAREKEEAERKERERIEREEQERLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQ 629

Query: 646  ETKGAEPYENPRSVSAPLE-------RENPEAIERDINDLFARRNVSLQTRPKSRLDPGI 698
             +       N RSVSAP+E       R++   I+ DIN+L   RN SLQTRP SRLDPGI
Sbjct: 630  GSSDERNTANGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGI 689

Query: 699  LYSAPAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSK 758
            +    AE+  +  L   D +  +EK ILETIRRS+FLGS +N+N ELE A+K  L    +
Sbjct: 690  I---AAESRLSANLE--DDQASKEKTILETIRRSKFLGSQFNLNVELEKAQKD-LVSKER 743

Query: 759  KEKRSKVTSQNIVAD-----KAAIGVIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRR 813
            +E+  K + Q    +     K A  V  L D E   RK+SE+KVPQFTR+S+HFS+SN+R
Sbjct: 744  QEQLRKYSEQTAKYEVQKLPKNAKAVATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKR 803

Query: 814  LSVLSMYSTKQSYTNLGDILK-EGGVNLASEANNTTTSKASTEPEFQFESVNEGTAN-KL 871
             SVLS+YSTK S+TNL D LK +  +         ++SK + EPEF FE+V E   N KL
Sbjct: 804  FSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVEELDENSKL 863

Query: 872  YELQE----------EPEYTDVNKEDGKPKKNVKLPTLPPLH-----EKTNQANGLAIYQ 916
            +E+ E            E TD  K+     K++ LP+LPPL         N A GL IYQ
Sbjct: 864  FEVPETEEGKLASAARKESTDARKQSTN-DKDINLPSLPPLQVSHDVADENGALGLGIYQ 922

Query: 917  SSSDDDKKPTEPQPKSQSMIPERQD-SINNSASVKKTPVVE--PESQATKKINXXXXXXX 973
             +    K      P    +I E  D +I++++ V +T VV+  P +   +K N       
Sbjct: 923  PNDQTQK------PHKTMLIDESIDENISSTSDVSRTEVVKKPPLNDVVRKNN------- 969

Query: 974  XXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLL 1033
                    L E+ P VE KR +SFFRKFS+ S    L    FD ++   VSAP++YK L 
Sbjct: 970  ---NERKPLEEITPKVENKRKISFFRKFSQGSE-KKLGPESFDSQLKAGVSAPKMYKALD 1025

Query: 1034 RLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEM-IVESKGKQSVVGFNKIS 1092
            RLL  W+ YGLK V+S  N   ++GKL++DNILSLRST F++ ++  +G  S++ F K S
Sbjct: 1026 RLLNEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKS 1085

Query: 1093 GSSKTVRRLFVEIEKVLRQEGVL 1115
            GS+KT  RL  EIEK+L +E VL
Sbjct: 1086 GSTKTFNRLVKEIEKILEKEKVL 1108

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1170 (51%), Positives = 756/1170 (64%), Gaps = 116/1170 (9%)

Query: 9    KAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETS 68
            K  PTIKGD IG WK+GETLGLGSTGKVQLA+N+TT  QAAIK+ISK+IF    +SN TS
Sbjct: 5    KTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQ---DSNVTS 61

Query: 69   MVANT-PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
            MV NT PD+LPYGIEREI+IMKLL HANVL LYDVWETNSNLYM+LEYAEKGELFNLLVE
Sbjct: 62   MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121

Query: 128  KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED 187
            +GPLPE EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALETED
Sbjct: 122  RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181

Query: 188  KLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 247
            KLLETSCGSPHYAAPEIVSGIPYHGF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLK
Sbjct: 182  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241

Query: 248  VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNL 307
            VQ+GQFEMP+DDE+S++AQ+LIS+IL V+P +RI  R+ILKHPLLQKYPSIKDSKSI+NL
Sbjct: 242  VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNL 301

Query: 308  PREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
            PREDTYL PL++ NS ID +ILQNLVVLWHGRD  +I  KLKE GANAEKT+YA+L RFK
Sbjct: 302  PREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361

Query: 368  IEAENLSAKQEQVKRKQS---------------IIKKSTANVSTPPRKKNRISTMSVSSS 412
            ++ E  + K E +K +QS                + +S+ N +T PRKKNR S +SV+SS
Sbjct: 362  LDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSS 421

Query: 413  RKRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHS 472
             KRP+SF +LPT+++  +   I           TP ++ R               + G+ 
Sbjct: 422  HKRPISFQKLPTLNSTSSLAAI-----------TPSTSAR---------RKRLSKISGYP 461

Query: 473  NGNSN-SPTP-SRSKRISLINLDNSTAPPI-PVNVLKDYXXXXXXXXXXXXXXXLTFLGN 529
              N N SPTP SR KR S+ N+  + +  I   N  K                 ++ L N
Sbjct: 462  VSNVNGSPTPASRKKRNSMANIQAARSSTIKKTNTFK---------KNNRASKRVSILPN 512

Query: 530  GKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589
             K G+I +KL+STYAKLSEDD WEY+E+ETKRTSS+FATLIDEIFEHEKYEQIRKEKEEL
Sbjct: 513  NKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEEL 572

Query: 590  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKG 649
                                                      +++EI NLK +L  +   
Sbjct: 573  ARKVREAKEREEAERKQKELQEREKQRERERKENETNDRQRIMEEEIENLKKEL--DMMS 630

Query: 650  AEPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSN 709
             E     RSVS PL ++    +E ++ +L  +RN +LQTRPKSRLDPG+ + +      N
Sbjct: 631  HEGKTESRSVSEPLNKKQG-GVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRN 689

Query: 710  PLL----SDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKV 765
            P L     ++D ++  EK ILETIRRS+FLGSS++I+KEL+ A  +A ++ S+   R   
Sbjct: 690  PSLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSA--SARSDYSRAPGRVIT 747

Query: 766  TSQNI----VADKAAIGVIPL--NDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSM 819
               N+    V  K AI   PL  +  +  +RKIS+IKVPQFTRKSR+FS S++RLSVLSM
Sbjct: 748  APSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSM 807

Query: 820  YSTKQSYTNLGDIL--KEGGVNLASEANNTTTSKASTEPEFQFESVNE--------GTAN 869
            YST+QS+ NL D++  +    + A       T  ++ + EF FESVNE         T  
Sbjct: 808  YSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFESVNEEAENTNNTSTDG 867

Query: 870  KLYELQEEPEYTD-----VNKEDGKPKKNV------KLPTLPPLHEKTNQANGLAIYQSS 918
            KLYE+ E PE +      VN  D   K N       KLP LPPL     +  GL IYQ  
Sbjct: 868  KLYEVSESPESSSKKGLRVNLSDRYNKANSEADMENKLPILPPLDP---EIAGLGIYQDQ 924

Query: 919  SDD-DKKPTEPQPKSQSM----IPERQDSINN--SASVKKTPVVEPESQATKKINXXXXX 971
             ++ + KP E + KS+S     I E +  +++  + +++K P  +P     KK++     
Sbjct: 925  PEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAP--QPPITEKKKLDAKKQR 982

Query: 972  XXXXXXXXXXLNEMPPNVEKKRNVS--FFRKFSKSSAVSTL----TKNGFDYEVYVNVSA 1025
                       N+      K+   S  F RK S  S  +T     TK G +  ++  VSA
Sbjct: 983  -----------NDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSA 1031

Query: 1026 PQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSV 1085
             Q+Y+GL  LL+GW  YGLK +K  S  M +TGKL+++NILSLRST+FE+I+  +GK S 
Sbjct: 1032 TQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSK 1091

Query: 1086 VGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            V   K SGS+K V RL  E++ VL +EGV+
Sbjct: 1092 VDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1229 (50%), Positives = 759/1229 (61%), Gaps = 152/1229 (12%)

Query: 11   IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70
            + T+K D IGPWKLG  LG GS GKV +A +ETT QQAA+KI+SKSIF     +N +++V
Sbjct: 15   LTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIV 74

Query: 71   -ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKG 129
             +N PD LPYGIEREIIIMKLL H NVL LYDVWET SNLYM+LEY EKGELFNLLVE+G
Sbjct: 75   GSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERG 134

Query: 130  PLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKL 189
            PLPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE++DKL
Sbjct: 135  PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKL 194

Query: 190  LETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ 249
            LETSCGSPHYAAPEIVSG+PYHGFESDVWSCGVIL+ALLTGRLPFDE++GNIR+LLLKVQ
Sbjct: 195  LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQ 254

Query: 250  SGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPR 309
            SG++EMP +DE+S +AQDLI++ILTVDP +RIKTREILKHPLLQKYPSIKDSKSI+NLPR
Sbjct: 255  SGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPR 314

Query: 310  EDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIE 369
            EDTYL PL   +  ID  ILQNLVVLWHGRD+ +I AKL E GAN EKT Y LL+RFK +
Sbjct: 315  EDTYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHD 374

Query: 370  AE-------------------------NLSAKQEQVKRKQSIIKKSTAN---------VS 395
                                         S +   V  K+  +KKS +           +
Sbjct: 375  VHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSLSGT 434

Query: 396  TPPRKKNRISTMSVSSSRKRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXX 455
            T P+KKNR+S +SVSSS KRPVSFN+L T   GK+          DS   TP S+ +   
Sbjct: 435  TTPKKKNRVSMISVSSSHKRPVSFNKLSTA--GKS----------DSACGTPGSSTKRMS 482

Query: 456  XXXXXXXXXXXXVQGHSNGNSNSPTPSRSKRISLINLDNSTAPPIPVNVLKDYXXX---- 511
                            + G + SPTP+ +KR+S+ ++D S+APP+P++VL DY       
Sbjct: 483  ISLSSSKRLS------AMGPNTSPTPA-NKRMSVRDMD-SSAPPVPMDVLNDYTSALPNR 534

Query: 512  XXXXXXXXXXXXLTFLGNGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLID 571
                        L+FL N KRGSITTKL++TYAKLSE+D+WEYIEKETKRTS+DFATL D
Sbjct: 535  KATKRASRASKRLSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCD 594

Query: 572  EIFEHEKYEQIRKEKEELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNH 631
            +IFEHEKYEQIRKEK+EL                                          
Sbjct: 595  QIFEHEKYEQIRKEKQELERKVREAKEREERERRKRQEEQEEQERKRRAEEERVLRELED 654

Query: 632  IDQ---------EISNLKADLANETKGAEPYENP----RSVSAPL---------ERENPE 669
              Q         E++ L+AD        EP E      R VSAP+         +R++  
Sbjct: 655  AKQQELQELMAKEVAMLRADYGEPQ--TEPEEQGASKNRCVSAPIASSSAKDDGKRDSIA 712

Query: 670  AIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEIDR-EKKILET 728
             +  DI+DL  RR VSLQTRP SRLDPGI+ +    +V       +D+   R EK ILET
Sbjct: 713  RLSGDIDDLLKRRTVSLQTRPVSRLDPGIVAAENLGSVIYEEADGVDETTLRTEKTILET 772

Query: 729  IRRSRFLGSSYNINKELEFA---KKTALAETSKKEKRSKVTSQNIVAD--------KAAI 777
            IRRSRFLGSS++I KELE A   K+ ALA   ++   S  T+ +   D        K A 
Sbjct: 773  IRRSRFLGSSFDIKKELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPKNAA 832

Query: 778  GVIPLNDTE-AGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEG 836
             V  LND      RKISEIKVPQFTR+SRHF+ SN+RLSVLSMYSTK S+TNL D LK G
Sbjct: 833  AVDTLNDERNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLK-G 891

Query: 837  GVNLASEANNT-TTSKASTEPEFQFESVNE--------GTAN-KLYELQEEPE------- 879
            G +L   + +  +T+K + EPEF FESV+E         TA+ +LYE+ +  E       
Sbjct: 892  GADLQEVSGSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTK 951

Query: 880  ------YTD-VNKEDGKPKKNVKLPTLPPLHEK-TNQANGLAIYQSSS--DDDKKPTE-- 927
                  + D  N   G    +VKLP LPPL +  + + NGL IYQS      D  PT   
Sbjct: 952  AAMRLNFADRFNTRAGDNPADVKLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSMV 1011

Query: 928  PQPKSQSMIPERQDSINNSASVKKTPVVEPE---SQATKKINXXXXXXXXXXXXXXX--- 981
             +PK  SMIP   D I   A  K T   E E   + ATKK                    
Sbjct: 1012 HEPKVFSMIP---DDIAGPA--KSTKPAESENVPTSATKKSEPKNALHSADAPEASQPPL 1066

Query: 982  ------------LNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLY 1029
                        L ++ P  EKKRN SFFRKFS+SS       + FD ++  +V A Q++
Sbjct: 1067 NGMMRKNNDRKPLEDITPAAEKKRNRSFFRKFSRSSEEK--KSDNFDAKLNTSVEAVQMF 1124

Query: 1030 KGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIV-ESKGKQSVVGF 1088
              L +LL GW  YGLK+V+ Q     +TGKLS+DNILSLRST+FE++V +   K SVV F
Sbjct: 1125 NALGKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWF 1184

Query: 1089 NKISGSSKTVRRLFVEIEKVLRQEGVLSA 1117
             K SGS+KT +RL  E+EKVL +E VL++
Sbjct: 1185 VKKSGSTKTFKRLVKEVEKVLERENVLTS 1213

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/1181 (52%), Positives = 762/1181 (64%), Gaps = 105/1181 (8%)

Query: 8    KKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNET 67
            K  + T+KGD IGPWKLG TLG GSTGKV +A +E+T QQAA+KI+SKSIF  + NS+ T
Sbjct: 12   KSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSS-T 70

Query: 68   SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
             + +N PD LPYGIEREIIIMKLL H NVL LYDVWETNS+LYM+LEY EKGELFNLLV+
Sbjct: 71   IVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVD 130

Query: 128  KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED 187
            +GPLPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE++D
Sbjct: 131  RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKD 190

Query: 188  KLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 247
            KLLETSCGSPHYAAPEIVSG+PYHGFESDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLK
Sbjct: 191  KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK 250

Query: 248  VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNL 307
            VQSG+FEMPD +E+S +AQDLI++ILTVDP  RIK+R ILKHPLLQKYPSIKDSKSI+NL
Sbjct: 251  VQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNL 310

Query: 308  PREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
            PREDTYL PL   +  ID +I+ NLVVLWHGRD+ +I  KLKE GAN EKT YALL+RFK
Sbjct: 311  PREDTYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFK 370

Query: 368  IEAENLSAKQE------QVKRKQSIIKKSTANV---STPPRKKNRISTMSVSSSRKRPVS 418
             +++    KQ+      QV  K++ ++KS +     ST P+KK R   +S SSS KRPVS
Sbjct: 371  HDSQQEQLKQQRRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKRPVS 430

Query: 419  FNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNS 478
            F+RL   +   T++  PN  +G  ++    SNKR               +    N NS S
Sbjct: 431  FSRLSYSNGSNTDHNTPNS-SGKRSSVNLSSNKR---------------ISALINPNS-S 473

Query: 479  PTPSRSKRISLINLDNSTAPPIPVNVLKDYXXXX--XXXXXXXXXXXLTFLGNGKRGSIT 536
            PTP+ SKR SL  LD S APPIPV++LKDY                 L+FL   KRGSIT
Sbjct: 474  PTPA-SKRASLRELDPS-APPIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSIT 531

Query: 537  TKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXX 596
            TKL++TYAK+SED++WEYIEKETKRTS+DFATL DEIFEHEKYEQIR+EKEEL       
Sbjct: 532  TKLIATYAKISEDNDWEYIEKETKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREA 591

Query: 597  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNH--------IDQEISNLKADLANETK 648
                                              H        ID+E++ LK      + 
Sbjct: 592  KEQEERERRQREEEERRQREEELARQREFEEERYHRQREVQENIDREMALLKEGYETSS- 650

Query: 649  GAEPYENPRSVSAPLE-------RENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYS 701
            G +P +N RSVSAP+E       R + +A++ DI DL  RR  SL+TRPKSRLDPGI   
Sbjct: 651  GVDPNKN-RSVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIYT- 708

Query: 702  APAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKEL--EFAKKTALAETSKK 759
               E V N  + D  +++  EK ILETIRRS+FLGSS++INKEL  E   K   A   K+
Sbjct: 709  --LEEVPNSDIKDGGRDLKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQ 766

Query: 760  EKRSKVTSQNIVADKAAIGVIPL------------NDTEAGLRKISEIKVPQFTRKSRHF 807
             K+      N   + +  G  P             ND  +  RKISE++VPQFTR+SRHF
Sbjct: 767  RKKEDRVVSNATGNYSENGYEPQTLPKNAAATKISNDAGSDPRKISEVQVPQFTRRSRHF 826

Query: 808  SNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLAS-EANNTTTSKASTEPEFQFESVN-E 865
            + SN+RLSVLSMYSTK S+TNL D L+ G  +L S   +  +TS+   E EF FESV+ E
Sbjct: 827  TASNKRLSVLSMYSTKASFTNLADHLR-GKTDLQSINGSPPSTSRMEPETEFMFESVDGE 885

Query: 866  G--TAN-----KLYELQE--EPE----------YTD-VNKEDGKPKKNV------KLPTL 899
            G  TA+     +LYE+ E  +P+          + D  NK    P ++V      KLP+L
Sbjct: 886  GKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKLPSL 945

Query: 900  PPLHE-KTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIP----ERQDSINNSASVKKTPV 954
            PPL + K++  NGL +YQ +SD  +     QPK  SMIP    +++ +       K+ P 
Sbjct: 946  PPLDKAKSDGVNGLGLYQPASDSSETEIHHQPK--SMIPVDAEQKEAAEAKPEEQKQVPP 1003

Query: 955  VEPESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNG 1014
             + ES A   +N                N+  PN  KK N SFFR+FS  S         
Sbjct: 1004 KDVES-APAPLNKVMKKNTEAEKNQP--NQPAPNAVKKNNKSFFRRFSGKSD-DEKRPGE 1059

Query: 1015 FDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFE 1074
            +D++    +   Q++  L +LL  W  YGLKDV +  +  K+ GK+S+DN+LSLRST+FE
Sbjct: 1060 YDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFE 1119

Query: 1075 MIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            + + SKG+ S+VGF K SGS+KT ++L  EIEK+L  +  L
Sbjct: 1120 ISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKAL 1160

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1184 (51%), Positives = 757/1184 (63%), Gaps = 139/1184 (11%)

Query: 13   TIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFN------------- 59
            T+ G+ IGPWKLGETLG GSTGKVQLA NE TNQQAAIKIISKS+F+             
Sbjct: 10   TVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSAL 69

Query: 60   TKPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKG 119
               + N  S V +  ++LPYGIEREIIIMKLL H NVL LYDVWETN+NLYM+LEYAEKG
Sbjct: 70   AASDVNNGS-VQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKG 128

Query: 120  ELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFG 179
            ELFNLLVEKGPL E EAVRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFG
Sbjct: 129  ELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFG 188

Query: 180  MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG 239
            MAALETEDKLLETSCGSPHYAAPEIVSG+PY+G E+D+WSCGVILFALLTGRLPFDEEDG
Sbjct: 189  MAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEEDG 248

Query: 240  NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIK 299
            NIRNLLLKVQ G+FEMP  DE+S +AQDLI +ILTV+P +RIKTREILKHPLLQKYP+IK
Sbjct: 249  NIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNIK 308

Query: 300  DSKSIKNLPREDTYLFPLSDNNSV---IDPSILQNLVVLWHGRDKEQIAAKLKESGANAE 356
            DSK+I++LPREDTYL PL+DNN V   ID SILQNL VLWHG+DK +I  KLKE GANAE
Sbjct: 309  DSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANAE 368

Query: 357  KTIYALLYRFKIEAENLSAKQEQVKRKQSIIKKSTANV----STPPRKKNRISTMSVSSS 412
            KT+Y LL+RFK + E  + K  Q++++QS++K S+++     + P R+KNR S +SV+SS
Sbjct: 369  KTLYVLLHRFKEDTERENHKNSQLRKRQSLMKASSSSSSNQGNVPRRRKNRNSMISVTSS 428

Query: 413  RKRPVSFNRLPTISNGKTNNII--PNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQG 470
             K+PVS+N++  +  G + ++I  P+     S+NTTP S+KR                  
Sbjct: 429  HKKPVSYNKIAMVG-GSSKDVISLPS-----SSNTTPASSKRISLSLSSSNKRNSRL--- 479

Query: 471  HSNGNSNSPTPS-RSKRISLINLDN--STAPPIPVNVLKDYXX-XXXXXXXXXXXXXLTF 526
            ++  NS+SPTP+ RS+R S  NL N  S APPIPV+VLKDY                 +F
Sbjct: 480  YTQSNSSSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSRLSKRYSF 539

Query: 527  LGNGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEK 586
            L N KRGS+TTK++STYAKL+EDD+WE+IEKETKR SSDFATLIDEIFEHEK+E+IRKEK
Sbjct: 540  LLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKFEKIRKEK 599

Query: 587  EELXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKA 641
            EEL                                             N ID+E   LK 
Sbjct: 600  EELERKVIEAKQKEERERKEAEAAAKEEARVRREKELARMNKEEEQLQNDIDEEARLLKD 659

Query: 642  D--LANETKGAEPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGIL 699
            +    N+     P  N RSVS P        ++    D   +RN SLQTRP SRLDPG++
Sbjct: 660  EFNFVNDETQENPI-NSRSVSEP--------VKNGGTDEKGQRNFSLQTRPISRLDPGLM 710

Query: 700  YSAPAETVSNPLLSDIDQEI--DREKKILETIRRSRFLGSSYNINKE------------- 744
            +S   +  +N   S +D+ +  + +K ILETIRRS+FLGSS++INKE             
Sbjct: 711  FSKLGDVDNN---SSVDENLTMNNQKTILETIRRSKFLGSSFDINKELNNANEERKRLRQ 767

Query: 745  LEFAKKTALAETSKKEKRSKVTSQNIVADKAAIGVIPLNDTEAGL--RKISEIKVPQFTR 802
            L+  K+  L E  +    S V+++N V  K AIGV+ L D  + +  RKISE++VPQFTR
Sbjct: 768  LQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEPRKISEVQVPQFTR 827

Query: 803  KSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTEPEFQFES 862
            KS++FS SN+RLSVLS YS+KQSYTNL D++KE         N       + +P F FE 
Sbjct: 828  KSKYFSESNKRLSVLSFYSSKQSYTNLVDMIKE---------NPVEDEDVTEDPGFNFE- 877

Query: 863  VNEGTANKLYELQEEP---------EYTDVNKEDGKPKKNVKL----------------- 896
              +   + L E  E P         E  D  +E+ K   ++KL                 
Sbjct: 878  --DSQYDYLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSVSMKLNFADRFSNVNSNTKQES 935

Query: 897  ---PTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTP 953
                  P +  K+    GL +Y   S ++K  TEP+P  +SMIPE +D +N+S      P
Sbjct: 936  SFEDKFPNILSKSG-TEGLGLY---SKNEK--TEPKP-VKSMIPE-EDKVNSS------P 981

Query: 954  VVE-PESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNV-SFFRKFSKSSAVSTLT 1011
            VVE P ++   K                  ++ P   +K  N  SF RK S  S+ ST+ 
Sbjct: 982  VVEAPLNKVVNKTRAENKST----------SKGPSGSQKVSNTSSFLRKISGKSSNSTVA 1031

Query: 1012 KNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRST 1071
            K  F+  +Y +V+  QL+ GL  LL+GW+ YGLKDVK       + GKLSNDNILSLRST
Sbjct: 1032 KGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRST 1091

Query: 1072 VFEMIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            + E+ V ++ K SV+G  K SGSSKT+RRL  EIEKVL +EGVL
Sbjct: 1092 IVELCVFTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVL 1135

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa] {ON}
            similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507c GIN4
          Length = 1103

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1167 (49%), Positives = 730/1167 (62%), Gaps = 118/1167 (10%)

Query: 1    MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNT 60
            M+ ++ N   +  IK + IGPWKLGETLG GSTGKV LA NETT QQAA+K+ISK++F  
Sbjct: 1    MSAISSN--TVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58

Query: 61   KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120
              NS       N   +LPY IE+EIIIMKLL H NVL L+DVWETNS+LY++LEYAEKGE
Sbjct: 59   MNNSESNGDATN---ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115

Query: 121  LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180
            LFN+LVE+GPLPE EAVR FRQIIIGISYCH+LG+VHRDLKPENLLLD+K NIKIADFGM
Sbjct: 116  LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGM 175

Query: 181  AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240
            AALE+EDKLLETSCGSPHYAAPEI+SG+PY GF SDVWSCGVILFALLTGRLPFDEEDGN
Sbjct: 176  AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235

Query: 241  IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300
            IRNLLLKVQ G+FEMPDDDE++++AQDL++R+LTVDP+KRI  REILKHPLLQKYPSIKD
Sbjct: 236  IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKD 295

Query: 301  SKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY 360
            S+SI+NLPREDTYL PL+D NS ID +ILQNLV+LWHG+D  +IAAKL+E GAN EKT+Y
Sbjct: 296  SRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLY 355

Query: 361  ALLYRFKIEAE---NLSAKQEQVKRKQSIIKKSTANVSTP------PRKKNRISTMSVSS 411
            ALLYRFK + +   N + +Q ++ ++ S I +STA  S        P+KKN+ +++ ++S
Sbjct: 356  ALLYRFKCDTQREANRARRQSKIVQRNSTI-RSTAPESPSKKKTYTPQKKNKRASI-IAS 413

Query: 412  SRKRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGH 471
            S KRPVS  +  T       NI  N     S   TPKS KR                   
Sbjct: 414  SSKRPVSVTKTAT-------NITVNS----SITGTPKSAKRMSMNNSARKRMSALY---- 458

Query: 472  SNGNSNSPT-PSRSKRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNG 530
              G  +SPT  SRS+R S+I  D     P    +   +               ++ + N 
Sbjct: 459  --GTRDSPTKTSRSRRSSIITKDFLGNRPRDSVISMSH-----NKRASKSSKRISLVPNL 511

Query: 531  KRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELX 590
            KR S+TTKL++TYAKLSEDD+WEYIE+ETKRTSSDFATLIDEIFE+EKYEQIRKEK EL 
Sbjct: 512  KRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAELE 571

Query: 591  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKGA 650
                                                     +D+EISNLK +L  +    
Sbjct: 572  RKVRETKEREERERKERQEKELQERLERERIEKQKEDIARQMDEEISNLKKELVGDQDNE 631

Query: 651  EPYENPRSVSAPLERENP--EAIERDINDLFARRNVSLQTRPKSRLDPGILY-SAPAETV 707
            + +   RSVS PLE ++   E IE DI+ +   R  SLQTRP SRLDPGI +   P ++ 
Sbjct: 632  DKF---RSVSEPLESKSKKIEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSE 688

Query: 708  SN-PLLSDIDQEIDR-EKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKV 765
             + P   +++ E++  E+KILETIRRS+FLGSS++I KELE              KR + 
Sbjct: 689  QHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKELENV------------KRHRQ 736

Query: 766  TSQNI---VADKAAIGVIPLN------DTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSV 816
            TSQ I   +A  A    +P          +  LRKIS+IKVPQFTRKSRHFS SNRRLSV
Sbjct: 737  TSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSV 796

Query: 817  LSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTEPEFQFESVNEGTA-------N 869
            LSMYSTK+SY+NL DILK  G           T K++ + +  F++++E           
Sbjct: 797  LSMYSTKESYSNLADILK-NGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREE 855

Query: 870  KLYELQEEPEYTDVNKE---------DGKPKKNV-------KLPTLPPLHEKTNQANGLA 913
            +LYE+ EE E    NK+         +G   K+V       KLP LPPL E         
Sbjct: 856  RLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFE--------- 906

Query: 914  IYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVE-----PESQATKKINXX 968
                    D    E + +S+SMIPE   S  +   ++K    E     P     + ++  
Sbjct: 907  --------DGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDK 958

Query: 969  XXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQL 1028
                          +E   + +KKRN+SF R   K S  S+ +K+  D  +  +VS+ QL
Sbjct: 959  GVTKEKPTVTMKTTSEQ-VSADKKRNMSFLR---KLSKGSSSSKDNVDVTLSTSVSSKQL 1014

Query: 1029 YKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGF 1088
            + GL+ LL+GW+KYGLK +   S    +TGKL+NDNILS RST F +++ S+ K S V F
Sbjct: 1015 FSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTF 1074

Query: 1089 NKISGSSKTVRRLFVEIEKVLRQEGVL 1115
             K+SGS K VRRL  E++KVL +EGVL
Sbjct: 1075 RKVSGSGKAVRRLSDEVKKVLSKEGVL 1101

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR507C
            (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1196 (48%), Positives = 733/1196 (61%), Gaps = 156/1196 (13%)

Query: 11   IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70
            + +++GD IGPWKLGETLG GSTGKV LA N  T Q AA+K+ISKS+FN +     T + 
Sbjct: 8    VTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQ---GSTFVG 64

Query: 71   ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130
            +N PD LPYGIEREIIIMKLL H NVL LYDVWET  +LYM+LEY EKGELFNLLV++GP
Sbjct: 65   SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124

Query: 131  LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 190
            LPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALE++DKLL
Sbjct: 125  LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 184

Query: 191  ETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250
            ETSCGSPHYAAPEIVSG+PYHGFESDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQS
Sbjct: 185  ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244

Query: 251  GQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
            G++E+P +DE+S +A+DLI +ILTV+P +RIKTREILKHPLLQKYPSIKDSKSI+NLPRE
Sbjct: 245  GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304

Query: 311  DTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370
            DTYL PL  N+  ID +ILQNLVVLWHGRDK +I  KLKE GAN EKT YALL+RFK E 
Sbjct: 305  DTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364

Query: 371  ENLSAKQEQVKRK---------QSIIK----KSTANVSTPPRKKNRISTMSVSSSRKRPV 417
            E    KQ+Q+ ++         Q+I+K    +S  N+ + P+KK R S ++VSS+ KRPV
Sbjct: 365  EQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKK-RSSAINVSSAHKRPV 423

Query: 418  SFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSN 477
            S  +L        N+       G  N T+P S KR                       SN
Sbjct: 424  SIQKL--------NDC------GTLNPTSP-SKKRSLSNRKLSAVL----------AGSN 458

Query: 478  SPTPSRSKRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITT 537
            S +PSR KR+S+       APP+P  VL+DY               L+FL + KRGSITT
Sbjct: 459  SSSPSR-KRMSV----GQDAPPVPTAVLRDY-----NKRASRASKRLSFLPS-KRGSITT 507

Query: 538  KLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXX 597
            K+++TYAKLSED++WEYI++E KRTSSDFATLID IFEHEKYEQIR+EKEEL        
Sbjct: 508  KIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKYEQIRREKEELERKVREAK 567

Query: 598  XXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXXXXNHIDQEISNLKADLANETK-- 648
                                                     ++++++ LKA++A   +  
Sbjct: 568  EREERERRARAEAERRKREEEERRRRREVEELIRQRELQKSLEEQVARLKAEVAATKQEK 627

Query: 649  --GAEPYENPRSVSAPLERENPEAIERD--------INDLFARRNVSLQTRPKSRLDPGI 698
                   ++ RS+S P+ER+     +RD        IN L  RR +SL+TRP SRLDPGI
Sbjct: 628  RISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGI 687

Query: 699  LYSAPAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAET-- 756
              S     + + L  + D+ +  EK ILETIRRS+FLGS Y+I+KEL+  ++  L +   
Sbjct: 688  RLSEENTILEDDLECNEDR-LRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNM 746

Query: 757  -------------SKKEKR----------SKVTSQNIVADK--AAIGVIPLNDTEAGLRK 791
                         S++E+R          S   S++I+  K   AIGV  L D E+  RK
Sbjct: 747  RKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGV--LKDEESEPRK 804

Query: 792  ISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLAS-EANNTTTS 850
            +SE+K+PQFTR+S+HFS S++RLSVLSMYSTK SYTNL D L    V L S + +  T+ 
Sbjct: 805  LSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLN-NDVQLKSLQPSAPTSI 863

Query: 851  KASTEPEFQFESVNEGTANKL--------------------YELQEEPEYTDVNKEDGKP 890
            K   EPEF FES   G  N+                     +E  E  E  +++  + + 
Sbjct: 864  KIPQEPEFMFESA--GQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRS 921

Query: 891  KK-------NVKLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEP--QPKSQSMIPERQD 941
            K+        VKLP LPPL +  N+ NGL IYQ+ +     P EP  QP  +SMIP    
Sbjct: 922  KQYSEEDIAKVKLPILPPL-DHLNKPNGLGIYQAPA----PPKEPLGQPVMKSMIP---- 972

Query: 942  SINNSASVKKTP-VVEPESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRK 1000
               +   +K  P  + P  +AT++                     PPN +KK +      
Sbjct: 973  ---DDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIAAETFPPPNTKKKPSFFKKFS 1029

Query: 1001 FSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKL 1060
              K         +  D ++   V   ++++ L +LL GW+ YGLK+V+S      +TGKL
Sbjct: 1030 REK-------MHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKL 1082

Query: 1061 SNDNILSLRSTVFEMIVESKGKQ-SVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
            S+DNILSLRST FE+++ S     S V F K SGS KT  RL  EIEK+L +E VL
Sbjct: 1083 SSDNILSLRSTAFEIVILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVL 1138

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1142 (43%), Positives = 659/1142 (57%), Gaps = 187/1142 (16%)

Query: 18   TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
            TIGPWKLGETLG+GS GKV+LA +E T  + A+KIISKSIFNT+ N        N    L
Sbjct: 17   TIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGN------YGNHGSVL 70

Query: 78   PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
            PY IEREI+IMKLL H NVL LYDVWETN+NLY+ILEYAEKGELFNLLV++G LPE+EA+
Sbjct: 71   PYNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAM 130

Query: 138  RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            + FRQIII +SYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL+T+  LLETSCGSP
Sbjct: 131  KCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSP 190

Query: 198  HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            HYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEE+GNIR LLLKVQ GQFEMPD
Sbjct: 191  HYAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPD 250

Query: 258  DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFPL 317
            D E+S+DAQDLIS+IL VDP +RIK R+IL HPLL++Y +IKDSKSIK+LPREDTYL+PL
Sbjct: 251  DTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPL 310

Query: 318  SDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQ 377
            +D  + ID SILQNLVVLWHGR  ++I AKLK SG N EKT+YALLYRFK+E+   S K+
Sbjct: 311  ADAGAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKR 370

Query: 378  EQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFNRLPTISNGKTN-NIIPN 436
             + K K++               KNR    S SSS  +  +    P     KT+ N   +
Sbjct: 371  RRHKTKKT---------------KNR--KFSTSSSLVKGRNLESTPRKRTSKTHSNNFSS 413

Query: 437  GRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSPTPSR-SKRISLINLDNS 495
            G+   S   +P                         N  ++SP P R SK ISL N  + 
Sbjct: 414  GKKRSSFILSP-------------------------NSINSSPIPLRNSKGISLRNATSG 448

Query: 496  TAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSITTKLLSTYAKLSEDDNWEYI 555
             +P +PV +L  +                +++ N K GS+T++LLS Y KL ++D+WE I
Sbjct: 449  GSPVVPVILLNSFKRNSKLSSKRS-----SYMPNLKSGSVTSRLLSNYNKLIDEDDWECI 503

Query: 556  EKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXXXXXXXXXXXXXXXXXXXX 615
            EK+TKRTSS+FATLIDEIFE E++E  ++EK EL                          
Sbjct: 504  EKDTKRTSSNFATLIDEIFEPEEFELAKREKVELQRKVR--------------------- 542

Query: 616  XXXXXXXXXXXXXXNHIDQEISNLKADLANETKGAEPYENPRS-VSAPL---ERENPEAI 671
                               ++S+   D +  T G +  +   + VS+PL   E    E +
Sbjct: 543  -----------------GSKMSDNIGDRSEFTDGMKELKRINAKVSSPLINYEFSQQELL 585

Query: 672  ERDINDLFARR-NVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEI----DREKKIL 726
            + DI+ L   R  +S  TRP S+LDPG++ +A     + P   DI ++     D E KI+
Sbjct: 586  Q-DIDTLLTNRYQLSAYTRPISKLDPGLMPAAG----TTP--HDIKEQTALIRDTEVKII 638

Query: 727  ETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNI-VADKAAIGVIPL-ND 784
            ETI RS+FLGS  N+                 +E  SK   +   + + + I   PL  D
Sbjct: 639  ETIHRSKFLGSLLNV-----------------REGMSKDDDELAPIEESSIISTTPLIYD 681

Query: 785  TEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASE- 843
                +RKIS+++VP FTRKSRHF+ ++ R SVLS+YS++ S+ +L  I K    +  S+ 
Sbjct: 682  DRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSRDSFKDLSQISKNEYSDSPSQR 741

Query: 844  -ANNTTTSK--------ASTEPEFQFESVNEGTA-----NKLYELQEEPEYTDVNKE--- 886
              ++T++SK        AS       +S N+  +     N LY++   PE  D+ +E   
Sbjct: 742  SVDDTSSSKKVGHTESLASVAEHIDDDSYNDHNSGMNSDNVLYDV---PEGVDLPQEVKN 798

Query: 887  ------------DGKPKKNVKLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQS 934
                          +P   V+LP+L     K   A+GL IYQ        PT     S +
Sbjct: 799  SDEQSSCSLVSSSLEPTPVVELPSLSSFQGK--NASGLGIYQREPSKVSLPTATIDTSDA 856

Query: 935  MIPERQDSINNSASVKKTPVVEPESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKKRN 994
             +  R+  +             P+    +  N                 E P  ++K  N
Sbjct: 857  -VENRETEVKKELKHDSIATNLPDDNVKENNNATA--------------EAPSRIKKSSN 901

Query: 995  VSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYM 1054
            VS  +  SK   +        + E++  +   +L++GL +LL+GW +YGLK +   +  M
Sbjct: 902  VSILKNISKGKIL--------ELEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAAKM 953

Query: 1055 KLTGKLSNDNILSLRSTVFEMIVESKG-KQSVVGFNKISGSSKTVRRLFVEIEKVLRQEG 1113
             + GKL ND+ILSLRST+FE+IV   G  +S++ FNK +GSSK + +L  EI+ +L++EG
Sbjct: 954  IIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQKEG 1013

Query: 1114 VL 1115
            VL
Sbjct: 1014 VL 1015

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/593 (62%), Positives = 440/593 (74%), Gaps = 53/593 (8%)

Query: 11  IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70
           + ++KG  IGPW LGETLG+GSTGKV +A N  T Q AA+KIISKSIFN +     T + 
Sbjct: 9   VTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQ---GSTFVG 65

Query: 71  ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130
           +N PD LPYGIEREI IMKLL H NVL LYDVWET+++LYM+LEY EKGELFNLL+E+GP
Sbjct: 66  SNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGP 125

Query: 131 LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 190
           LPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALE++DKLL
Sbjct: 126 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 185

Query: 191 ETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250
           ETSCGSPHYAAPEIVSG+PYHGFESDVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKVQS
Sbjct: 186 ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQS 245

Query: 251 GQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           G+FEMPD DE+S +AQDLI++ILTVDP+ RIKTREILKHPLL+KYPSIKDSKSI+NLPRE
Sbjct: 246 GEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRE 305

Query: 311 DTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370
           DTYL PL  N+  +D +IL+NLVVLWHGRD+ +I  KL E G N EKT YALL+RFK E 
Sbjct: 306 DTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYEN 365

Query: 371 ENLSAKQEQVKRK---------QSIIKKSTAN-----VSTPPRKKNRISTMSVSSSRKRP 416
           E    KQ+Q+ ++         ++I+K S+       + TP  KK R S ++VSS+ KRP
Sbjct: 366 EQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTP--KKKRSSGINVSSAHKRP 423

Query: 417 VSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNS 476
           VS  +   I  G    I P+ +   SN                         +  +  N+
Sbjct: 424 VSIQKWGEIGGGNNGLISPSKKRSLSNR------------------------KLSAILNT 459

Query: 477 NSPTPSRSKRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNGKRGSIT 536
            S +PSR KR+S+       APP+P +VL+DY                +FL + KR SIT
Sbjct: 460 PSSSPSR-KRMSIAQ----DAPPMPTSVLRDY-----NKRASRNSKRFSFLPSIKRQSIT 509

Query: 537 TKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589
           +K+++TYAKLSED++WEYI+KE KRTSSDFATLID IFEHEKYEQIR+EKE L
Sbjct: 510 SKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562

 Score =  235 bits (600), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 190/543 (34%), Positives = 278/543 (51%), Gaps = 92/543 (16%)

Query: 632  IDQEISNLKADLANETKGAEPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTRPK 691
            ++Q+++++  +       +EP++   S S   +R++  A++  IN +  +R VS+QTRP 
Sbjct: 651  VEQQLNSMSKNQVARRSVSEPHKRHSSTS---KRDSLLALQYSINTVLNKRAVSVQTRPI 707

Query: 692  SRLDPGILYSAPAETVSNPLLSDIDQEI------DREKKILETIRRSRFLGSSYNINKEL 745
            SRLDPGI+    A+ V++ L  D D+EI       REK ILETIRRS FLGS ++I+KEL
Sbjct: 708  SRLDPGIM----AQEVAHELDYD-DEEILSERTLRREKTILETIRRSNFLGSQFDIHKEL 762

Query: 746  EFAKKTALAETSKKEK-------RSKVTSQNIVADKAAIG----------------VIPL 782
            + AKK  + +  K+++       R     Q  V+D   I                 V  L
Sbjct: 763  KNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVGVL 822

Query: 783  NDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLAS 842
             D E+  +K+SE+++P+ TR+SRH S S++R SVLSMYST  SYTNL D +K   V L  
Sbjct: 823  RDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMK-SDVQLKP 881

Query: 843  EANNTTTSKASTEPEFQFESVNEGT--------------------------ANKLYELQE 876
              N+T +SK + +PEF FES  +                            A++ Y+  E
Sbjct: 882  -LNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNYADRFYKPVE 940

Query: 877  EPEYTDVNKEDGKPKKN---VKLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEP-QPKS 932
              E  D +      +++   VKLP LPPL +     NGL IYQ SS     P E  +   
Sbjct: 941  VIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSS-----PREDFKHAV 995

Query: 933  QSMIPERQDSINNSASVKKTPVVEPESQATKKINXXXXXXXXXXXXXXXLNEMPPNVEKK 992
            +S+ P   ++  N      T    P +   K++                L ++      K
Sbjct: 996  RSVTP--NENKENEDPAGTTQQKAPLTSVGKELGIREP-----------LTDLAQQGVPK 1042

Query: 993  RNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSN 1052
            +  SFFRKFSK        K  +DY++   V+  ++++ L +LL GW+ YGLK V+S  +
Sbjct: 1043 KRPSFFRKFSKEK-----IKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPS 1097

Query: 1053 YMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQE 1112
               +TGKLS+DNILSLRST F+++V      S V F K SGS KT  RL  EIEK+L +E
Sbjct: 1098 VSMITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFARLVNEIEKILEKE 1157

Query: 1113 GVL 1115
             VL
Sbjct: 1158 KVL 1160

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/526 (65%), Positives = 411/526 (78%), Gaps = 43/526 (8%)

Query: 14  IKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANT 73
           +KG+T+GPWKLGETLGLGSTGKVQLA+N +T QQAAIK+ISK++FN   N+N +     T
Sbjct: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNND-NANASDSALLT 70

Query: 74  PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPE 133
           PDSLPYGIEREIIIMKLL H NVL LYDVWET+SNLYM+LEYAEKGELFNLLVE+GPLPE
Sbjct: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130

Query: 134 KEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETS 193
            EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALETEDKLLETS
Sbjct: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190

Query: 194 CGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 253
           CGSPHYAAPEI+SG+PYHG E+DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSGQF
Sbjct: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTY 313
           EMP +DE+SR+AQDLIS+ILTVDP KRIKTREILKHPL+QKYPSIKDSK+I+NLPREDTY
Sbjct: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310

Query: 314 LFPLSDNN---SVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370
           L PLSD+N     IDP ILQNLVVLWHGRD ++I  KLKE GANAEKT+YALL RFK + 
Sbjct: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370

Query: 371 ENLSAKQEQVKRKQSIIKKSTAN----------------VSTPPRKKNRISTMSVSSSRK 414
           E    +Q Q+K++QS ++++ ++                V+TP ++KNR S +SVSS+ K
Sbjct: 371 EKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430

Query: 415 RPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXV------ 468
           RPVSFNRL       +N++I  G NG     TP+ + +               +      
Sbjct: 431 RPVSFNRLSRAD--LSNHVINTGING-----TPQRHSQIESSGTLQRNSSSKRMSINLSS 483

Query: 469 -----QGHSNGNSNSPTPSR-SKRISLINLDNSTAPPIPVNVLKDY 508
                Q  +N  + SPTPS  +KR+S+IN      PP+P++++K+Y
Sbjct: 484 NKRISQLLANDLNTSPTPSNCTKRMSIIN----GTPPVPMDIMKNY 525

 Score =  253 bits (646), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 220/636 (34%), Positives = 303/636 (47%), Gaps = 183/636 (28%)

Query: 656  PRSVSAPLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSA-PAETVSNPLLSD 714
            PRSVSAPLE+   E       D   +RN SL+TRP SRLDPG++YS+    +  NP  S 
Sbjct: 761  PRSVSAPLEKT--EKSRDSPFDYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHST 818

Query: 715  ID-------QEIDREKKILETIRRSRFLGSSYNINKELEFAK-------KTALAETSKKE 760
             D         ID +K ILETIRRS+FLGSS+++ KELE  +       K    + S  E
Sbjct: 819  EDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAFQDSHLE 878

Query: 761  KRSKVT---SQN--------IVA---DKAAIGVIP-----------LNDTEAGLRKISEI 795
            + + VT   SQ+        IV+   D+    ++P           LND+    R +SEI
Sbjct: 879  EMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEI 938

Query: 796  KVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTE 855
            KVPQFTRKS+ FS SN+RLSVLS+YS+++S+TNL D+LKE G+N+     + TT   S E
Sbjct: 939  KVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTT--KSQE 996

Query: 856  PEFQFES----------------VNEG------TANKLY--------------------- 872
            PEF FES                +NE        +N L                      
Sbjct: 997  PEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKN 1056

Query: 873  ----ELQEEPEYTDVNKED-GKPKKN-----VKLPTLPPLHEKTNQANGLAIYQSS---- 918
                 +++EP+  D N  D   PK       VKLP LPPL   T + +GL IYQ S    
Sbjct: 1057 SPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL--TTKKTDGLGIYQKSKQRT 1114

Query: 919  SDDDKKPTEPQ--------------PKSQSMI-------PERQDSINNSASV---KKTPV 954
            S +   P  P               P + +MI        E ++ +NNS+ +   K + +
Sbjct: 1115 SSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREKVNNSSKLIPPKNSEI 1174

Query: 955  VEPESQATKKINXXXXXXXXXXXXXXXLNEMPP------NVEKKRNV------------- 995
            +  ++++  +I                    PP      +V  KRN              
Sbjct: 1175 ISQQNESV-QIRDDYKTKPERSNKADQSERAPPAETTLNDVMTKRNQSKSRDNPQPSEEG 1233

Query: 996  -----SFFRKFSKSS------------------------------AVSTLTKNGFDYEVY 1020
                 SFFRKFSK S                              A    T N +D+++ 
Sbjct: 1234 KKGVNSFFRKFSKGSSRQSSNSSNKNKSLADDKNIPSVPKPVAHPASPVSTSNDYDFQLK 1293

Query: 1021 VNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEM-IVES 1079
             NV+APQ++KGL  L +GWSKYGLK++KS    ++ TGK+S++NILS +STVFE+ I+ +
Sbjct: 1294 ANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEIISN 1353

Query: 1080 KGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
              K  ++ F K SGSSK+VRRL  E+E VLR+EGVL
Sbjct: 1354 SVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389

 Score =  109 bits (272), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/61 (81%), Positives = 58/61 (95%)

Query: 529 NGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEE 588
           N +RGSITTKL+STYA+L+EDD+WE+IEKETKR SS+FATLID IFEHEKYEQIRKEK+E
Sbjct: 619 NMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKDE 678

Query: 589 L 589
           L
Sbjct: 679 L 679

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
            Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/991 (44%), Positives = 575/991 (58%), Gaps = 123/991 (12%)

Query: 208  IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQD 267
            +PYHGFESDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD DE+S +AQD
Sbjct: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 268  LISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLSDNNSVIDPS 327
            LI++ILTVDP  RIK+REILKHPLLQKYPSIKDSKSI+NLPREDTYL PL   N  ID S
Sbjct: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 328  ILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQEQVKR----- 382
            I+ NLVVLWHGRD+ +I A+LKE GAN EKT YALL+RFK ++     KQ++  +     
Sbjct: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189

Query: 383  ------KQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFNRLPTISNGKTNNIIPN 436
                  + S+ ++S  NV+  P+KKN+   +S SSS KRPVSFNRL + +NG      P 
Sbjct: 190  PKRSNMRNSVSRRSITNVT--PKKKNKAPVISASSSHKRPVSFNRL-SFNNGSNTAHTPP 246

Query: 437  GRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSPTPSRSKRISLINLDNST 496
                   +    SNKR               +    N N NSPTP   KR S+ +LD ++
Sbjct: 247  TSASKRASVNLSSNKR---------------ISALINPN-NSPTPVH-KRSSMRDLD-AS 288

Query: 497  APPIPVNVLKDYXXXX--XXXXXXXXXXXLTFLGNGKRGSITTKLLSTYAKLSEDDNWEY 554
            APPIP+++LKDY                 L+FL   KRGSITTKL++TYAK+S+D++WEY
Sbjct: 289  APPIPMDMLKDYNKSAPKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEY 348

Query: 555  IEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELXXXXXXXXXXXXXXXXXXXXXXXXX 614
            IEKET+RTS+DFATL DEIFEHEKYEQIRKEKEEL                         
Sbjct: 349  IEKETRRTSADFATLCDEIFEHEKYEQIRKEKEELERRVREAKEQEELERRQREEEERLQ 408

Query: 615  XXXXXXXXXXXXXXXNH--------IDQEISNLKADLANETKGAEPYENPRSVSAPLE-- 664
                                     I+QEI+ LK  +    +G     + RSVSAP E  
Sbjct: 409  REMELQHQMRLEEESRRRQRETQELIEQEIALLKQSV--NPQGPSDSNHVRSVSAPAESV 466

Query: 665  -----RENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEI 719
                 R +   ++ DI  L  RR  SL+TRPKSRLDPGI  S   +  S    +D+    
Sbjct: 467  LKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGADLST-- 524

Query: 720  DREKKILETIRRSRFLGSSYNINKELEFAK-----KTALAETSKKEK-RSKVTSQNIVAD 773
              EK ILETIRRS+FLGSS++INKEL   +     + ALA+   +E+  S  T+ N+V +
Sbjct: 525  --EKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEERVASNATTANVVGN 582

Query: 774  KAAIGVIPLNDTEAGL------RKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYT 827
                  +P     + +      RKISE++VPQFTR+SRHF+ SN+RLSVLSMYSTK S+T
Sbjct: 583  GYESQTLPKRKMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFT 642

Query: 828  NLGDILK-EGGVNLASEANNTTTSKASTEPEFQFESVN-EG--TAN-----KLYELQEEP 878
            NL D LK +  V L  + +  + SK   E EF FESV+ EG  TA+     +LYE+ E  
Sbjct: 643  NLADHLKGKADVQLI-QTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETK 701

Query: 879  E-----------YTD-VNKEDGKPKKN------VKLPTLPPLHE-KTNQANGLAIYQSSS 919
            +           + D  N+    P ++      +KLP LPPL + K N  +GL +YQ+++
Sbjct: 702  DAKNAKPAVKLNFADRFNRPTSPPSQDTDSSAAIKLPALPPLDKNKPNMVSGLGLYQATA 761

Query: 920  DDDKKPTEPQPKS--------------QSMIPERQDSINNSASVKKTPVVEPESQATKKI 965
            +   +  +P  KS              ++ + E +++  NS  V   PV  P +   KK 
Sbjct: 762  EPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVA-PLNNVMKK- 819

Query: 966  NXXXXXXXXXXXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNG-FDYEVYVNVS 1024
                            L+++ P VEKK N SFFRKF  SS  S   K+G +D+     + 
Sbjct: 820  --------NTDADRKPLSDITPAVEKKANKSFFRKF--SSKGSDEKKSGDYDFRFKTVIE 869

Query: 1025 APQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQS 1084
              Q++  L +LL  W  YGLKDV +  +  ++ GKLS+DNILSLRST+F + V  +G+ S
Sbjct: 870  ETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGS 929

Query: 1085 VVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115
             V F K SGS+KT ++L  EIEK+L  +  L
Sbjct: 930  YVEFTKKSGSNKTFKKLVKEIEKILESKKAL 960

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/591 (56%), Positives = 408/591 (69%), Gaps = 83/591 (14%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           IGPWKLGETLG GSTGKVQLA +E T Q+ A+K+I KSIF ++ +        N    LP
Sbjct: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH------GNNDSVLP 71

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
           + IEREI+IMKLL H NVLSLYDVWET++NLY+ILEYAEKGELFNLLV++GPLPE+EA++
Sbjct: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F+QIII ISYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL+T+  +LETSCGSPH
Sbjct: 132 CFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPH 191

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           YAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP++
Sbjct: 192 YAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNN 251

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLS 318
            E+S DAQDLI RIL VDPT+RIK R+IL HPLL+KY +IKDSKSIK+LPRE+TYL+PL+
Sbjct: 252 AEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLA 311

Query: 319 DNNS----VIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLS 374
           D ++     ID SILQNLV+LWHGR  E+I  KL+++G N EKT+YALLYRFK+E     
Sbjct: 312 DADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLE----- 366

Query: 375 AKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSFNRLPTISNGKTNNII 434
           + +E  KR +S I K+        +K  R+ST+S SSS     +FN              
Sbjct: 367 SMKETNKRSRSKINKT--------KKSKRVSTLSSSSSS----AFNH------------- 401

Query: 435 PNGRNGDSNNTTPKSNKRXXXXXXXXXXXXXXXVQGHSNGNSNSPTPSRSKRISLINLDN 494
                  S ++ P+ +                  +GHS        PS  KR S I   N
Sbjct: 402 ------QSLDSAPRKHAS----------------RGHSKN-----FPSSRKRSSFILSSN 434

Query: 495 ST-APPIPV--------------NVLK-DYXXXXXXXXXXXXXXXLTFLGNGKRGSITTK 538
           ST   PIP+              N L+                  L+++ N  RGS+TT 
Sbjct: 435 STDCSPIPLRSSKRISISSAVPGNTLQVPDSSLKLKRNSKRSSKRLSYMPNLGRGSLTTN 494

Query: 539 LLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589
           LLS Y  L +DD+WEYI+K+TKRTSS+FATLIDEIFE EK+E  ++EK EL
Sbjct: 495 LLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEIFEPEKFELAKREKAEL 545

 Score =  168 bits (425), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 160/503 (31%), Positives = 242/503 (48%), Gaps = 104/503 (20%)

Query: 659  VSAPL---ERENPEAIERDINDLFARR-NVSLQTRPKSRLDPGILYSAPAETVSNPLLSD 714
            VS+PL   E    E ++ DI+ L   R  +S  TRP SRLDPG+           P+   
Sbjct: 586  VSSPLMNYEFSQKELLQ-DIDTLLTNRYQLSSYTRPISRLDPGL----------TPVTGA 634

Query: 715  IDQEI--------DREKKILETIRRSRFLGSSYNINKEL-EFAKKTALAETSKKEKRSKV 765
            I   I        D E KI+ETIR+S FLGS  N+ + + +   + A  E S K      
Sbjct: 635  IPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLNVREGISQDNNQLASIEVSPK------ 688

Query: 766  TSQNIVADKAAIGVIPL--NDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTK 823
                       I   PL  ND +  +RKIS+++VP FTRKS+HF+ +N R SVLS+YS K
Sbjct: 689  -----------ISTTPLMYND-QVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLK 736

Query: 824  QSYTNLGDILK--------EGGVNLASEANNTTTSKASTEPEFQFESVNEGTANK----- 870
            +S  +L  I K        +G  + AS++      +  TE +      ++   +      
Sbjct: 737  ESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEQKNSQHDQDDSNDSNGMNNN 796

Query: 871  --LYELQE---EPEYTDVN---------KEDGKPKKNVKLPTLPPLHEKTNQANGLAIYQ 916
              LY++ E    P+  D+N          +  +PK  VKLP+L     K   A+GL IYQ
Sbjct: 797  NILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRK--NASGLGIYQ 854

Query: 917  SSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQATKKINXXXXXXXXXX 976
              S  +  P+               +IN S S K T     E++A K+I           
Sbjct: 855  RESSRESLPSV--------------TINISESDKTT-----ENEAQKEIKHDKSDTILSN 895

Query: 977  X---XXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLL 1033
                      ++   V +  + SF +K SK   +        + +V   +S  +LY+GL 
Sbjct: 896  HDGKADSYKGDISNIVRESSHGSFLKKLSKGKIL--------ELDVRAKISEKRLYEGLH 947

Query: 1034 RLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGK-QSVVGFNKIS 1092
            +LL+GW +YGLK++   +  M ++GKL ND ILSLRST+FE+++   G  +S++ FNK +
Sbjct: 948  KLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKT 1007

Query: 1093 GSSKTVRRLFVEIEKVLRQEGVL 1115
            GS+KT+ +   EI+ +L++EGVL
Sbjct: 1008 GSTKTLTKFATEIQIILQKEGVL 1030

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  411 bits (1056), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/393 (52%), Positives = 269/393 (68%), Gaps = 50/393 (12%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-------SIFNTKPNSNETSM 69
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K       S   T PNS  +SM
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 70  V--------------ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEY 115
           V              +N   + PYGIEREI+IMKL+ H NV++L++VWE  S LY++LEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 116 AEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIK 174
            + GELF+ LV KG LPE+EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 175 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPF 234
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +  D NI+ LLLKVQSG+++MP +  +S +A+DLIS+IL +DP KRI T+EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 295 YPSIKDSKSIKNLPRED--------------------TYLFPLSDNNSVIDPSILQNLVV 334
           Y  +  +K ++ + R++                      L+  SD    ID SIL++L +
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSD----IDESILRSLQI 427

Query: 335 LWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           LWHG  +E I AKL +   + EK  Y+LL ++K
Sbjct: 428 LWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  408 bits (1048), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/353 (57%), Positives = 256/353 (72%), Gaps = 16/353 (4%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76
           DT+GPWKLG+TLG GS+G+V+LA N  T + AAIKI+ K   N + N+ + +       S
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKR--NVRHNNTQLT-------S 109

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           LPYGIEREIIIMKL+ H NV++LY+VWE    LY++LEY E GELF+ L+ +G LPE+EA
Sbjct: 110 LPYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEA 169

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKIADFGMAALETEDKLLETSCG 195
           V +F+QI+ G+SYCH   I HRDLKPENLLLD K  ++KIADFGMAALET DKLLETSCG
Sbjct: 170 VHYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCG 229

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQSG+++M
Sbjct: 230 SPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQM 287

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRED-TYL 314
           P +  +S +A+DLI++IL VDP  RI   E+L+HPLL KY   + SKS  NL   D T  
Sbjct: 288 PQN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPN 344

Query: 315 FPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
             + ++   ID SIL NL +LWHG  KE +  KL + G   EK  Y+LL R++
Sbjct: 345 IVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  407 bits (1045), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/353 (57%), Positives = 255/353 (72%), Gaps = 10/353 (2%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76
           DT+GPWKLG+TLG GS+G+V+LA N  T + AAIKI+ K +  +  N+++ S  AN   +
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRST-NASKKSNAAN--GN 112

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           LPYGIEREIIIMKL+ H N+++LY+VWE  S L+++LEY E GELF+ LV KG LPE+EA
Sbjct: 113 LPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEA 172

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKIADFGMAALETEDKLLETSCG 195
           V +FRQII G++YCH   I HRDLKPENLL+D K   IKIADFGMAALET +KLLETSCG
Sbjct: 173 VHYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCG 232

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQSG++ M
Sbjct: 233 SPHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHM 290

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD-SKSIKNLPREDTYL 314
           P +  +S +AQDLIS+IL VDP  RI   E+L+HPL+ KY   +  S S  +L      L
Sbjct: 291 PQN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQL 348

Query: 315 FPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
             L      ID SIL NL +LWHG   E I A+L + G   EK  Y+LL++++
Sbjct: 349 VTLQSKED-IDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  408 bits (1048), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/390 (53%), Positives = 271/390 (69%), Gaps = 44/390 (11%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-------SIFNTKPNSNETSM 69
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K       S   T PNS  +SM
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSM 135

Query: 70  V--------------ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEY 115
           V              +N   + PYGIEREI+IMKL+ H NV++L++VWE  S LY++LEY
Sbjct: 136 VTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 116 AEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIK 174
            + GELF+ LV KG LPE+EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 175 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPF 234
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +  D NI+ LLLKVQSG+++MP +  +S +A+DLIS+IL +DP KRI T+EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 295 YPSIKDSKSIKNLPREDTYLFPLSDN-----NSV------------IDPSILQNLVVLWH 337
           Y  +  +K ++ + R+D      S++     N+V            ID SIL++L +LWH
Sbjct: 372 YDDLPVNKVLRKM-RKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWH 430

Query: 338 GRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           G  +E I AKL +   + EK  Y+LL ++K
Sbjct: 431 GVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  406 bits (1043), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 285/419 (68%), Gaps = 45/419 (10%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-------SIFNTKPNSNETSM 69
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K       S   T PNS  +SM
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 70  V--------------ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEY 115
           +              +N   + PYGIEREI+IMKL+ HANV++L++VWE  S LY++LEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 116 AEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIK 174
            + GELF+ LV KG LPE+EA+ +F+QI+ G+S+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 175 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPF 234
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +  D NI+ LLLKVQSG+++MP +  +S +A+DLIS+IL ++P KRI T+EIL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 295 YPSIKDSKSIKNLPRE---------DTYLFPLSDNNSV-------IDPSILQNLVVLWHG 338
           Y ++  +K I+ + R+         D +L      + V       ID SIL++L +LWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 339 RDKEQIAAKLKESGANAEKTIYALLYRFKIEAE---NLSAKQEQVKRKQSIIKKSTANV 394
             +E I AKL +   + EK  Y+LL ++K       +LS ++++V ++ S+ +  T N 
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSLSNEKKKVPKESSMDESKTGNT 490

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  403 bits (1036), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/393 (52%), Positives = 265/393 (67%), Gaps = 47/393 (11%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK--------------------- 55
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K                     
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 56  -----SIFNTKPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLY 110
                ++ NT  N+  T+  +N   + PYGIEREI+IMKL+ HANVL LY+VWE  S LY
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATN-PYGIEREIVIMKLISHANVLGLYEVWENKSELY 192

Query: 111 MILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK 170
           ++LEY + GELF+ LV +G L E+EAV +F+QII G+SYCHA  I HRDLKPENLLLD K
Sbjct: 193 LVLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKK 252

Query: 171 -FNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLT 229
              IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLT
Sbjct: 253 NSTIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLT 312

Query: 230 GRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
           G LPF+  D +I+ LLLKVQSG+++MP +  +S++AQDLI++ILTV+P KR+ T EIL+H
Sbjct: 313 GHLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRH 368

Query: 290 PLLQKYPSIKDSKSIKNLPRE--------DTYLFPLSDNNSV-------IDPSILQNLVV 334
           PL+ KY S+  +K  K L +         D +L    +  ++       ID +IL NL +
Sbjct: 369 PLIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQI 428

Query: 335 LWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           LWHG  +E I AKL +   + EK  Y+LL ++K
Sbjct: 429 LWHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  404 bits (1038), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/392 (52%), Positives = 271/392 (69%), Gaps = 48/392 (12%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-------SIFNTKPNSNETSM 69
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K       S   T PNS  +SM
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 70  V--------------ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEY 115
           V              +N   + PYGIEREI+IMKL+ HANV++L++VWE  S LY++LEY
Sbjct: 136 VTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 116 AEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIK 174
            + GELF+ LV +G LPE+EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 175 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPF 234
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +  D NI+ LLLKVQSG+++MP +  +S +A++LIS+IL +DP KRI T+EIL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 295 YPSIKDSKSIKNLPRE---------DTYLFPLSDNNSV----------IDPSILQNLVVL 335
           Y ++  +K ++ +  +         D +L    DN S           ID SIL++L +L
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLHLL---DNVSPSIVTLNTKNEIDESILRSLQIL 428

Query: 336 WHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           WHG  +E I AKL +   + EK  Y+LL R+K
Sbjct: 429 WHGVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  402 bits (1033), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/383 (55%), Positives = 266/383 (69%), Gaps = 38/383 (9%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-------------SIFNTKPN 63
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K             S F+   N
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 64  SNET-SMVANTP---------DSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMIL 113
           SN   S +A +P            PYGIEREI+IMKL+ H NV++LY+VWE  S LY++L
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVL 215

Query: 114 EYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-N 172
           EY + GELF+ LV KG L EKEAV +F+QII G+SYCH+  I HRDLKPENLLLD K  +
Sbjct: 216 EYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS 275

Query: 173 IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRL 232
           IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG L
Sbjct: 276 IKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHL 335

Query: 233 PFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
           PF+  D NI+ LLLKVQ+G+F MP    +S +AQDLISRIL +DP+KRI T  IL HPL+
Sbjct: 336 PFN--DDNIKKLLLKVQAGKFRMP--STLSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

Query: 293 QKY-PSIKDSKSIKNLPREDTYLF------PLS-DNNSVIDPSILQNLVVLWHGRDKEQI 344
            KY P+ K+  S K+    D ++       P+S  + + ID SIL+NL +LWHG  +E I
Sbjct: 392 LKYEPAGKNMVSGKS--NSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTSRELI 449

Query: 345 AAKLKESGANAEKTIYALLYRFK 367
            AKL ++  + EK  Y+LL+++K
Sbjct: 450 IAKLLQTPMSEEKLFYSLLWQYK 472

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  400 bits (1028), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/355 (56%), Positives = 256/355 (72%), Gaps = 19/355 (5%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76
           DT+GPWKLG+TLG GS+G+V+LA N  + + AAIKI+ K   N + N  + +       +
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKR--NVRHNQKQVT-------A 106

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           LPYGIEREIIIMKL+ H N+++LY+VWE  S LY++LEY E GELF+ L+ +G LPE+EA
Sbjct: 107 LPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEA 166

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIKIADFGMAALETEDKLLETSCG 195
           + +F+QI+ G+SYCH   I HRDLKPENLLLD K   +KIADFGMAALET ++LLETSCG
Sbjct: 167 IHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCG 226

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D N+R LLLKVQ G+++M
Sbjct: 227 SPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQM 284

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLF 315
           P +  +S++A+DLIS+IL VDP KRI   +IL+HPLL KY +    K     P E     
Sbjct: 285 PSN--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDN--PGKGGLACPLEKPEER 340

Query: 316 P-LSDNNSV--IDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           P + D +S+  ID +IL NL +LWHG  KE +  KL +SG   EK  YALL R++
Sbjct: 341 PKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  394 bits (1013), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 249/355 (70%), Gaps = 23/355 (6%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76
           DTIGPWKLG+TLG GS+G+V+LA N  T + AA+KI+ K+              ++ P++
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT-------------KSSRPNA 99

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           LPYGIEREIIIMKL+ H NV+ LY+VWE    L+++LEY + GELF+ LV +G L EKEA
Sbjct: 100 LPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEA 159

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKIADFGMAALETEDKLLETSCG 195
           + +FRQII G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCG
Sbjct: 160 IHYFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCG 219

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SPHYA+PEIV G  Y+G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ+G+++M
Sbjct: 220 SPHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQM 277

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS---IKNLPREDT 312
           P    +S +AQDLISRIL VDP KRI   +IL HPL+ KY   K SKS   +  L     
Sbjct: 278 P--QAISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKSNSDLHILSHTSP 334

Query: 313 YLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
            +  +     V DP+ILQNL +LWHG  K+ I  +L E     EKT Y+LL  ++
Sbjct: 335 QICTIRSERDV-DPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  395 bits (1016), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/424 (53%), Positives = 279/424 (65%), Gaps = 55/424 (12%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76
           DTIGPWKLG+TLG GS+G+V+LA N  T + AAIKI+ K+       S+ T        S
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKT------KSSRTG-------S 99

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           LPYGIEREIIIMKL+ H NV+ LY+VWE    L+++LEY + GELF+ LV +G LPEKEA
Sbjct: 100 LPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEA 159

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKIADFGMAALETEDKLLETSCG 195
           + +FRQII G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCG
Sbjct: 160 IHYFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCG 219

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SPHYA+PEIV G  Y+G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ+G+++M
Sbjct: 220 SPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQM 277

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNL-------P 308
           P    +S  AQDLISRIL VDP KRI   EIL HPLL KY + K SKS  +L       P
Sbjct: 278 P--QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKSNSDLHILSHSKP 334

Query: 309 REDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKI 368
           +  T       + S +DP+ILQNL +LWHG  KE I   L +     EKT Y+LL     
Sbjct: 335 QISTI-----KSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLL----- 384

Query: 369 EAENLSAKQEQVKRKQ--------SIIKKS-----TANVSTPPRKKNRISTMSV--SSSR 413
               L+ +Q Q K+K+         I++KS     +    + PRK++  S+  V  S+S+
Sbjct: 385 ----LAYQQRQSKQKEKPPPINAPKILQKSQFSVSSIKSQSSPRKEHVASSSRVFKSTSK 440

Query: 414 KRPV 417
           KR V
Sbjct: 441 KRLV 444

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  395 bits (1015), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 244/354 (68%), Gaps = 19/354 (5%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76
           DT+GPWKLG+TLG GS+G+V+LA N  T + +AIKI+ K               +N    
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVK-----------SNQIKQ 116

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           LPYGIEREIIIMKL+ H NV+ LY+VWE  S LY++LEY E GELF+ LV KG LPE EA
Sbjct: 117 LPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEA 176

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLD-HKFNIKIADFGMAALETEDKLLETSCG 195
           + +F+QI+  ++YCH   I HRDLKPENLLLD  K +IKIADFGMAALET DKLLETSCG
Sbjct: 177 IHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCG 236

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQSG+++M
Sbjct: 237 SPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQM 294

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIK--NLPREDTY 313
           P    +S +A+DLISRIL VDP +RI   +IL+H LL KY     SKS    NL      
Sbjct: 295 P--QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPN 352

Query: 314 LFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           +   S     ID +IL NL +LWHG  ++ +  +L + G   EK  Y+LL+ ++
Sbjct: 353 IVSFSSERD-IDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQ 405

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  395 bits (1015), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/380 (54%), Positives = 261/380 (68%), Gaps = 37/380 (9%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIF------NTKPNSNETSMV 70
           DT+GPWKLG+TLG GS+G+V+LA N    Q AAIKI+ K+        N   N N T++ 
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 71  AN-----TPDSL----PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGEL 121
            N     T D      PYGIEREI+IMKL+ H NV+ L++VWE  ++L+++LEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 122 FNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGM 180
           F+ LV KG LPE EAV +F+QII G+++CH+  I HRDLKPENLLLD K   IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 181 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240
           AALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300
           IR LLLKVQSG+F +P +  +S +AQDLI++IL V+P +RIK  +ILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 301 SK-------SIKNLPREDTYLFPLSDNN------SVIDPSILQNLVVLWHGRDKEQIAAK 347
            K       S  NL  E      L+ NN      + ID SIL+NL +LWHG  +E I AK
Sbjct: 379 VKFNQVPNPSATNLNSEHM----LTPNNLKLASRADIDESILRNLQILWHGTSREIIIAK 434

Query: 348 LKESGANAEKTIYALLYRFK 367
           L +   +AEK  Y+LL+++K
Sbjct: 435 LLQYPMSAEKIFYSLLWQYK 454

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  397 bits (1021), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/390 (53%), Positives = 252/390 (64%), Gaps = 52/390 (13%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTK--------------- 61
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K+  + K               
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 62  ----PNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAE 117
                +SNET+     P +  YGIEREI+IMKL+ H NV+ LY+VWE  S LY++LEY +
Sbjct: 128 KPYTTHSNETN-----PSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVD 182

Query: 118 KGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKIA 176
            GELF+ LV +G LPE+EAV +F+QII G++YCHA  I HRDLKPENLLLD K   IKIA
Sbjct: 183 GGELFDYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIA 242

Query: 177 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDE 236
           DFGMAALE  DKLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+ 
Sbjct: 243 DFGMAALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNH 302

Query: 237 EDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYP 296
           +  NI+ LLLKVQSG + MP D  +S DA+DLIS+IL VDP KR+ T EIL H L+ KY 
Sbjct: 303 D--NIKKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYD 358

Query: 297 -------------SIKDSKS------IKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWH 337
                        S+   KS      I NL   D  L     N   ID SIL NL +LWH
Sbjct: 359 RMGLTNRNYNNNLSMARDKSNSNLNFINNLSNVDILL----QNPCDIDTSILSNLQILWH 414

Query: 338 GRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           G  K  I  KL +   N EK  Y+LL ++K
Sbjct: 415 GESKHAIIDKLLQPNMNEEKLFYSLLLKYK 444

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  392 bits (1008), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/383 (53%), Positives = 263/383 (68%), Gaps = 39/383 (10%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVA----- 71
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K+    K N N   M +     
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 72  ------NTPDSL----PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGEL 121
                 N  D+     PYGIEREI+IMKL+ H NV+ LY+VWE  S L+++LEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 122 FNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGM 180
           F+ LV +G L E+EAV +F+QII G+SYCH+  I HRDLKPENLLLD K N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 181 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240
           AALE  +KLL TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300
           I+ LLLKVQSG+F+MP +  +S +A+DLISRIL VDP KRI+  +IL HPL++KY   +D
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKY---ED 379

Query: 301 SKSIKN-------LPREDTYLFPLSD---------NNSVIDPSILQNLVVLWHGRDKEQI 344
           +K+  N         + ++ L  L+D           + ID SIL+NL +LWHG  +E I
Sbjct: 380 NKTDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELI 439

Query: 345 AAKLKESGANAEKTIYALLYRFK 367
            +KL ++  + EK  Y+LL ++K
Sbjct: 440 ISKLLQTPMSEEKLFYSLLLQYK 462

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  391 bits (1005), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/403 (50%), Positives = 258/403 (64%), Gaps = 61/403 (15%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKP-------------- 62
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K      P              
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 63  --------------------NSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDV 102
                               N+  + + AN     PYGIEREI+IMKL+ H+N+L LY+V
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPAN-----PYGIEREIVIMKLISHSNILGLYEV 210

Query: 103 WETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKP 162
           WE  S LY++LEY + GELF+ LV +G L E+EAV +F+QI+ G+SYCH+  I HRDLKP
Sbjct: 211 WENKSELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKP 270

Query: 163 ENLLLDHKF-NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCG 221
           ENLLLD K  +IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG
Sbjct: 271 ENLLLDKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCG 330

Query: 222 VILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRI 281
           +ILFALLTG LPF+  D NI+ LLLKVQSG+F MP +  +S +A+DL+S+IL V+P KRI
Sbjct: 331 IILFALLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRI 386

Query: 282 KTREILKHPLLQKYPS----IKDSKSIKNLP------REDTYLFPLSDNNSV-------I 324
            T EIL HPLL KY      +K   S+  +         D ++   S++N V       I
Sbjct: 387 ATEEILNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDI 446

Query: 325 DPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
           D SI+ NL +LWHG  +E I AKL +   + EK  Y+LL  +K
Sbjct: 447 DDSIVSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  390 bits (1002), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/402 (50%), Positives = 265/402 (65%), Gaps = 57/402 (14%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK--------------------- 55
           DT+GPWKLG+TLG GS+G+V+LA N  T + AAIKI+ K                     
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 56  ----SIFNTKPNSN----ETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNS 107
               SI NT    N    + + + N+    PYGIEREI+IMKLL H NV++LY+VWE N+
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNN 208

Query: 108 NLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL 167
            LY++LEY + GELF+ LV KG L E EAV +F+QII GISYCH+  I HRDLKPENLLL
Sbjct: 209 ELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLL 268

Query: 168 DHKFN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFA 226
           D K   IKIADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  SD+WSCG+ILFA
Sbjct: 269 DKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFA 328

Query: 227 LLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREI 286
           LLTG LPF+  D NI+ LL+KVQ+G+++MP    +S++A++LISRIL VDP+KRI T +I
Sbjct: 329 LLTGHLPFN--DDNIKKLLIKVQNGRYQMP--SYISQEAKNLISRILVVDPSKRISTEQI 384

Query: 287 LKHPLLQKY---------------------PSIKDSKSIKNLPREDTYLFPLSDNNSVID 325
           L HPLL KY                      S  D   + N+P ++T +  L    S ID
Sbjct: 385 LSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIP-QNTEIVKLRA-RSDID 442

Query: 326 PSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
            SIL+NL +LWHG  ++ I AKL ++  + EK IY+LL+++K
Sbjct: 443 ESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  385 bits (988), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 256/387 (66%), Gaps = 38/387 (9%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFN----------------- 59
           DT+GPWKLG+TLG GS+G+V+LA N      AAIKI+ K  +N                 
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSG 147

Query: 60  --TKPNSNETSMVANTPDSL--PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEY 115
             +K +SN    + N  DS   PYGIEREI+IMKL+ H NV+ L +VWE  S LY++LEY
Sbjct: 148 TDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEY 207

Query: 116 AEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IK 174
            + GELF+ LV KG L E EAV +F QII G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 208 VDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIK 267

Query: 175 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPF 234
           IADFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFALLTG LPF
Sbjct: 268 IADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

Query: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +  D NI+ LLLKVQ+G+F++P    ++ DA+DLI+RIL  +P KR+   EIL HPL++K
Sbjct: 328 N--DDNIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEILNHPLIKK 383

Query: 295 Y---PSIKDSKSIKNLPREDTYLFPLSDNNSV---------IDPSILQNLVVLWHGRDKE 342
           Y   P+     ++    + ++ L  L  N            ID SIL++L +LWHG  ++
Sbjct: 384 YRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQ 443

Query: 343 QIAAKLKESGANAEKTIYALLYRFKIE 369
           ++  +L   GA  EK  Y+LL+++K++
Sbjct: 444 RLVERLLVEGATEEKLFYSLLFQYKLK 470

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  365 bits (937), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 267/430 (62%), Gaps = 85/430 (19%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS-----------------IFN 59
           D IGPWKLG+TLG GS+G+V+LA N+ T Q AAIKI+ KS                  ++
Sbjct: 91  DMIGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYD 150

Query: 60  TKPNSNETSM-------VANTPDSLP----------------------------YGIERE 84
            KP+ + +S+       V + P  L                             YGIERE
Sbjct: 151 NKPHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIERE 210

Query: 85  IIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQII 144
           I+IMKL+ H NV++LY+VWE  + LY++LEY + GELF+ LV KG L E EAVR+F+QII
Sbjct: 211 IVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQII 270

Query: 145 IGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            G+ YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+  + LL+TSCGSPHYA+PE
Sbjct: 271 RGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPE 330

Query: 204 IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSR 263
           IV G  Y+G  SDVWSCG+ILFALLTG LPF+  D +I+ LL+KVQ+G+++MP  + +S+
Sbjct: 331 IVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP--NYLSK 386

Query: 264 DAQDLISRILTVDPTKRIKTREILKHPLLQKYP---SIK--------------------- 299
           DA+DLISRIL V+P  R+ T +IL+HPL+ KY    S+K                     
Sbjct: 387 DAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLMRGKS 446

Query: 300 --DSKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEK 357
             D   ++N+P + T +  L   N  ID SIL+NL +LW+G  +E + +KL +   + EK
Sbjct: 447 NTDLAILQNIP-DKTDIIQLRSRND-IDDSILRNLQILWNGVPRETLISKLIQDPVSEEK 504

Query: 358 TIYALLYRFK 367
            IY+LL+++K
Sbjct: 505 LIYSLLWQYK 514

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  335 bits (860), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 213/298 (71%), Gaps = 13/298 (4%)

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
           YGIEREI+IMKL+ H NV+ LY+VWE  S LY+ILEY + GELF+ LV +G LPE EA+ 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLL-LDHKFNIKIADFGMAALETEDKLLETSCGSP 197
           +F+QII G+SYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
           HYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ+G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY-PSIKDSKSIKNLPREDTYLF- 315
           +  +S +A+DLISRIL V P+KR+ T EIL HPL+ KY  S K    +K     D +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 316 PLSDNNSV------IDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367
            +S  N        ID SIL+NL +LWHG  ++ I AKL +   + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/39 (66%), Positives = 32/39 (82%)

Query: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK 55
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIKI+ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  245 bits (625), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/120 (93%), Positives = 116/120 (96%)

Query: 88  MKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGI 147
           MKLL HANVL LYDVWETNSNLYM+LEY EKGELFNLLVE+GPLPE EAVRFFRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 148 SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 207
           SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE++DKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
            {ON} YDR507C (REAL)
          Length = 1024

 Score =  265 bits (676), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 222/683 (32%), Positives = 334/683 (48%), Gaps = 117/683 (17%)

Query: 472  SNGNSNSPTPSR-SKRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNG 530
            SN ++ SP PSR SKR S  N  ++  PP+PV +L  Y               L+++ N 
Sbjct: 422  SNSSNGSPMPSRNSKRSSFFNTASANVPPVPVKLLNSYKRNSKRSSKR-----LSYVPNV 476

Query: 531  KRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELX 590
            KRGS+T+K LS Y  L ++D+WEYIEK+TKRTSS+FATLIDEIFE EK+E  R+EK EL 
Sbjct: 477  KRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLIDEIFEPEKFELARREKAELQ 536

Query: 591  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHIDQEISNLKADLANETKGA 650
                                                        +++ L  +  NET  +
Sbjct: 537  RKVQEAKRGK---------------------------------SDVAKLNQENGNETGKS 563

Query: 651  EPYENPR----SVSAPL---ERENPEAIERDINDLFARR-NVSLQTRPKSRLDPGILYSA 702
            +  E  +     VS+PL   E    E ++ DIN L   R  +S  TRP S+LDPG++ + 
Sbjct: 564  DAMEELKKINNKVSSPLINYEYSQQELLQ-DINTLLTNRCQLSAYTRPISKLDPGLMPT- 621

Query: 703  PAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKR 762
              ET+   +    D  +D E KILETIR+S+ L SS N+ KE+           S+   R
Sbjct: 622  -PETIPYDIKEKTDLLLDTEMKILETIRKSKILDSSLNLRKEV-----------SRDADR 669

Query: 763  SKVTSQNIVADKAAIGVIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYST 822
                 ++ +A       +  N+    + KIS+I+VP FTRKS+ F+ +N R SVLS+YS+
Sbjct: 670  LPSVEESPIASTTP---LVYNNDSKEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSS 726

Query: 823  KQSYTNLGDIL--KEGGVNLASEANNTTTSKAS-TEPEFQFESVN--EGTANKLYELQEE 877
            + S+  L  IL  K+   N  S  N   + +   TE     +++       N+LY++ E 
Sbjct: 727  RHSFKGLSRILNSKDPSANPYSHINGPLSEEIDLTEDIANMKNIENNNNNNNRLYDVSES 786

Query: 878  P----------------------EYTDVNKEDGKPKKNVKLPTLPPLHEKTNQANGLAIY 915
                                           + +P   VKLP+L    EK   A+GL IY
Sbjct: 787  AILLQGNDDDDDDDDNENDDGSQSIQSSVSNNTEPTTFVKLPSLSSFQEK--NASGLGIY 844

Query: 916  QSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQATKKINXXXXXXXXX 975
            Q          EP     S+ P  + SI    +V    + + +     +I          
Sbjct: 845  QR---------EP-----SIEPSIESSIEPLPNV-TIAIEDVDEDGENEIQHENITTSLS 889

Query: 976  XXXXXXLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRL 1035
                   ++    + +  NVSF +KFSK   +        + E++  + A +L++GL +L
Sbjct: 890  NDNIKKNDDTKDTIREYSNVSFLKKFSKGKIL--------ELEIHAKIPAERLFEGLHKL 941

Query: 1036 LQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIV-ESKGKQSVVGFNKISGS 1094
            L+GW +YGLK++   +  M +TGKL NDNILSLRST+FE+IV  ++  +S++ FNK +GS
Sbjct: 942  LEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTGS 1001

Query: 1095 SKTVRRLFVEIEKVLRQEGVLSA 1117
            +KT+++L  EI+ VL++EGVL +
Sbjct: 1002 TKTLKKLGYEIQIVLQKEGVLDS 1024

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  246 bits (629), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 178/273 (65%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  +G +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 33  GSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL--------------AKS 78

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E+E
Sbjct: 79  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQE 137

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 138 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 197

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 198 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 255

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A DLI R+L V+P  RI   EI++
Sbjct: 256 P--KFLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  245 bits (625), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 180/273 (65%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TTNQ+ A+KII+K I                  
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKIL--------------AKS 81

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++  ++ M++EYA+  ELF+ +V++  + E E
Sbjct: 82  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENE 140

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A +FF+QII  + YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+   L+TSCG
Sbjct: 141 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD  D +I  L   + +G + +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTL 258

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A +LI R+L V+P  RI   EI++
Sbjct: 259 P--KFLSPGAANLIKRMLIVNPLNRISMNEIME 289

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  244 bits (624), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 182/278 (65%), Gaps = 19/278 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LAF+ TT Q+ A+KII+K + +      ++ M      
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLS------KSDMQGR--- 74

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
                IEREI  ++LLRH +++ LYDV ++   + M++EYA+  ELF+ +V++  + E E
Sbjct: 75  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENE 128

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
             RFF+QII  + YCH   IVHRDLKPENLLLD  +N+KI DFG++ + T+   L+TSCG
Sbjct: 129 GRRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCG 188

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ LL  RLPFD+E  +I  L   + +G + +
Sbjct: 189 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTI 246

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
           P  + +S  A  LI ++L V+P  RI   +I++ P  +
Sbjct: 247 P--NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  244 bits (623), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 177/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL--------------AKS 94

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E+E
Sbjct: 95  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQE 153

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 154 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 213

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 214 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 271

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 272 P--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  244 bits (623), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 177/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL--------------AKS 94

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E+E
Sbjct: 95  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQE 153

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 154 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 213

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 214 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 271

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 272 P--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  243 bits (621), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 176/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 48  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL--------------AKS 93

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E E
Sbjct: 94  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDE 152

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 153 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 212

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 213 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSL 270

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 271 P--KFLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  243 bits (620), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 178/273 (65%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVL--------------AKS 85

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E E
Sbjct: 86  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDE 144

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 145 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 204

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 205 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTI 262

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S+ A  LI ++L V+P  RI  +EI++
Sbjct: 263 P--KFLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  243 bits (620), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 179/273 (65%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +        ++ M      
Sbjct: 50  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLA------KSDMQGR--- 100

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
                IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E+E
Sbjct: 101 -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQE 154

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 155 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 214

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 215 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 272

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 273 P--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  242 bits (617), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 180/274 (65%), Gaps = 19/274 (6%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTP 74
           +G  IG +++ +TLG GS GKV+LA++ +T Q+ A+KII+K +                 
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVL--------------AK 73

Query: 75  DSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEK 134
             +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  +PE+
Sbjct: 74  SDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQ 132

Query: 135 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSC 194
           EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSC
Sbjct: 133 EARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 192

Query: 195 GSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 254
           GSP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + 
Sbjct: 193 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYT 250

Query: 255 MPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           +P  + +S+ A  LI ++L V+P  RI   EI++
Sbjct: 251 IP--NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  242 bits (618), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 180/273 (65%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LAF+ TT Q+ A+KII++ + +      ++ M      
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLS------KSDMQGR--- 86

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
                IEREI  ++LLRH +++ LYDV ++   + MI+EYA   ELF+ +V++  + E E
Sbjct: 87  -----IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENE 140

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A +FF+QII  + YCH   IVHRDLKPENLLLD  +N+KI DFG++ + T+   L+TSCG
Sbjct: 141 ARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCG 200

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTL 258

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P  + +S  A  LI ++L V+P  RI   EI++
Sbjct: 259 P--NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  242 bits (618), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 178/273 (65%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII++ +                  
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVL--------------AKS 83

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA+  ELF+ +V++  + E+E
Sbjct: 84  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQE 142

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 143 ARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 202

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 203 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTL 260

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 261 P--RFLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  241 bits (616), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 179/278 (64%), Gaps = 19/278 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TTNQ+ A+KII+K +                  
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVL--------------AKS 84

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + +++E+A   ELF+ ++++  + E+E
Sbjct: 85  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQE 143

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 144 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 203

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 204 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYIL 261

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
           P    +S  A +LI ++L V+P  RI   EI K    Q
Sbjct: 262 P--KFLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  241 bits (616), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 175/272 (64%), Gaps = 19/272 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TTNQ+ A+KII+K +                  
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVL--------------AKS 107

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   +EREI  ++LLRH +++ LYDV ++   + M++EYA   ELF  +V++  + E E
Sbjct: 108 DMQGRVEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENE 166

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A +FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 167 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCG 226

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD  D +I  L   + +G + +
Sbjct: 227 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTL 284

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287
           P    +S  A +LI ++L V+P  RI   EI+
Sbjct: 285 P--KFLSEGAANLIKKMLIVNPLNRISMTEII 314

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  241 bits (615), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 176/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL--------------AKS 81

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + EKE
Sbjct: 82  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKE 140

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 141 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 258

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 259 P--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  239 bits (611), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 176/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K I                  
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKIL--------------AKS 88

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + +++E+A   ELF+ ++++  + E E
Sbjct: 89  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENE 147

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 148 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 207

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 208 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYIL 265

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 266 P--KFLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  240 bits (612), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 176/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVL--------------AKS 100

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E E
Sbjct: 101 DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENE 159

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 160 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 219

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 220 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTI 277

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S+ A  LI R+L V+P  RI   EI++
Sbjct: 278 P--KFLSQGASSLIKRMLIVNPLNRISISEIMQ 308

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  236 bits (602), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 178/270 (65%), Gaps = 19/270 (7%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +        ++ M         
Sbjct: 27  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLA------KSDMQGR------ 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E+EA R
Sbjct: 75  --IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARR 131

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 132 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 191

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 192 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP-- 247

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILK 288
             +S  A +LI R+L V+P  RI   EI++
Sbjct: 248 KFLSPGAANLIKRMLIVNPLNRITIHEIME 277

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  237 bits (604), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 176/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                  
Sbjct: 45  GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVL--------------AKS 90

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
            +   IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E+E
Sbjct: 91  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEE 149

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 150 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 209

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 210 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 267

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A  LI R+L V+P  RI   EI++
Sbjct: 268 P--KFLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  236 bits (601), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 175/270 (64%), Gaps = 19/270 (7%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                   + 
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVL--------------AKSDMQ 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E EA R
Sbjct: 75  GRIEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARR 133

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+
Sbjct: 134 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 193

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 194 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP-- 249

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILK 288
             +S  A +LI R+L V+P  RI   EI++
Sbjct: 250 KFLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  235 bits (600), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 174/270 (64%), Gaps = 19/270 (7%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           IG +++ +TLG GS GKV+LA++ TT Q+ A+KII+K +                   + 
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL--------------AKSDMQ 73

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E EA R
Sbjct: 74  GRIEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARR 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
           FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L TSCGSP+
Sbjct: 133 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPN 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +P  
Sbjct: 193 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLP-- 248

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILK 288
             +S  A +LI R+L V+P  RI   EI++
Sbjct: 249 KFLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  234 bits (598), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 175/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA + +T Q+ A+KII+K +                  
Sbjct: 33  GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--------- 83

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
                IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E E
Sbjct: 84  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENE 137

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 138 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 197

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 198 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSI 255

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S+ A +LI R+L V+P  RI   EI++
Sbjct: 256 P--KFLSQGAANLIKRMLIVNPLNRITIHEIME 286

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  234 bits (598), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/273 (44%), Positives = 176/273 (64%), Gaps = 19/273 (6%)

Query: 16  GDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD 75
           G  IG +++ +TLG GS GKV+LA++ +T+Q+ A+KII+K +                  
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------- 87

Query: 76  SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKE 135
                IEREI  ++LLRH +++ LYDV ++   + M++EYA   ELF+ +V++  + E E
Sbjct: 88  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENE 141

Query: 136 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 195
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 142 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 201

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255
           SP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   + +G + +
Sbjct: 202 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSI 259

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S  A +LI ++L V+P  RI   EI++
Sbjct: 260 P--KFLSPGAANLIKKMLIVNPLNRITIHEIME 290

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  203 bits (516), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 171/291 (58%), Gaps = 28/291 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTN------QQAAIKIISKSIFNTKPNSNETSMVA 71
           T GP+ +G TLG G  GKV+L +++T+N      +Q AIK+I +   +T P ++E  +  
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR---DTIPKNSEKEI-- 90

Query: 72  NTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPL 131
                    I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +K  L
Sbjct: 91  --------KIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRL 142

Query: 132 PEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLL 190
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E++L+
Sbjct: 143 KEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELM 202

Query: 191 ETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE----DG-NIRNL 244
           +TSCGSP YAAPE +V+  PY   ++DVWSCGVIL+A+L G LP+D++    DG +I  L
Sbjct: 203 KTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKL 262

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
              +     + P  D ++   +DL+  IL  DP +RI   + LKH  LQ +
Sbjct: 263 YRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  204 bits (519), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 127/350 (36%), Positives = 202/350 (57%), Gaps = 33/350 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS--IFNTKPN---SNETS-MVA 71
           ++G W   ET+G GS GKV+LA N  T +  AIKI++++  IF TK +   S+ T+ ++ 
Sbjct: 93  SLGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIM 152

Query: 72  NTPDSLPYG--IEREII----------IMKLLRHANVLSLYDVWETNSNLYMILEYAEKG 119
           N  D L     +E+EI           + ++L H ++  L++++  +++ YM+ EY   G
Sbjct: 153 NEKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGG 212

Query: 120 ELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFG 179
           +L + +++ G L E  A  F RQI+  + Y HA  IVHRDLK EN+++    NIKI DFG
Sbjct: 213 QLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFG 272

Query: 180 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG 239
           ++ L  + K L+T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 273 LSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 332

Query: 240 NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSI 298
           N+  L  K++ G+   P    +S +   L+S +L VDP KR    +++KH  + K Y SI
Sbjct: 333 NV--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSI 388

Query: 299 KDSKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKL 348
            D+    +LP+      PL+  +  ID  +++ +  L    D EQ   KL
Sbjct: 389 PDA----HLPKR----VPLTSES--IDMKVIKEMKHLEFIEDIEQTEKKL 428

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  201 bits (512), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/323 (38%), Positives = 183/323 (56%), Gaps = 31/323 (9%)

Query: 10  AIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTN------QQAAIKIISKSIFNTKPN 63
           A P  +  T GP+ +G TLG G  GKV+L +++  +      +Q AIK+I +   ++ P 
Sbjct: 27  AKPRKRHVTFGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR---DSIPK 83

Query: 64  SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
           ++E  +           I REI  +K L H N++ L +V + +  + ++LEYA  GE + 
Sbjct: 84  NSEKEV----------KIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYK 133

Query: 124 LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-A 182
            +  K  L E  A R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    
Sbjct: 134 YIQRKRRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNE 193

Query: 183 LETEDKLLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE---- 237
             + ++L++TSCGSP YAAPE +VS  PY   +SDVWSCGVIL+A+L G LP+D++    
Sbjct: 194 FVSHNELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNP 253

Query: 238 DGN-IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYP 296
           DGN I  L   +     + P  + ++  ++DL+ RIL  DP KRI  R I KH  L+ + 
Sbjct: 254 DGNDIVRLYYYITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPHA 311

Query: 297 ---SIKDSKSIKNLPREDTYLFP 316
              SI   +  K +  +D +  P
Sbjct: 312 AFISITPEEWDKAMSSKDVFRLP 334

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  201 bits (511), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 167/288 (57%), Gaps = 29/288 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQ-----QAAIKIISK-SIFNTKPNSNETSMVA 71
           T GP+ +G TLG G  GKV+L + +TT++     Q AIK+I + +I N      +     
Sbjct: 36  TFGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNYSEKETK----- 90

Query: 72  NTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPL 131
                    I REI  +K L H N++ L +V + +  + ++LE+A  GE +  + +K  L
Sbjct: 91  ---------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRL 141

Query: 132 PEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLL 190
            E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L+
Sbjct: 142 KETPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELM 201

Query: 191 ETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE----DG-NIRNL 244
           +TSCGSP YAAPE +V+  PY   ++DVWSCG+IL+A+L G LP+D++    DG +I  L
Sbjct: 202 KTSCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKL 261

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            L +     + P  + ++   +DL+ +IL  DPTKR+  R I KH  L
Sbjct: 262 YLYITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  200 bits (509), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 171/305 (56%), Gaps = 42/305 (13%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQA--------------------AIKIISKSI 57
           T GP+ +G TLG G  GKV+LA++++  QQ                     AIK+I +  
Sbjct: 44  TFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRD- 102

Query: 58  FNTKPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAE 117
           F TK  S ET             I REI  +K L H N++ L +V + +  + ++LEYA 
Sbjct: 103 FITKDPSKETK------------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAA 150

Query: 118 KGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIAD 177
            GE +  +  K  L E  A R F Q+I  + Y H+ G+VHRDLK ENLLLD++ N+ I D
Sbjct: 151 GGEFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITD 210

Query: 178 FGMA-ALETEDKLLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFD 235
           FG       ++ +++TSCGSP YAAPE +VS  PY   ++D WSCG+ILFA+L G LP+D
Sbjct: 211 FGFVNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWD 270

Query: 236 EE----DG-NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHP 290
           ++    DG +I  L   + +   + P  + ++   +DL+ +IL +DP KRI  R I KHP
Sbjct: 271 DDPKNPDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHP 328

Query: 291 LLQKY 295
            L+ +
Sbjct: 329 WLESH 333

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  200 bits (509), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 170/291 (58%), Gaps = 28/291 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTN------QQAAIKIISKSIFNTKPNSNETSMVA 71
           T GP+ +G TLG G  GKV++ +++T++      +Q AIK+I +   +T P ++E  +  
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRR---DTIPKNSEKEV-- 90

Query: 72  NTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPL 131
                    I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +K  L
Sbjct: 91  --------KIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRL 142

Query: 132 PEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLL 190
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E++L+
Sbjct: 143 KESAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELM 202

Query: 191 ETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE----DG-NIRNL 244
           +TSCGSP YAAPE +V+  PY   ++D+WSCGVI++A+L G LP+D++    DG +I  L
Sbjct: 203 KTSCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKL 262

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
              +     + P  D ++   +DL+  IL  DP KRI   + L H  LQ +
Sbjct: 263 YRYITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  199 bits (507), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 178/326 (54%), Gaps = 43/326 (13%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETTN--------QQAAIKIISK-SIFNTKPNSN 65
           K  + GP+ +G TLG G  GKV++ +             +Q AIK+I + SI N K  S 
Sbjct: 35  KCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDK--SK 92

Query: 66  ETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
           E              I REI  +K L H N++ L +V + +  + ++LEYA  GE +  +
Sbjct: 93  EVK------------IYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYI 140

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALE 184
            ++  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      
Sbjct: 141 QKRRVLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYF 200

Query: 185 TEDKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEE----DG 239
           ++++L+ TSCGSP YAAPE+V S  PY G  +D+WSCG+ILFA+L G LP+D++    DG
Sbjct: 201 SQNELMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDG 260

Query: 240 -NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPS- 297
            +I  L   +     + P  + ++   +DL+ RIL  DP +R+  REI  H  L+K+   
Sbjct: 261 EDIAKLYYYITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQF 318

Query: 298 ----------IKDSKSIKNLPREDTY 313
                     I  SK+I  LP+ + +
Sbjct: 319 LSIQPEEWDRISQSKNITRLPKHNKH 344

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  198 bits (504), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 169/290 (58%), Gaps = 27/290 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTN-----QQAAIKIISKSIFNTKPNSNETSMVAN 72
           T GP+ LG TLG G  G+V+L +++ T+     +Q AIK+I +   +T P +++  +   
Sbjct: 40  TFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRR---DTIPKNSDKEI--- 93

Query: 73  TPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP 132
                   I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +K  L 
Sbjct: 94  -------KIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 146

Query: 133 EKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLE 191
           E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++
Sbjct: 147 EAVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMK 206

Query: 192 TSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE----DGN-IRNLL 245
           TSCGSP YAAPE +VS  PY   ++D+WSCGVIL+A+L G LP+D++    DGN I  L 
Sbjct: 207 TSCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLY 266

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
             +     + P  + ++   +DL+ RIL  DP +RI  R I KH  ++ +
Sbjct: 267 QYITRTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  199 bits (505), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 166/291 (57%), Gaps = 28/291 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAF--NETTNQ----QAAIKIISKSIFNTKPNSNETSMVA 71
           T GP+ +G TLG G  GKV+L +  N T+NQ    Q AIK+I +             +V 
Sbjct: 40  TFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRD-----------KIVK 88

Query: 72  NTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPL 131
           N+   +   I REI  +K L H N++ L +V + +  + ++LEYA  GE +  +  K  L
Sbjct: 89  NSEKEIK--IFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRL 146

Query: 132 PEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLL 190
            E    R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG       ++ L+
Sbjct: 147 KETAGCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLM 206

Query: 191 ETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDE-----EDGNIRNL 244
           +TSCGSP YAAPE+V S  PY   ++D+WSCG+IL+A+L G LP+D+     E  +I  L
Sbjct: 207 KTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARL 266

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
              +     + P  + +S   +DL+ R+L  DP KR+  R+I +H  L+ +
Sbjct: 267 YYFITRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  199 bits (505), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 170/290 (58%), Gaps = 27/290 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTN-----QQAAIKIISKSIFNTKPNSNETSMVAN 72
           T GP+ +G TLG G  GKV+L +++TT      +Q AIK+I +   +T P +++  +   
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRR---DTVPKNSDKEV--- 93

Query: 73  TPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP 132
                   I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +K  L 
Sbjct: 94  -------KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLK 146

Query: 133 EKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLE 191
           E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       +++L++
Sbjct: 147 EHAACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMK 206

Query: 192 TSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IRNLL 245
           TSCGSP YAAPE +V+  PY   ++D+WSCGVI++A+L G LP+D++  N     I  L 
Sbjct: 207 TSCGSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLY 266

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
             +     + P  + ++   +DL+ RIL  +P KR+  R++ +H  LQ +
Sbjct: 267 HYITKTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  197 bits (502), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 122/330 (36%), Positives = 179/330 (54%), Gaps = 39/330 (11%)

Query: 19  IGPWKLGETLGLGSTGKVQLAF----------NETTNQQAAIKIISKSIFNTKPNSNETS 68
            GP+ +G T+G G  GKV+L +          N   ++Q AIK+I +    +K +S E  
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAI-SKDSSKE-- 122

Query: 69  MVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEK 128
                       I REI  +K L H N++ L +V + +  + ++LEYA  GE +  +  K
Sbjct: 123 ----------LKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRK 172

Query: 129 GPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETED 187
             L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 173 KRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHN 232

Query: 188 KLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----I 241
           +L++TSCGSP YAAPE+V S  PY   ++D+WSCG+IL+A+L G LP+D++ GN     I
Sbjct: 233 ELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDI 292

Query: 242 RNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDS 301
             L   +     + P  D ++   +DL+ +IL  DP +RI  ++I KH  L+ + +    
Sbjct: 293 SRLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPHTAF--- 347

Query: 302 KSIKNLPRE-DTYLFPLSDNNSVIDPSILQ 330
             +   P E DT + P S N S I P  L 
Sbjct: 348 --LSITPEEWDTIMHPKS-NTSFIRPVPLH 374

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  196 bits (499), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 167/298 (56%), Gaps = 32/298 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQLA----FNETTN------QQAAIKIISKSIFNTKPNSNET 67
           T GP+ LG TLG G  GKV+L     F+ ++N      +Q AIK+I +        SN+ 
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSI-----SNDY 91

Query: 68  SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
                        I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +
Sbjct: 92  RKEVK--------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 128 KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 186
           K  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 KRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 187 DKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN----- 240
           ++L++TSCGSP YAAPE+V S  PY   ++D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSD 263

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
           I  L   + S   + P  D +    +DL+ R+L  DP KRI  ++I KH  L+ + S 
Sbjct: 264 IGRLYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  196 bits (498), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 116/298 (38%), Positives = 167/298 (56%), Gaps = 32/298 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAF-----NETTN-----QQAAIKIISKSIFNTKPNSNET 67
           T GP+ LG TLG G  GKV+L +     N +T+     +Q A+K+I +        SN+ 
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTI-----SNDY 91

Query: 68  SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
                        I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +
Sbjct: 92  KKEVK--------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 128 KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 186
           K  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 KRRLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 187 DKLLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDE-----EDGN 240
           ++L++TSCGSP YAAPE +VS  PY   ++D+WSCGVIL+A+L G LP+D+     E  +
Sbjct: 204 NELMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSD 263

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
           I  L   + S   + P  D +    +DL+ RIL  DP +RI  ++I KH  L+ + S 
Sbjct: 264 IGRLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 166/298 (55%), Gaps = 32/298 (10%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETT----------NQQAAIKIISKSIFNTKPNS 64
           K  T GP+ +G TLG G  GKV+L + + +           +Q AIK+I +    +K +S
Sbjct: 41  KHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTI-SKDSS 99

Query: 65  NETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
            E              I REI  +K L H N++ L +V + +  + ++LEYA  GE +  
Sbjct: 100 KEIK------------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKY 147

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-L 183
           +  K  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG  +  
Sbjct: 148 IQRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEF 207

Query: 184 ETEDKLLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-- 240
            +  +L++TSCGSP YAAPE +VS  PY   ++D+WSCGVIL+A+L G LP+D++ GN  
Sbjct: 208 YSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPD 267

Query: 241 ---IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
              I  L   +     + P  D ++   +DL+ RIL  DP +RI  + I KH  L+ +
Sbjct: 268 GDDISRLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  196 bits (499), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 169/292 (57%), Gaps = 20/292 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK-------PNSNETS 68
           ++G W   ET+G GS GKV+LA +  TN+  AIKI++++   F  K       P SNE  
Sbjct: 111 SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFIHKQQQQQLPPPSNEEE 170

Query: 69  MVANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELF 122
           ++      L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L 
Sbjct: 171 LMERR-KKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 229

Query: 123 NLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 182
           + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ 
Sbjct: 230 DYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSN 289

Query: 183 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIR 242
           L    K L T CGS ++AAPE++   PY G E D+WS GV+L+ L+ G++PFD+E+ ++ 
Sbjct: 290 LYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV- 348

Query: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
            L  K++ G+ E P    +S D   L+S++L VDP KR   ++++ H  +QK
Sbjct: 349 -LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  190 bits (482), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 166/299 (55%), Gaps = 40/299 (13%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTN------------------QQAAIKIISKSIFNT 60
            G + LG+TLG G  GKV+L +    N                  +Q AIK+I +   + 
Sbjct: 56  FGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTLSA 115

Query: 61  KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120
              S E+ +           + REI  +K+L H N++ L +V + +  + ++LEYA  GE
Sbjct: 116 ---SKESEI----------KLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGE 162

Query: 121 LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180
            +  +  K  L E +A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ I DFG 
Sbjct: 163 FYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGF 222

Query: 181 AALETE-DKLLETSCGSPHYAAPEIVSGI-PYHGFESDVWSCGVILFALLTGRLPFDEED 238
               T+ +KL+ T CGSP YAAPE+V+ + PY+  ++D+WSCGVIL+A+L G LP+D++ 
Sbjct: 223 VNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDP 282

Query: 239 GNIRN-----LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            NI       L   +++   + P+   M    +DL+ R+L +DP KR+  + IL+H  +
Sbjct: 283 KNINGTDIVKLYKYIENQPLKFPEYINMV--PRDLLRRMLEIDPAKRMSMKHILQHAWI 339

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  190 bits (482), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 162/296 (54%), Gaps = 30/296 (10%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNE--------TTNQQAAIKIISKSIFNTKPNSNE 66
           K  T GP+ LG T+G G  GKV+  ++         T  +Q AIK+I +     K +   
Sbjct: 48  KQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQE- 106

Query: 67  TSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLV 126
                         + REI  +KLL H N++ L DV + +  + ++LEYA  GE +  L 
Sbjct: 107 ------------LKVYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQ 154

Query: 127 EKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 185
            K  L E  A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T
Sbjct: 155 RKKRLKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEIST 214

Query: 186 EDKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEE----DG- 239
            +KL++T CGSP YAAPE+V S  PY   ++D+WS GVIL+A+L G LP+D++    DG 
Sbjct: 215 NNKLMKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGS 274

Query: 240 NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           NI  L   +     + PD  E    A+DLI +IL + P  R+   ++ +H  L+ +
Sbjct: 275 NIMRLYEYITKNNLKFPDYIEPL--ARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  193 bits (490), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 116/336 (34%), Positives = 176/336 (52%), Gaps = 58/336 (17%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTN-------------------------QQAAIKI 52
           T GP+ +G T+G G  GKV+L ++++ +                         +Q AIK+
Sbjct: 57  TFGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKL 116

Query: 53  ISKSIFNTKPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMI 112
           I +   +  P                  I REI  +K L H N++ L +V + +  + ++
Sbjct: 117 IRRDTISKDPRRE-------------IKIYREINALKQLTHPNIVKLDEVLQNSKYIGIV 163

Query: 113 LEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN 172
           LEYA  GE +  +  K  L E  A + F Q+I G++Y H+ G++HRDLK EN+LLD   N
Sbjct: 164 LEYASGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNEN 223

Query: 173 IKIADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTG 230
           + I DFG      T ++L++TSCGSP YAAPE+V S  PY   + D+WSCG+ILFA+L G
Sbjct: 224 LIITDFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAG 283

Query: 231 RLPFDEE-----DGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTRE 285
            LP+D++       NI  L   + +   + P  + ++   +DL+ RIL  DP KR+  R 
Sbjct: 284 YLPWDDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRY 341

Query: 286 ILKH-------PLL----QKYPSIKDSKSIKNLPRE 310
           ILKH       P L    +++ +I  S+SI  LP+ 
Sbjct: 342 ILKHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  192 bits (487), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 182/326 (55%), Gaps = 33/326 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAF---NETTN--QQAAIKIISKSIFNTKPNSNETSMVAN 72
           T GP+ +G TLG G  GKV+L +   NE+T+  +Q AIK+I +            S++ +
Sbjct: 30  TFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRD-----------SILQD 78

Query: 73  TPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP 132
               +   I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +K  L 
Sbjct: 79  REKEI--KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 136

Query: 133 EKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLE 191
           E  A + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++
Sbjct: 137 EPIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMK 196

Query: 192 TSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN-----LL 245
           TSCGSP YAAPE +V+  PY   ++DVWSCG+ILFA+L G LP+D++  N R      L 
Sbjct: 197 TSCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLY 256

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIK 305
             + +   + P    +S   +DL+ +IL  +P +R+  REI  H  L+ + S      +K
Sbjct: 257 NYITTSPLKFP--SYISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF-----LK 309

Query: 306 NLPREDTYLFPLSDNNSVIDPSILQN 331
             P+E   +  L  + S I P  LQN
Sbjct: 310 ISPKEWDDVMKLKADPSKIRPK-LQN 334

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  194 bits (494), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 119/362 (32%), Positives = 194/362 (53%), Gaps = 34/362 (9%)

Query: 7   NKKAIPTIKGDT-------IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI-- 57
           N+   P I  +T       +G W   ET+G GS GKV+LA +  T +  AIKI++++   
Sbjct: 142 NRNTAPIISNETKQFHRRSLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKA 201

Query: 58  FNTK-----PNSNETSMVANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETN 106
           F  K     P  NE   +A     L   I R      E  + ++L H ++  L+++   +
Sbjct: 202 FLHKEQSMPPPKNEQE-IAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMS 260

Query: 107 SNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLL 166
           ++ YM+ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN++
Sbjct: 261 NHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIM 320

Query: 167 LDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFA 226
           + +   IKI DFG++ +    K L T CGS ++AAPE++   PY G E DVWS G++L+ 
Sbjct: 321 ISNSGEIKIIDFGLSNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYV 380

Query: 227 LLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREI 286
           L+ G++PFD+E+ ++  L  K++ G+ E P  + +S +   L+S+++ VDP KR   R++
Sbjct: 381 LVCGKVPFDDENSSV--LHEKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQV 436

Query: 287 LKHPLLQKYPSIKDSKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAA 346
           ++HP + +     D   +  LPR      PL+     ID ++L+ +  L    D E+   
Sbjct: 437 VEHPWMTRG---YDFPPLSYLPRR----IPLTP--EAIDNNVLREMFRLEFIDDVEECQN 487

Query: 347 KL 348
            L
Sbjct: 488 SL 489

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  192 bits (488), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 114/295 (38%), Positives = 167/295 (56%), Gaps = 32/295 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAF-------NETTNQ---QAAIKIISKSIFNTKPNSNET 67
           T GP+ LG TLG G  GKV+L +       + TT +   Q A+K+I +   +T  N+ + 
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKR---DTISNNYKK 93

Query: 68  SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
            +           I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +
Sbjct: 94  EV----------KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 128 KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 186
           K  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 KRRLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 187 DKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN----- 240
           ++L++TSCGSP YAAPE+V S  PY   ++D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSD 263

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           I  L   + S   + P  D +    +DL+ RIL  DP KR+  ++I KH  L  +
Sbjct: 264 IGRLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  194 bits (492), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/346 (33%), Positives = 193/346 (55%), Gaps = 29/346 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK------PNSNETSM 69
           ++G W   ET+G GS GKV+LA +  TN+  AIKI++++   F  K      P S E ++
Sbjct: 150 SLGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEAL 209

Query: 70  VANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
                 +L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L +
Sbjct: 210 --ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLD 267

Query: 124 LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
            +++ G L E  A +F R I   + Y H   IVHRDLK EN+++    +IKI DFG++ L
Sbjct: 268 YIIQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNL 327

Query: 184 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243
               K L T CGS ++AAPE++   PY G E D+WS GV+L+ L  G++PFD+E+ ++  
Sbjct: 328 YDSKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV-- 385

Query: 244 LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303
           L  K++ G+ + P    +S +   L+S++L VDP KR   ++I+ HP + +     D+K+
Sbjct: 386 LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTRG---FDTKA 440

Query: 304 IKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLK 349
              LP       P+S +  +I+ ++++ +  L    D EQ   KLK
Sbjct: 441 PSYLPLR----VPMSID--MINHNVVKEMFELEFIDDIEQSMNKLK 480

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  193 bits (491), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 168/285 (58%), Gaps = 18/285 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK-----PNSNETSMV 70
           ++G W+  ET+G GS GKV+LA +  TN+  A+KI++++   F  K     P  NE  ++
Sbjct: 114 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 174 ERQ-KKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDY 232

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L 
Sbjct: 233 IIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLY 292

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  L
Sbjct: 293 DSRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--L 350

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
             K++ G+ E P    +S +   L+S++L VDP +R   +++++H
Sbjct: 351 HEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 165/295 (55%), Gaps = 32/295 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQL----AFNETTN------QQAAIKIISKSIFNTKPNSNET 67
           T GP+ LG TLG G  GKV+L    +F  ++N      +Q A+K+I +        SN+ 
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTI-----SNDY 91

Query: 68  SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
                        I REI  +K L H N++ L +V + +  + ++LEYA  GE +  + +
Sbjct: 92  KKEVK--------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQK 143

Query: 128 KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 186
           +  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 RRRLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 187 DKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDE-----EDGN 240
           ++L++TSCGSP YAAPE+V S  PY   ++D+WSCGVIL+A+L G LP+D+     E  +
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSD 263

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           I  L   +     + P  D +    +DL+ RIL  DP +RI  ++I KH  L+ +
Sbjct: 264 IGRLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 168/285 (58%), Gaps = 18/285 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK-----PNSNETSMV 70
           ++G W+  ET+G GS GKV+LA +  TN+  A+KI++++   F  K     P  NE  ++
Sbjct: 127 SLGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 186

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 187 ERQ-KKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDY 245

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L 
Sbjct: 246 IIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLY 305

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  L
Sbjct: 306 DSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--L 363

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
             K++ G+ E P    +S +   L+S++L VDP +R   +++++H
Sbjct: 364 HEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 167/288 (57%), Gaps = 18/288 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI-------FNTKPNSNETSMV 70
           ++G W   ET+G GS GKV+LA +  TN+  AIKI++++         +  P  NE  M+
Sbjct: 97  SLGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLAPPKNENEML 156

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 157 ERQ-KKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 215

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G L E  A +F R +   + Y HA  IVHRDLK EN+++     IKI DFG++ + 
Sbjct: 216 IIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVF 275

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E D+WS GV+L+ L+ G++PFD+E+ ++  L
Sbjct: 276 DTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--L 333

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             K++ G+ E P  + +S +   L+S++L VDP KR    ++++HP +
Sbjct: 334 HEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  192 bits (488), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 168/290 (57%), Gaps = 18/290 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI-------FNTKPNSNETSMV 70
           ++G W   ET+G GS GKV+LA +  T +  AIKI++++         N+ P  N   ++
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++  H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 164 ERQ-KKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDY 222

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G L E  A +F R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ + 
Sbjct: 223 IIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVY 282

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L
Sbjct: 283 DTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--L 340

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
             K++ G+ E P    +S +   L+S++L VDP++R   +++++HP + K
Sbjct: 341 HEKIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 167/291 (57%), Gaps = 18/291 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFNTK------PNSNETS 68
           ++G W   ET+G GS GKV+LA +  TN+  AIKI+   +KS  + +      P + E  
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEE 109

Query: 69  MVANTPD-----SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
           ++          S      RE  + ++L H ++  L+++   +++ YM+ EY   G+L +
Sbjct: 110 LLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 169

Query: 124 LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
            +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ +
Sbjct: 170 YIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSNM 229

Query: 184 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243
               K L T CGS ++AAPE++   PY G E D+WS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 230 YDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV-- 287

Query: 244 LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           L  K++ G+ E P    +S D   L+S++L VDP KR   ++++ H  +QK
Sbjct: 288 LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  191 bits (486), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 167/290 (57%), Gaps = 23/290 (7%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS--IFNTKPNSNETSMVANTPD 75
           ++G W   ET+G GS GKV+LA N  TN+  AIKI++++  IF +K  + + +     P 
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYT-IPL 125

Query: 76  SLPYGIER----------------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKG 119
           S    IER                E  + ++L H ++  LY++   +++ YM+ EY   G
Sbjct: 126 SEKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGG 185

Query: 120 ELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFG 179
           +L + +++ G L E  A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG
Sbjct: 186 QLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFG 245

Query: 180 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG 239
           ++ L  +   L+T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 246 LSNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 240 NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
           N+  L  K++ G+   P    +S +   L+S++L VDP KR    +++ H
Sbjct: 306 NV--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  187 bits (476), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 164/295 (55%), Gaps = 32/295 (10%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNET----------TNQQAAIKIISKSIFNTKPNSNET 67
           T GP+ +G TLG G  GKV+L +  T           ++Q AIK+I +            
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRD----------- 88

Query: 68  SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127
           ++V N+   +   I REI  +K L H NV+ L +V + +  + ++LEYA  GE +  +  
Sbjct: 89  TIVKNSEKEI--KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQR 146

Query: 128 KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 186
           K  L E  A R F Q+I G++Y H+  +VHRDLK ENLLLD   N+ I DFG       +
Sbjct: 147 KRRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPD 206

Query: 187 DKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN----- 240
           ++ ++TSCGSP YAAPE+V S  PY   ++DVWSCG+IL+A+L G LP+D++  N     
Sbjct: 207 NEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDD 266

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           I  L   +     + P  + ++   +DL+ +IL  DP KR+  + I +H  L+ +
Sbjct: 267 IGKLYQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  190 bits (482), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 148/282 (52%), Gaps = 28/282 (9%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T Q+  +K   KS     PN               
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS----DPN--------------- 79

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +   +  +  LY+V  T + ++M LEY    EL++ L+ K  LP  E   
Sbjct: 80  --VVREVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAE 137

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  
Sbjct: 138 LFAQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTV 197

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++   PY GF+ D+WS GVIL+ LL G LPFDE+D      LL  Q    + P  
Sbjct: 198 YMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVI 252

Query: 259 DEMSR--DAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
           DE     +AQ+LI ++L+ DPT+R  T  IL HP LQ Y ++
Sbjct: 253 DERITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 171/294 (58%), Gaps = 26/294 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFN-----TKPNSNETSM 69
           ++G W   ET+G GS GKV+LA +  T++  AIKI+   +KS  +     T P S + ++
Sbjct: 75  SLGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEAL 134

Query: 70  ---------VANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120
                    ++    ++     RE  + ++L H ++  L+++   +++ YM+ EY   G+
Sbjct: 135 ERKRKLEKEISRDKRTI-----REASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 189

Query: 121 LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180
           L + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG+
Sbjct: 190 LLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGL 249

Query: 181 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240
           + +    K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ +
Sbjct: 250 SNMYDPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENAS 309

Query: 241 IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +  L  K++ G+ E P    +S +   L+S++L VDP+KR   ++++ H  +Q+
Sbjct: 310 V--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 168/285 (58%), Gaps = 18/285 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK-----PNSNETSMV 70
           ++G W+  ET+G GS GKV+LA +  TN+  A+KI++++   F  K     P  NE  ++
Sbjct: 114 SLGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 174 ERQ-KKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDY 232

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L 
Sbjct: 233 IIQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLY 292

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  L
Sbjct: 293 DSRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--L 350

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
             K++ G+ E P    +S +   L+S++L VDP +R   +++++H
Sbjct: 351 HEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 168/285 (58%), Gaps = 18/285 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK-----PNSNETSMV 70
           ++G W+  ET+G GS GKV+LA +  TN+  A+KI++++   F  K     P  NE  ++
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 176 ERQ-KKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDY 234

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ + 
Sbjct: 235 IIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIY 294

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  L
Sbjct: 295 DSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--L 352

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
             K++ G+ E P    +S +   L+S++L VDP +R   +++++H
Sbjct: 353 HEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 160/293 (54%), Gaps = 27/293 (9%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETTN-----QQAAIKIISKSIFNTKPNSNETSM 69
           K  T GP+ +G TLG G  GKV+L + + ++     +Q AIK+I +       +      
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKE---- 94

Query: 70  VANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKG 129
                      I REI  +K L H N++ L +V + +  + ++LE+   GE +  +  K 
Sbjct: 95  ---------VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKR 145

Query: 130 PLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDK 188
            L E  A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG       +++
Sbjct: 146 RLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNE 205

Query: 189 LLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IR 242
           L+ TSCGSP YAAPE +VS  PY   ++DVWSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMNTSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIA 265

Query: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
            L   +     + P  + ++   +DL+ RIL  +P +R+  R I +H  L+ +
Sbjct: 266 RLYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  187 bits (474), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 164/295 (55%), Gaps = 30/295 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFN--------ETTNQQAAIKIISKSIFNTKPNSNETSMV 70
            G + LG TLG G  GKV+L ++        ++ ++Q AIK+I +  +  K +  E    
Sbjct: 43  FGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRD-YVKKGSDKEIK-- 99

Query: 71  ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130
                     I REI  +KLL H N++ L +V + +  + ++LE+A  GE +  L  K  
Sbjct: 100 ----------IYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRR 149

Query: 131 LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKL 189
           L E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L
Sbjct: 150 LKEPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNEL 209

Query: 190 LETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IRN 243
           ++ SCGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+D++  N     I  
Sbjct: 210 MKRSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGK 269

Query: 244 LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
           L   +     + P    +S  A+DLI +ILT +P++RI    I KH  L+ + S 
Sbjct: 270 LYQYITKTALKFP--AYISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 168/294 (57%), Gaps = 19/294 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIF------NTKPNSNETSMVA 71
           ++G W   ET+G GS GKV+LA +  T +  AIKI+++++        + P       V 
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFD 337

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 338 RKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 395

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK---YP 296
            K++ G+ + P  + +S +   L+S++L VDP +R   +++++HP + +   YP
Sbjct: 396 EKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 166/290 (57%), Gaps = 18/290 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFNTK----PNSNETSMV 70
           ++G W+  ET+G GS GKV+L  +  T +   IKI+   SK+  + +    P  NE  ++
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNENELL 162

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 163 ERQ-KRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 221

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G L E  A +F R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ + 
Sbjct: 222 IIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIF 281

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
              K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  L
Sbjct: 282 DSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--L 339

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
             K++ G+ + P    +S DA  L++R++ VDP KR   + +  HP + +
Sbjct: 340 HEKIKKGKVDYP--SHLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 190/346 (54%), Gaps = 31/346 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFN---TKPNSNETSMVA 71
           ++G W   ET+G GS GKV+LA +  T++  AIKI+   +K++ +    +P       V 
Sbjct: 180 SLGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVL 239

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 240 ERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 299

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 300 IQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFN 359

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 360 PKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 417

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK---YPSIKDSK 302
            K++ G+ E P    +S +   L+S++L VDP+KR   ++++ H  +Q+   +P+     
Sbjct: 418 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRGYDFPA----- 470

Query: 303 SIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKL 348
                P    +  PL+ +   +DP+++Q +  L    +  + AA L
Sbjct: 471 -----PSYIPHRVPLTAD--ALDPTVIQEMYRLEFVDNTSEAAAWL 509

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 172/304 (56%), Gaps = 19/304 (6%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI-------FNTKPNSNETSMVA 71
           +G W   ET+G GS GKV+LA +  TN+  AIKI++++         N  P  +E  ++ 
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 166 RQ-KRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 224

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 225 IQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYD 284

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E  ++  L 
Sbjct: 285 PRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LH 342

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSI 304
            K++ G  E P  + +S +   L+S++L VDP +R   +++++HP + + Y  I  S   
Sbjct: 343 EKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPSYLP 400

Query: 305 KNLP 308
           K +P
Sbjct: 401 KRIP 404

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  189 bits (479), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFNTK-----PNSNETSM 69
           ++G W   ET+G GS GKV+LA +  TN+  AIKI+   +KS  + +     P + E  M
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELM 153

Query: 70  VANTPDSLPYGIEREII----IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                       +R  I    + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 154 ERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 213

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 214 IQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 273

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E D+WS GV+++ L+ G++PFD+E+ ++  L 
Sbjct: 274 NKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LH 331

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
            K++ G+ E P    +S +   L+S++L VDP KR   +++  H  +Q+
Sbjct: 332 EKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  189 bits (479), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 168/307 (54%), Gaps = 46/307 (14%)

Query: 11  IPTIKGD------TIGPWKLGETLGLGSTGKVQLAF-----NET-TNQQAAIKIISKSIF 58
           IP  KG+      T GP+ +G TLG G  GKV+L +     N+T   +Q AIK+I +   
Sbjct: 55  IPENKGNGRRKHITFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR--- 111

Query: 59  NTKPNSNETSMVANTPDSLPYGIEREIII------MKLLRHANVLSLYDVWETNSNLYMI 112
                           D++  G E+EI I      +K L H N++ L +V + +  + ++
Sbjct: 112 ----------------DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIV 155

Query: 113 LEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN 172
           LEYA  GE +  + +K  L E  A   F Q++ G+ Y H  G+VHRDLK ENLLLD   N
Sbjct: 156 LEYASGGEFYKYIQKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGN 215

Query: 173 IKIADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTG 230
           + I DFG         +L++TSCGSP YAAPE+V S  PY   ++D+WSCG+ILFA+L G
Sbjct: 216 LIITDFGFVNEFSKFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAG 275

Query: 231 RLPFDEE----DGN-IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTRE 285
            LP+D++    DGN I  L   + +   + P  + +S  A+DL+  IL   P KR   ++
Sbjct: 276 YLPWDDDPKNPDGNDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQ 333

Query: 286 ILKHPLL 292
           ILKH  L
Sbjct: 334 ILKHQWL 340

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  187 bits (476), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 160/288 (55%), Gaps = 25/288 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFN----ETTNQQAAIKIISKSIFNTKPNSNETSMVANT 73
           T GP+ +G TLG G  GKV+L ++    E  ++  AIK++ +   +T P  +E  +    
Sbjct: 61  TFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRR---DTIPKHSEKEV---- 113

Query: 74  PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPE 133
                  I REI  +K L H N++ L +V + +  + ++L+YA  GE +  + +K  L E
Sbjct: 114 ------KIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKE 167

Query: 134 KEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETS 193
             A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L++TS
Sbjct: 168 PPACRLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTS 227

Query: 194 CGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDE-----EDGNIRNLLLK 247
           CGSP YAAPE +V+  PY   ++DVWSCGVIL+A+L G LP+D+     E  +I  L   
Sbjct: 228 CGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHY 287

Query: 248 VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           +     + P  + +    +DL+ RIL  +P  R+   EI  H  L+ +
Sbjct: 288 ITKSALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  189 bits (479), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 163/284 (57%), Gaps = 16/284 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIF------NTKPNSNETSMVA 71
           ++G W   ET+G GS GKV+LA +  TN+  AIK+++++         T P       + 
Sbjct: 179 SLGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLPPPQTEQEIL 238

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
               +L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 239 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 298

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 299 IQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 358

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             + L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 359 TTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 416

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
            K++ G+ + P    +S +   L+S++L VDP KR   R++++H
Sbjct: 417 EKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  187 bits (475), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 162/288 (56%), Gaps = 25/288 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNET----TNQQAAIKIISKSIFNTKPNSNETSMVANT 73
           T GP+ +G TLG G  GKV+L +++      ++  AIK+I +   +T P ++E  +    
Sbjct: 41  TFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR---DTVPKNSEKEI---- 93

Query: 74  PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPE 133
                  I RE+  +KLL H N++ L +V + +  + ++L+YA  GE +  + +K  L E
Sbjct: 94  ------KIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKE 147

Query: 134 KEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETS 193
             A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L+ TS
Sbjct: 148 PPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMRTS 207

Query: 194 CGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLK 247
           CGSP YAAPE +VS  PY   ++DVWSCGVIL+A+L G LP+D++  N     I  L   
Sbjct: 208 CGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQY 267

Query: 248 VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           +     + P  + +    +DL+ RIL  +P  R+   +I +H  LQ +
Sbjct: 268 ITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  185 bits (469), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 168/306 (54%), Gaps = 36/306 (11%)

Query: 3   TLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETT---------NQQAAIKII 53
           T++ NKK+         GP+ +G TLG G  GKV++ ++ T+         ++Q AIK+I
Sbjct: 24  TISRNKKS-----HMKFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLI 78

Query: 54  SKSIFNTKPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMIL 113
            +         +E  M           I REI  +K L H N++ L +V + +  + ++L
Sbjct: 79  RRDFIK---KGSEKEM----------KIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVL 125

Query: 114 EYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNI 173
           EYA  GE +  +  K  L E  A R F Q+I G+SY H+ GIVHRDLK ENLLLD   N+
Sbjct: 126 EYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENL 185

Query: 174 KIADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGR 231
            I DFG       +++L++TSCGSP YAAPE+V +  PY   ++D+WSCG+IL+ +L G 
Sbjct: 186 IITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGY 245

Query: 232 LPFDEEDGN-----IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREI 286
           LP+D++  N     I  L   +     + P  + ++   +DL+  IL  +P +R+ +R I
Sbjct: 246 LPWDDDKQNPNGEDIVRLYHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHI 303

Query: 287 LKHPLL 292
            KH  L
Sbjct: 304 KKHEWL 309

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  183 bits (465), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 158/293 (53%), Gaps = 33/293 (11%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAF-----------NETTNQQAAIKIISKSIFNTKPNSNE 66
           T GP+ +G TLG G  GKV++ +           ++ T +Q AIK+I +     + +  E
Sbjct: 46  TFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTI-VRNSDKE 104

Query: 67  TSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLV 126
           T             I REI  +K L H N++ L ++ + +  + ++LEYA  GE +  + 
Sbjct: 105 TK------------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQ 152

Query: 127 EKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 185
            K  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 153 RKRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSN 212

Query: 186 EDKLLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN---- 240
           E+ L++TSCGSP YAAPE +VS   Y G + D+WSCGVIL+A+L G LP+D++  N    
Sbjct: 213 ENVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGD 272

Query: 241 -IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            I  L   + +   + P  D ++   +DL+ RIL  DP +R     I  H  L
Sbjct: 273 DISKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  186 bits (471), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 160/293 (54%), Gaps = 27/293 (9%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETTN-----QQAAIKIISKSIFNTKPNSNETSM 69
           K  T GP+ +G TLG G  GKV+L +++ ++     +Q AIK+I +       +      
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDADKE---- 94

Query: 70  VANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKG 129
                      I REI  +K L H N++ L +V + +  + ++LE+   GE +  +  K 
Sbjct: 95  ---------VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKR 145

Query: 130 PLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-K 188
            L E  A R F Q+I G++Y H  G+VHRDLK ENLL+D   N+ I DFG      ED +
Sbjct: 146 RLKESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNE 205

Query: 189 LLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IR 242
           L+ TSCGSP YAAPE +VS   Y   ++DVWSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIA 265

Query: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
            L   +     + P  + ++   +DL+ RIL  +P +R+  R I +H  L+ +
Sbjct: 266 RLYQYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 177/350 (50%), Gaps = 49/350 (14%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETTN-----QQAAIKIISKSIFNTKPNSNETSM 69
           K  T GP+ +G TLG G  GKV+L + +  +     +Q AIK+I +       +      
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKE---- 94

Query: 70  VANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKG 129
                      I REI  +K L H N++ L +V + +  + ++LE+   GE +  +  K 
Sbjct: 95  ---------VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKR 145

Query: 130 PLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-K 188
            L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ED +
Sbjct: 146 RLKESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNE 205

Query: 189 LLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IR 242
           L+ TSCGSP YAAPE +VS   Y   ++DVWSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIA 265

Query: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY------- 295
            L   +     + P  + ++   +DL+ RIL  +P +R+  R I +H  L+ +       
Sbjct: 266 RLYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPHHAFLSIQ 323

Query: 296 PSIKDSKSIKNLP---------REDTYLFPLS------DNNSVIDPSILQ 330
           P+  D +  K  P         R  TY  P S      D NS+I  S ++
Sbjct: 324 PNYWDEQLRKERPQLSTRGDVGRHTTYSSPTSPDPKSRDRNSLIIESTME 373

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  187 bits (475), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 162/284 (57%), Gaps = 16/284 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK----PNSNETSMVA 71
           ++G W   ET+G GS GKV+LA +  TN+  AIKI++++   F  K    P       + 
Sbjct: 141 SLGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIM 200

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
               +L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 201 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 260

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A RF R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L  
Sbjct: 261 IQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYD 320

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 321 NRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 378

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
            K++ G+ E      +S +   L+S++L VDP +R   ++++ H
Sbjct: 379 EKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  187 bits (474), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFN---TKPNSNETSMVA 71
           ++G W+  ET+G GS GKV+L  +  T +   IKI+   SK+  +   T P+    + + 
Sbjct: 102 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEIL 161

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 162 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 221

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 222 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 281

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 282 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 339

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
            K++ G+ + P    +S +A  L++R++ +DP KR   + ++ HP + +
Sbjct: 340 EKIKKGKVDYP--SHLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  186 bits (473), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 164/284 (57%), Gaps = 16/284 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK----PNSNETSMVA 71
           ++G W   ET+G GS GKV+LA +  T +  AIKI++++   F  K    P   +   + 
Sbjct: 74  SLGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRATNAFLHKEQSLPPPKKEEEIL 133

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 134 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 193

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 194 IQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNLFD 253

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
           + K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 254 KSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 311

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
            K++ G+ E P    +S +   L+S++L VDP +R   +++++H
Sbjct: 312 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  184 bits (466), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 160/293 (54%), Gaps = 27/293 (9%)

Query: 15  KGDTIGPWKLGETLGLGSTGKVQLAFNETTN-----QQAAIKIISKSIFNTKPNSNETSM 69
           K  T GP+ +G TLG G  GKV+L + + ++     +Q AIK+I +       +      
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKE---- 94

Query: 70  VANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKG 129
                      I REI  +K L H N++ L +V + +  + ++LE+   GE +  +  K 
Sbjct: 95  ---------IKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKR 145

Query: 130 PLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-K 188
            L E  A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG      ED +
Sbjct: 146 RLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNE 205

Query: 189 LLETSCGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN-----IR 242
           L++TSCGSP YAAPE +VS   Y   ++DVWSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIA 265

Query: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
            L   +     + P  + ++   +DL+ RIL  +P +RI  + I +H  L+ +
Sbjct: 266 RLYKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  184 bits (467), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 154/279 (55%), Gaps = 24/279 (8%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           IG +K+ + +G GS GKV LA +  T+Q+  +K  +K                N P+   
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNK----------------NDPN--- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +     ++  LY+V  T S ++M LEY    EL+  L+ +  +  +E+ +
Sbjct: 75  --VVREVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGK 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  
Sbjct: 133 LFAQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ D+WS GVIL+ ++ G +PFDEED       +  +   +   +D
Sbjct: 193 YMAPELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---ND 249

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPS 297
           D +S+DA+DLIS++L  DP++R +  ++L HP LQ Y S
Sbjct: 250 DVVSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  185 bits (469), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFNTK---PNSNETSMVA 71
           ++G W+  ET+G GS GKV+L  +  T +   IKI+   SK+  + +   P+    S + 
Sbjct: 95  SLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEIL 154

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 155 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 214

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 215 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 274

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 275 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 332

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
            K++ G+ + P    +S +   L++R++ VDP +R   + +++HP + +
Sbjct: 333 EKIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  184 bits (467), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 165/302 (54%), Gaps = 34/302 (11%)

Query: 8   KKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQ-------QAAIKIISKSIFNT 60
           KK +P       GP+ L  TLG G  GKV+L +++ + Q       Q AIK+I +S    
Sbjct: 76  KKYVP------FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSILP 129

Query: 61  KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120
           K ++ E              + REI  +K L H N++ L DV + +  + ++LEYA  GE
Sbjct: 130 KGSNKEIK------------VYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGE 177

Query: 121 LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180
            +  +  K  L E  A + F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG 
Sbjct: 178 FYKYIQRKKRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGF 237

Query: 181 A-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEE- 237
                  ++L+ T CGSP YAAPE+V S  PY   ++D+WSCG+IL+A+L G LP+D++ 
Sbjct: 238 VNEFFQTNELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDI 297

Query: 238 ---DGN-IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
              DGN I  L   + +   + P  + +    +DL+ +IL  +  KRI  R I+ H  L+
Sbjct: 298 KNPDGNDIARLYYYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLK 355

Query: 294 KY 295
            +
Sbjct: 356 PH 357

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  183 bits (465), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 161/292 (55%), Gaps = 22/292 (7%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPD-- 75
           ++  W   ET+G GS GKV+LA N+ +N+  AIKI+ ++   TK   ++   +    D  
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRA---TKAYMHKAQQLPPPADEN 119

Query: 76  -------------SLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELF 122
                        S      RE  + ++L H NV  LY++   +++ YM  E+   G+L 
Sbjct: 120 EAKERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLL 179

Query: 123 NLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 182
           + +++ G L E  A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ 
Sbjct: 180 DYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSN 239

Query: 183 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIR 242
           +    K L+T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E  N  
Sbjct: 240 MYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSS 297

Query: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
            L  K++ G+   P    +S D   L+S+IL VDP KR   ++++ H  + K
Sbjct: 298 ALHEKIKKGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  183 bits (465), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/369 (30%), Positives = 192/369 (52%), Gaps = 33/369 (8%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ E +G GS GKV LA +  T+++  IK                S V N P+   
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK----------------SSVKNDPN--- 83

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +   +  +  LY++  T S ++M LEY    EL++ +++   +P +E ++
Sbjct: 84  --IVREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQ 141

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  
Sbjct: 142 LFSQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTV 201

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE+    PY GF+ D+WS GVIL+ +L+G +PFDE+D       +  +  ++   + 
Sbjct: 202 YMAPELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NS 258

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLS 318
             M+ + +DL+ ++L  D   R   REIL+H  LQ Y +   +++   + R+       +
Sbjct: 259 KFMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGTTVLTQTDNLIARQRK---GAT 315

Query: 319 DNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQE 378
           + +S ++  +L+ L     G D + I   + +   ++   ++ LL    +E E    K++
Sbjct: 316 NFHSKLERRVLKRLNRC--GFDTQSIKQSVIKKKCDSLAGLWCLL----LEKEKKYQKRK 369

Query: 379 QVKRKQSII 387
           Q++R +SI+
Sbjct: 370 QLRRSKSIL 378

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  183 bits (465), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 162/285 (56%), Gaps = 18/285 (6%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTK-----PNSNETSMV 70
            +G W   ET+G GS GKV++A +  TN+  AIKII+++   F  K     P  NE   +
Sbjct: 136 ALGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEAL 195

Query: 71  ANTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124
                 L   I R      E  + + L H ++  L+++   +++ YM+ EY   G+L + 
Sbjct: 196 ERQ-KKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 254

Query: 125 LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184
           +++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ + 
Sbjct: 255 IIQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMF 314

Query: 185 TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244
                L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L
Sbjct: 315 DPRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--L 372

Query: 245 LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
             K++ G+ + P    +S +   L+S++L VDP KR   +++++H
Sbjct: 373 HEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  182 bits (462), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 164/288 (56%), Gaps = 25/288 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQA---AIKIISKSIFNTKPNSNETSMVANTP 74
           T GP+ +G TLG G  GKV+L ++++ + ++   AIK+I +   +T P ++E  +     
Sbjct: 52  TFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRR---DTIPKNSEKEV----- 103

Query: 75  DSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEK 134
                 I REI  +K L H N+++L +V + +  + ++L YA  GE +  + +K  L E 
Sbjct: 104 -----KIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEP 158

Query: 135 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLETS 193
            A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      + + L++TS
Sbjct: 159 AACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTS 218

Query: 194 CGSPHYAAPE-IVSGIPYHGFESDVWSCGVILFALLTGRL-----PFDEEDGNIRNLLLK 247
           CGSP YAAPE +V+   Y   ++DVWSCGVIL+A+L G L     P + +  +I  L   
Sbjct: 219 CGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNY 278

Query: 248 VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           +     + P  + ++   +D++ RIL  DP+KRI    ILKH  LQ +
Sbjct: 279 ITKTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  183 bits (464), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII---SKSIFNTK---PNSNETSMVA 71
           ++G W+  ET+G GS GKV+L  +  T +   IKI+   SK+  + +   P+    + V 
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVL 162

Query: 72  NTPDSLPYGIER------EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLL 125
                L   I R      E  + ++L H ++  L+++   +++ YM+ EY   G+L + +
Sbjct: 163 ERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 222

Query: 126 VEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 185
           ++ G L E  A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 223 IQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 282

Query: 186 EDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLL 245
             K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 283 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 340

Query: 246 LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
            K++ G+ + P    +S +A  L+++++ VDP +R   + ++ HP + +
Sbjct: 341 EKIKKGKVDYP--SHLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  181 bits (459), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 193/373 (51%), Gaps = 41/373 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA ++ T+++  +K   K                N P+   
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK----------------NDPN--- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +   +  +  LY+V  T + ++M LEY    EL+  L+    +   E  R
Sbjct: 75  --VVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSR 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  I Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+  
Sbjct: 133 LFAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD- 257
           Y APE+     Y GF+ D+W+ GVIL+ ++ G +PFDE+D        K+ +   EMP+ 
Sbjct: 193 YMAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDEA--KTKWKIVN---EMPEI 247

Query: 258 -DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY--PSIKDSKSIKNLPREDTYL 314
            +D +S DA+DLI ++L  DP +R    +IL HP LQ Y  P ++ ++ I    R  +  
Sbjct: 248 NEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRRGSVH 307

Query: 315 FPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLS 374
           F     +S ++  +L+ L  +  G D + + A +++   +A   ++ LL    +E E   
Sbjct: 308 F-----HSKLERKLLKRLKQM--GFDTQSMKASVQKKKCDALSGLWLLL----VERELAL 356

Query: 375 AKQEQVKRKQSII 387
            KQE+ +R +S++
Sbjct: 357 EKQERPRRSRSVL 369

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 189/373 (50%), Gaps = 41/373 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+ +  +K  +KS     PN               
Sbjct: 35  VGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKS----DPN--------------- 75

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +   +  +  LY+V  T S ++M  EY    +L++ ++    +P    + 
Sbjct: 76  --IVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIE 133

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 134 LFTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTV 193

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP-- 256
           Y APE++    Y GF+ D+WS GVIL+ +L G +PFDE+D        K+ +   EMP  
Sbjct: 194 YMAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET--KTEWKIMN---EMPVF 248

Query: 257 DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNL--PREDTYL 314
           +D  +S DA+DL+ ++L+ DP +R   +EIL HP LQ Y S+   K+ + L   R  T  
Sbjct: 249 NDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQRNGTIH 308

Query: 315 FPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLS 374
           F     +S ++  +L+NL     G D + +   +++  ++     + LL    ++ E   
Sbjct: 309 F-----HSKLERKLLKNLKRT--GFDTQAMKVSVQKRKSDLLSATWTLL----LQREKRH 357

Query: 375 AKQEQVKRKQSII 387
            K  Q KR +S++
Sbjct: 358 EKVNQPKRSRSLL 370

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  178 bits (451), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 149/279 (53%), Gaps = 24/279 (8%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+     K++ KS     PN               
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTH----TKVVLKSSDKNDPN--------------- 75

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +   +  +  LY+V  T + ++M LEY    EL++ ++    +P  E V+
Sbjct: 76  --IVREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQ 133

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+ G+ Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 134 LFAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTV 193

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ D+WS GVIL+ ++ G +PFDE+D       +  Q+ Q    ++
Sbjct: 194 YMAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NE 250

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPS 297
           + ++ DA+DLI R+L  +P  R    +ILKHP LQ + S
Sbjct: 251 NIVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  178 bits (451), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 159/290 (54%), Gaps = 28/290 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSI--FNTKPNSNETSMVANTPD 75
           ++G W    T+G GS GKV+LA +   +   A+KI++++   F  +  S      A  P 
Sbjct: 114 SLGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQS------APAPQ 167

Query: 76  SLPYGIEREIIIMK----------------LLRHANVLSLYDVWETNSNLYMILEYAEKG 119
           S     ERE ++ K                +L H N+  LY +   +++ YM+ EY   G
Sbjct: 168 SKADIKERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGG 227

Query: 120 ELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFG 179
           +L + +++ G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG
Sbjct: 228 QLLDYIIQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFG 287

Query: 180 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG 239
           ++ L      L T CGS ++AAPE++   PY G E D+WS GVIL+ L+ G++PFD+E+ 
Sbjct: 288 LSNLFDPRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENS 347

Query: 240 NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
           N   L  K++ G+   P    +S +   L++++LTV+P +R   +EI+ H
Sbjct: 348 NA--LHEKIKRGKVSYP--ATLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  176 bits (445), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 152/278 (54%), Gaps = 26/278 (9%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+Q+  +K+ SK                N P+   
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK----------------NDPN--- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +   ++++  LY+V  T + ++M LEY    EL+  L+ K  +P +E   
Sbjct: 75  --VVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSE 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE-MPD 257
           Y APE++   PY G++ D WS G+IL+ ++ G +PFDE D     +  K +   +    D
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD----EVKTKYKIVHYNPTYD 248

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           +D +  + ++LIS++L  DP +R    ++L+HP LQ Y
Sbjct: 249 NDYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  175 bits (444), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 192/383 (50%), Gaps = 34/383 (8%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +++ + +G GS GKV LA +  T+Q+  +K+ SK                N P+   
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK----------------NDPN--- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +   +  +  LY+V  T ++++M LEY    EL+  L+ K  +P  E   
Sbjct: 75  --VVREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSH 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++   PY G++ D WS G+IL+ ++ G +PFDEED +I+     V +  F   DD
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DD 249

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLS 318
           + +  + +DLI ++L  DP++R    ++L+HP +  + S    K+ K + R+        
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQSQGCKHF- 308

Query: 319 DNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQE 378
             +S ++  +L+ L     G D + I   + +   +A    + LL    +E E  S    
Sbjct: 309 --HSKLERRLLKKLK--QSGFDTQAIKQSVNKKKCDALAGTWQLL----LEKEKRSEILR 360

Query: 379 QVKRKQSIIK-KSTANVSTPPRK 400
             KR +S++  K     S P RK
Sbjct: 361 HPKRSRSVLSVKKVFEPSLPSRK 383

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  176 bits (446), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 152/292 (52%), Gaps = 24/292 (8%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA ++ T+++  +K   KS     PN               
Sbjct: 34  VGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS----DPN--------------- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +      +  LY+V  T + ++M LEY    EL+  L+    +P  E  +
Sbjct: 75  --LVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAK 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 133 LFAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ D+WS GVIL+ ++ G +PFDE+D       +      F   +D
Sbjct: 193 YMAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFND 249

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           + +S +A+DLI R+L   P++R    +IL HP LQ Y  I  S++ K + R+
Sbjct: 250 NFVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  175 bits (444), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 148/282 (52%), Gaps = 28/282 (9%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +++   +G GS GKV LA +  T+++  +K  +KS     PN               
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKS----DPN--------------- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +      +  LY++  T + ++M LEY    EL+  L+    +P  E  R
Sbjct: 75  --VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSR 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  
Sbjct: 133 LFAQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ DVWS GVIL+ LL G +PFDEE    +N   K+ +   EMP  
Sbjct: 193 YMAPELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSF 247

Query: 259 DE--MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
           D   +  DA DL+S++L  DP  R   +E+L+HP LQ Y ++
Sbjct: 248 DSTLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  174 bits (442), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 153/279 (54%), Gaps = 28/279 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA ++ T++    K++ KS   T PN               
Sbjct: 36  VGNYKILKQIGEGSFGKVYLALHKPTHK----KVVLKSSDKTDPN--------------- 76

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + REI   +      +  LY+V  T + ++M++EY    EL++ L+ K  +   E+ R
Sbjct: 77  --VVREIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESAR 134

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG     +++  LET CG+  
Sbjct: 135 IFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTV 194

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y G++ D+W+ G++L+ ++ G +PFDE+D   +   LK+ S     PD 
Sbjct: 195 YMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDP--KKTELKIISAS---PDY 249

Query: 259 DE--MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           D    + D+ DL++R+L+ DP+ R    +IL HP L  Y
Sbjct: 250 DNKYFNDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 147/279 (52%), Gaps = 28/279 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+++  +K  SK    T PN               
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSK----TDPN--------------- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +   H  +  LY++  T + ++M LEY    EL++ L+    +P  E  R
Sbjct: 75  --VVREVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSR 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+  
Sbjct: 133 LFAQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ D+WS GVIL+ L+ G +PFDEED   R     +     E PD 
Sbjct: 193 YMAPELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDY 247

Query: 259 DE--MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
           +E   + ++ +LI  +L  DP KR    EILKH  L+ Y
Sbjct: 248 NEKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  169 bits (429), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 157/292 (53%), Gaps = 24/292 (8%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           IG +K+ + +G GS GKV LA +  T+Q+  +K  +K      PN               
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK----RDPN--------------- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +      +  LY+V  T S ++M+LEY    EL+  L+++  L  +E+ +
Sbjct: 75  --VVREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKK 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 133 LFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ D+WS G+IL+ ++ G +PFDE+D +I+   LK+ + + +  + 
Sbjct: 193 YMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQ 249

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           + +S DA DLI  +L  +P +RI   ++L HP LQ +  +   K+ K L ++
Sbjct: 250 EWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVLLKQ 301

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 153/295 (51%), Gaps = 30/295 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+++  +K   K                N P+   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK----------------NDPN--- 78

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +      +  LY+V  T S ++M LEY    EL++ L+    +   E   
Sbjct: 79  --IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGE 136

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE---M 255
           Y APE++    Y GF+ D+WS GVIL+ L+TG LPFD++D       +  +  +++   +
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVI 256

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           PD      DA+DLISR+L  +P +R    ++L+HP LQ Y S+   ++ K L R+
Sbjct: 257 PD------DARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSVVLDQTQKILCRQ 305

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 152/295 (51%), Gaps = 30/295 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+++  +K   K                N P+   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK----------------NDPN--- 78

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +      +  LY+V  T S ++M LEY    EL++ L+    +   E   
Sbjct: 79  --IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGE 136

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE---M 255
           Y APE++    Y GF+ D WS GVIL+ L+TG LPFD++D       +  +  +++   +
Sbjct: 197 YMAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLI 256

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           PD      DA+DLISR+L  +P +R    ++L+HP LQ Y S+   ++ K L R+
Sbjct: 257 PD------DAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ 305

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  169 bits (428), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 148/282 (52%), Gaps = 28/282 (9%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +++ + +G GS GKV LA ++ T+Q+  +K  +KS     PN               
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS----DPN--------------- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +   +  +  LY+V  T + ++M LEY    EL++ L+ K  +P  E  R
Sbjct: 75  --VVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRR 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  
Sbjct: 133 LFAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD- 257
           Y APE++    Y G++ D WS G+IL+ +L G +PFDE+D  +R  L  +     E P  
Sbjct: 193 YMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGLKIMH----EEPAV 247

Query: 258 -DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
            D+  S  A+DLI R+L  +  +R    E+L+HP LQ Y ++
Sbjct: 248 LDEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  168 bits (426), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/295 (34%), Positives = 153/295 (51%), Gaps = 30/295 (10%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+++  +K   K                N P+   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK----------------NDPN--- 78

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +      +  LY+V  T S ++M LEY    EL++ L+    L   E   
Sbjct: 79  --IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGE 136

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE---M 255
           Y APE++    Y GF+ D+WS GVIL+ L+TG LPFD++D       +  +  +++   +
Sbjct: 197 YMAPELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKFI 256

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           PD      DA+DLISR+L  +P +R    ++L+HP LQ Y S+   ++ K L R+
Sbjct: 257 PD------DAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ 305

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  168 bits (425), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 151/294 (51%), Gaps = 28/294 (9%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA +  T+++  +K   K                N P+   
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDK----------------NDPN--- 78

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +      +  LY+V  T + ++M LEY    EL++ L+    +   E   
Sbjct: 79  --IVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAE 136

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y APE++    Y GF+ D+WS GVIL+ L+TG LPFD++D  ++     V     E P+ 
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNY 251

Query: 259 DE--MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310
           D   +  DA+DLISR+L  +P +R    ++L H  LQ Y S+   ++ K L R+
Sbjct: 252 DSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  160 bits (406), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 152/275 (55%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A   TT +  A+KI+ K     K N+ +  M+ +           
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKAL--KGNNVQLQMLYD----------- 100

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N+++  D +E+    Y++ + A  GELF+ +++KG   E +AV    Q+
Sbjct: 101 ELAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQL 160

Query: 144 IIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSPHY 199
           I  +SY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++ D L+    GS  Y
Sbjct: 161 ISAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGY 220

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL+G   F  E  +G +          +F  P 
Sbjct: 221 VAPEVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPY 279

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S++A+D I R LT+DP  R    E+L+ P +
Sbjct: 280 WDNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 149/282 (52%), Gaps = 28/282 (9%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +K+ + +G GS GKV LA ++ T+Q+  +K   K      PN               
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEKK----DPN--------------- 74

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             + RE+   +      +  LY+V  T S ++M LEY    EL++ L++K  +P  E  +
Sbjct: 75  --VVREVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSK 132

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  
Sbjct: 133 LFAQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTV 192

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD- 257
           Y APE++    Y G++ D WS G+IL+ +L G +PFDEED  +    LK+ +   EMP  
Sbjct: 193 YMAPELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPI 247

Query: 258 -DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
            D   +  A+DLI ++L   P++R    ++L+HP LQ Y +I
Sbjct: 248 VDAYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/229 (37%), Positives = 140/229 (61%), Gaps = 7/229 (3%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K +RH N++   D +E ++N+Y++LE    G L +LL  +  L E E VRFF   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I+G + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 202 PEIVSGIPY-HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE+++G    H +E D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G F  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLP 308
           +S +A  LI  IL++DP +R    EI+ +   +  +PS  D+  + + P
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 140/229 (61%), Gaps = 7/229 (3%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K +RH N++   D +E ++N+Y++LE    G L +LL  +  L E E VRFF   
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQ 184

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I+G + Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 202 PEIVSGIPY-HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE+++G    H +E D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G +  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKC 302

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLP 308
           +S++A  LI  IL++DP +R    EI+ +   +  +P   D+  + + P
Sbjct: 303 ISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 131/207 (63%), Gaps = 6/207 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H N++   D +E ++N+Y++LE    G L +L+ ++  L E E VRFF   
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I G + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H FE D+WS GV+++ALL G+ PF  +D N+  +  ++++ Q+  P D  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 261 MSRDAQDLISRILTVDPTKRIKTREIL 287
           +S +A+ LI+ IL VDP +R   REI+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
            kinase of the bud neck involved in the septin checkpoint,
            associates with septin proteins, negatively regulates
            Swe1p by phosphorylation, shows structural homology to
            bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 159/495 (32%), Positives = 245/495 (49%), Gaps = 84/495 (16%)

Query: 659  VSAPL---ERENPEAIERDINDLFARR-NVSLQTRPKSRLDPGILYSAPAETVSNPLLSD 714
            VS+PL   E    E ++ DI+ L   R  +S  TRP SRLDPG+  +   ET+ N L   
Sbjct: 587  VSSPLINYEFSQQELLQ-DIDTLLTNRYQLSSYTRPISRLDPGL--TPVTETLPNNLKEK 643

Query: 715  IDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVADK 774
                 D EKKI+ETIRRS+FLGS  N+   L   K    +E +  E+   V++  ++   
Sbjct: 644  TALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGK----SELAPIEESPIVSTTPLI--- 696

Query: 775  AAIGVIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILK 834
                    ND     R+IS+++VP FTRKS+HF+ +N R SVLS+Y+ K S  +L + L 
Sbjct: 697  -------YND-RMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLI 747

Query: 835  EGGVNLASEANNTTTSKASTEPEFQFESVNEGTANKLYE---------------LQEEPE 879
            +   +L  + +    S+ S +PE   ES+ + + N  Y+               L + P+
Sbjct: 748  KEDPDLPPQGSTDNESR-SEDPEIA-ESITD-SRNIQYDEDDSKDGDNVNNDNILSDFPQ 804

Query: 880  YTDVNKEDGKPKKN---------------VKLPTLPPLHEKTNQANGLAIYQSSSDDDKK 924
               +++E     KN               VKLP+L     K   A+GL +YQ        
Sbjct: 805  GVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGK--NASGLGLYQR------- 855

Query: 925  PTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQATKKINXXXXXXXXXXXXXXXLNE 984
              EP   S+  +P    + NNS+  +       +   ++KI                 N+
Sbjct: 856  --EP---SKVTLPSL--TSNNSSVGENIEDGAEKGTESEKIAASLSDDDLKEDNDKKDND 908

Query: 985  ---MPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSK 1041
                P  V+K  N    +KFSK   +        + E++  +   +LY+GL +LL+GW +
Sbjct: 909  TVNAPTTVKKPPNSVLLKKFSKGKIL--------ELEIHAKIPEKRLYEGLHKLLEGWKQ 960

Query: 1042 YGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGK-QSVVGFNKISGSSKTVRR 1100
            YGLK++      M +TGKL ND+IL LRST+FE++V   G  +S++ FNK +GS+KT+ +
Sbjct: 961  YGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTK 1020

Query: 1101 LFVEIEKVLRQEGVL 1115
            L  EI+ +L++EGVL
Sbjct: 1021 LATEIQIILQKEGVL 1035

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 5/119 (4%)

Query: 472 SNGNSNSPTPSRS-KRISLINLDNSTAPPIPVNVLKDYXXXXXXXXXXXXXXXLTFLGNG 530
           SN   +SP P RS KRI+ IN+ ++     P  V   +               L+++ N 
Sbjct: 433 SNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHKRNSKKRSSKR----LSYMPNT 488

Query: 531 KRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589
           KR S+T+K LS +  L +DD+WEYIEK+ KRTSS+FATLIDEIFE EK+E  ++EK EL
Sbjct: 489 KRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAEL 547

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  162 bits (411), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 117/187 (62%), Gaps = 4/187 (2%)

Query: 108 NLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL 167
           + YM+ EY   G+L + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++
Sbjct: 7   HFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMI 66

Query: 168 DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFAL 227
                IKI DFG++ +    K L T CGS ++AAPE++   PY G E DVWS GV+LF L
Sbjct: 67  STSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVL 126

Query: 228 LTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287
           + G++PFD+E+ ++  L  K++ G+ E P    +S +   L+S++L VDPTKR   ++++
Sbjct: 127 VCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQVV 182

Query: 288 KHPLLQK 294
            H  +Q+
Sbjct: 183 NHQWMQR 189

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  156 bits (394), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 148/275 (53%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A    TN+  A+KI+ K     K N  +  M+ +           
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKAL--KGNDVQLQMLYD----------- 93

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I+++L+H N++   D +E+    Y++ + A  GELF+ ++ KG   E++AV    QI
Sbjct: 94  ELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQI 153

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+  D L+  + GS  Y
Sbjct: 154 LSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGY 213

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI++ LL G   F  E  DG +           F  P 
Sbjct: 214 VAPEVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPY 272

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S +A++ I R LT+DP +R    E++K P +
Sbjct: 273 WDNISDEAKNFILRALTLDPAERPTAAELMKDPWI 307

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  161 bits (407), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K +RH N++   D +E ++N+Y++LE    G L +LL ++  L E E VRFF   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I+G I Y H+  I+HRDLK  N+  D  FN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 202 PEIVSGIPY-HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE+++G    H FE DVWS GV+++ALL G+ PF  ++ N   +  +++   F  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKP 296

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKH 289
           +S +A+ LI  IL++DP +R    EI+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  155 bits (393), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           ++ G+T+G G+ G V+ A   +T ++ A+KII K     + N  +  M+ +         
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKAL--EGNDIQLQMLYD--------- 89

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ L+H N++     +E+   +Y++ + A  GELF+ ++++G   E +AV    
Sbjct: 90  --ELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVV 147

Query: 142 QIIIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMAA-LETEDKLLETSCGSP 197
           QI+  + Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE E  L+  + GS 
Sbjct: 148 QILKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSL 207

Query: 198 HYAAPEIV--SGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQF 253
            Y APE++  SG   HG   D+WS G+I + LL G  PF  E  DG +  ++   +   F
Sbjct: 208 GYVAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAF 264

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             P  DE+S +A+  I R +T+DP +R    E+LK P +
Sbjct: 265 HSPYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  155 bits (392), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 157/279 (56%), Gaps = 24/279 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           ++ G+TLG GS G V+ A  ++ N++ AIKI+ K     + N  +  M+ +         
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKAL--EGNQVQLQMLYD--------- 75

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I+K L H N++   + +ET+  +Y++ + A  GELF+ +++KG   E +AV+   
Sbjct: 76  --ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILI 133

Query: 142 QIIIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSP 197
           QI+  + Y H+  IVHRDLKPENLL L  K +  + IADFG+A  L+  ++L+  + GS 
Sbjct: 134 QILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSL 193

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG----QF 253
            Y APE+++ +  HG   D+WS GVI + LL+G   F  E   +   L +  SG    +F
Sbjct: 194 GYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKF 250

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             P  D +S DA++ I + L ++P KR    E+L  P +
Sbjct: 251 HKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  155 bits (392), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 153/277 (55%), Gaps = 24/277 (8%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A N  T +  A+KI+ K         N+  + A         +  
Sbjct: 39  FGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALK----GNKVQLEA---------LYD 85

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N+++  D +E+    Y+I + A+ GELF+ +++KG   E++AVR   +I
Sbjct: 86  ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEI 145

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++LL    GS  Y
Sbjct: 146 LSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGY 205

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +G+    F  
Sbjct: 206 VAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHR 262

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
           P  D +S  A+  I + L +DP+KR    E+L+ P +
Sbjct: 263 PYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/275 (34%), Positives = 151/275 (54%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A   +TN+  A+KI+ K     + NS +  M+ +           
Sbjct: 34  FGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKAL--EGNSVQLQMLYD----------- 80

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++   D +ET    +++ + A  GELF+ +V+KG   E++A++   QI
Sbjct: 81  ELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEEDAIKILVQI 140

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L++ D+L+  + GS  Y
Sbjct: 141 LGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIFKAAGSLGY 200

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL G   F  E  +G +       +   F  P 
Sbjct: 201 VAPEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQNDKPVVFHKPY 259

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S DA+  I R LT+DPTKR     +L+ P +
Sbjct: 260 WDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 147/277 (53%), Gaps = 24/277 (8%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G TLG GS G V+ A   +T +  A+KI+ K     K    +  M+ +           
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGK--DVQLQMLYD----------- 94

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++   D +E+    Y++ + A  GELF+ +++KG   EK+AVR   QI
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQI 154

Query: 144 IIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPENLL L  K +  + + DFG+A  L  ED+L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGY 214

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+++    HG   D+WS GV+ + LL G  PF  E  ++   L +  SG+    F  
Sbjct: 215 VAPEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHK 271

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
           P    +S DA+D I + LTV P  R    E+L H  +
Sbjct: 272 PYWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H N++   D +E ++N+Y++LE    G L +LL ++  L E E VRFF   
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I+G I Y H+  I+HRDLK  N+  D  FN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 202 PEIVSGIPY-HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE+++G    H FE D+WS GV+++ALL G+ PF  ++ N   +  +++   F  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKP 296

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKH 289
           +S +A+ LI  IL++DP +R    EI+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 134/223 (60%), Gaps = 8/223 (3%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H N++   D +E ++N+Y++LE    G L +LL ++  L E E VRFF   
Sbjct: 142 EIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D K+N+KI DFG+AA    D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIA 260

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H +E D+WS GV+++AL+ GR PF  +D N   +  +++   F  P D  
Sbjct: 261 PEVLMGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKL 318

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY--PSIKDS 301
           +S +A+ LI  IL++DP +R    EI+ +   +    PS K+S
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKES 361

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  153 bits (387), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/275 (34%), Positives = 150/275 (54%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A   ++ +  A+KI+ K+    K N  +  M+ +           
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNAL--KGNDVQLQMLYD----------- 86

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N+++  D +E+    Y++ + A  GELF+ +++KG   E +AV    Q+
Sbjct: 87  ELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQL 146

Query: 144 IIGISYCHALGIVHRDLKPENLL-LD--HKFNIKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++ D L+    GS  Y
Sbjct: 147 LDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGY 206

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL+G  PF  E  +G +          QF  P 
Sbjct: 207 VAPEVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPY 265

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S +A+D I + LT+DP +R    E++  P +
Sbjct: 266 WDSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 159/294 (54%), Gaps = 22/294 (7%)

Query: 25  GETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIERE 84
           G  LG G   +    FN+ + +  A K ++K   + K       +++            E
Sbjct: 86  GHFLGEGGFARC-FQFNDDSGKIFAAKTVAK--LSIKSEKTRRKLLS------------E 130

Query: 85  IIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQII 144
           I I K +++ N++   D +E ++N+Y++LE    G L +LL ++  L E E VRFF   I
Sbjct: 131 IQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQI 189

Query: 145 IG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 202
            G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 190 CGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 249

Query: 203 EIVSGIPY-HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEM 261
           E++ G    H +E D+WS GV+L+ALL G+ PF  +D N   +  +++   F  P D  +
Sbjct: 250 EVLMGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKYI 307

Query: 262 SRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLPREDTYL 314
           S +A+ LI  +L++DP +R    EI+ +   +  +P   +S  + N+P  D  L
Sbjct: 308 SPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 126/208 (60%), Gaps = 4/208 (1%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K + H N++   D +E N N+Y++LE    G L  L+ ++  + E E   F  QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 202
             GI Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAP 247

Query: 203 EIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEM 261
           E++ G    H +E D+WS GV+L+ALL G+ PF  +D N   +  +++   F  P D ++
Sbjct: 248 EVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKI 305

Query: 262 SRDAQDLISRILTVDPTKRIKTREILKH 289
           S+DA+ LI  IL+++P +R   +EI+ +
Sbjct: 306 SQDAKYLIDDILSLNPMERPSIQEIMDY 333

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +  G+TLG GS G V+ A   +T +  A+KI+ K     K N  +  M+ +         
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKAL--KGNCVQIEMLYD--------- 86

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ L H N++     +E+    Y+  + A  GELF+ ++ +G   E +AVR   
Sbjct: 87  --ELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIV 144

Query: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSP 197
           Q++ GI Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++ D L+  + GS 
Sbjct: 145 QLLQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSL 204

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG----QF 253
            Y APE+++ +  HG   D+WS GVI + LL G  PF  E  ++   L +  SG    +F
Sbjct: 205 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKF 261

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             P  D +S +A++ I R L ++P+KR    E+L+ P +
Sbjct: 262 HRPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 148/272 (54%), Gaps = 24/272 (8%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG GS G V+ A   +T    A+KI+ K     K N  +  M+ +           
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKAL--KGNDVQLQMLYD----------- 94

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E++I++ L H N++   D +E+    Y++ + A  GELF+ +++KG   E +AV+   QI
Sbjct: 95  ELMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQI 154

Query: 144 IIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ +  L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGY 214

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+++    HG   D+WS GVI + LL G  PF  E  ++   L +  SGQ    F  
Sbjct: 215 VAPEVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHK 271

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287
           P  + +S++A+  I R+LT+ P KR    ++L
Sbjct: 272 PYWNNISKEAKLFILRVLTISPKKRPTATDLL 303

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 129/218 (59%), Gaps = 5/218 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K +RH NV+   D +E ++N+Y++LE    G L  LL ++  + E E   F  QI
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQI 197

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 202
              I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 198 CGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 257

Query: 203 EIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEM 261
           E++ G    H +E D+WS GV+++ALL G+ PF  +D N+  +  ++++  F  P D  +
Sbjct: 258 EVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYI 315

Query: 262 SRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSI 298
           S +A+ LI  IL+ DP +R    EI+ +   +  +PS 
Sbjct: 316 SNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSC 353

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  153 bits (387), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 147/272 (54%), Gaps = 26/272 (9%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A N   NQ  AIKI+ K         NE  M+ +           
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALK----GNELQMLYD----------- 102

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++   D +E+    Y++ + A  GELF+ +++KG   E +AV+   Q+
Sbjct: 103 ELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQM 162

Query: 144 IIGISYCHALGIVHRDLKPENLL-LD--HKFNIKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS  Y
Sbjct: 163 LTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGY 222

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+++    HG   D+WS GVI + LL G  PF  E  +    L +V SG     F  
Sbjct: 223 VAPEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAE--STEGFLEEVFSGSDPVTFHS 279

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287
           P  + +S++A+  I R LT+ P +R    E+L
Sbjct: 280 PYWNNISKEAKQFILRALTLTPARRPTAAELL 311

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  158 bits (399), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 89/255 (34%), Positives = 145/255 (56%), Gaps = 7/255 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR-Q 142
           EI I K ++H N++   D +E + N+Y++L     G L  LL ++  L E E VRFF  Q
Sbjct: 189 EIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQ 247

Query: 143 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 248 ICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 307

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H +E D+WS GV++FALL G+ PF  +D N   +  ++++ ++  P +  
Sbjct: 308 PEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKS 365

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQ-KYPSIKDSKSIKNLPREDTYLFPLSD 319
           +S++A+ LI  IL  DP  R    EI+++   +  +PS+  +     +P  D +L P   
Sbjct: 366 ISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTPNES 425

Query: 320 NNSVIDPSILQNLVV 334
            N+  +  I   L++
Sbjct: 426 LNNFRNCMIQSGLIL 440

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  157 bits (397), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 138/235 (58%), Gaps = 7/235 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H NV+   D +E ++N+Y++LE    G L +LL ++  L E E VRFF   
Sbjct: 129 EIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQ 187

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 247

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H +E D+WS GV+L+ALL G+ PF  +D N   +  +++   F  P +  
Sbjct: 248 PEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKH 305

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLPREDTYL 314
           +S +A+ LI  +L++DP +R    EI+ +   +  +P   +S  +  +P  D  L
Sbjct: 306 ISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  157 bits (397), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 135/229 (58%), Gaps = 7/229 (3%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR-Q 142
           EI I K +RHAN++   D +E  +N+Y++LE    G L  LL ++  L E E VRFF  Q
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQ 206

Query: 143 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I  GI Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 207 ICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 266

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H +E D+WS GV+++ALL G+ PF  +D N   +  +++   F  P +  
Sbjct: 267 PEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKY 324

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLP 308
           +S +A+ L+  +L++DP +R    E+L +   +  +P    S  +  +P
Sbjct: 325 ISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVP 373

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  152 bits (385), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 152/277 (54%), Gaps = 24/277 (8%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A N  T +  A+KI+ K         N+  + A         +  
Sbjct: 39  FGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALK----GNKIQLEA---------LYD 85

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N+++  D +E+N   Y+I + A+ GELF+ +++KG   E +AVR   +I
Sbjct: 86  ELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEI 145

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++++L+  + GS  Y
Sbjct: 146 LSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGY 205

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+++    HG   D+WS GVI + LL G   F  E   + + L +  +G+    F  
Sbjct: 206 VAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHR 262

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
           P  D +S  A+  I + L ++P KR    E+L+ P +
Sbjct: 263 PYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  152 bits (385), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 154/273 (56%), Gaps = 20/273 (7%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           ++ G+TLG GS G V+ A   ++N++ A+KI+ K     + N+ +  M+           
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQAL--RENAIQLRMLY---------- 78

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
            +E+ I+K L H N++   + +ET+  LY++ + A  GELF+ ++ +G   E +AV+   
Sbjct: 79  -QELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIV 137

Query: 142 QIIIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMAA-LETEDKLLETSCGSP 197
           QI+  + Y H+  IVHRDLKPENLL    +    + IADFG+A  L++ ++L+  + GS 
Sbjct: 138 QILSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSL 197

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEM 255
            Y APE+++ +  HG   D+WS GVI + LL G   F  E  +G +   +   Q  QF+ 
Sbjct: 198 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQK 256

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P  D +S+ A++ I + L + P +R    E+LK
Sbjct: 257 PYWDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  152 bits (384), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +  G+TLG G+ G V+ A N  T +  A+KI+ K         N+  + A         +
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALK----GNKIQLEA---------L 83

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ L H N+++  D +E+    Y+I + A+ GELF+ +++KG   E +AVR   
Sbjct: 84  YDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 197
           +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----F 253
            Y APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +G+    F
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRF 260

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             P  D +S  A+  I + L +DP+KR    ++L+ P +
Sbjct: 261 HRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/336 (30%), Positives = 177/336 (52%), Gaps = 23/336 (6%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K +RH N++   D +E + N+Y++LE    G L +LL  +  L E E VRFF   
Sbjct: 145 EIQIHKNMRHQNIVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILTEPE-VRFFTTQ 203

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 201
           I G + + H+  I+HRDLK  N+  D  FN+KI DFG+AA +  E++   T CG+P+Y A
Sbjct: 204 ICGALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKYTICGTPNYIA 263

Query: 202 PEIVSGIPY--HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDD 259
           PE++ G     H FE D+WS GV++FA++TG+ PF  ++  +  +  +++   +  P D 
Sbjct: 264 PEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKE--VSTIYDRIKHCNYSFPTDK 321

Query: 260 EMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ-KYPSIKDSKSIKNLPREDTYLFPLS 318
            +S+D + LI  IL+++P +R   +EIL +   +  +P       + ++P    Y   +S
Sbjct: 322 YVSKDVKKLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPIDVMNDIP---IYFMDIS 378

Query: 319 DNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQE 378
              S+I+    +N ++          +  L +   N E       Y++K+  +NLS+   
Sbjct: 379 PEESLIN---FRNCMIR---------SGLLVDEEENVEDDSPIQNYQYKLIKDNLSSITS 426

Query: 379 QVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRK 414
           ++  K+   +K   N  +P   K +   ++   S++
Sbjct: 427 KLFSKEQQQQKLLPNNLSPGHTKQKYKEITRKISKQ 462

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  155 bits (392), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 137/231 (59%), Gaps = 5/231 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H N++   D +E ++N+Y++LE    G L +LL ++  L E E   F  QI
Sbjct: 124 EIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQI 183

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 202
           +  I Y H   ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 184 VGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 243

Query: 203 EIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEM 261
           E+++G    H +E D+WS GV+++ALL G+ PF  ++ NI  +  +++SG +  P +   
Sbjct: 244 EVLAGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPT 301

Query: 262 SRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLPRED 311
           S++   LI  IL++DP +R    EI+ +   +  +P+  +   + ++P  D
Sbjct: 302 SKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 128/200 (64%), Gaps = 6/200 (3%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H+N++   D +E ++N+Y++LE    G L +LL ++  L E E VRFF   
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I G I Y H+  I+HRDLK  N+  D  +N+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H FE D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D  
Sbjct: 261 PEVLMGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKY 318

Query: 261 MSRDAQDLISRILTVDPTKR 280
           +S++A+ LI  IL+++P +R
Sbjct: 319 VSKEAEILIHDILSLNPLQR 338

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  149 bits (375), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 143/289 (49%), Gaps = 29/289 (10%)

Query: 14  IKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANT 73
           IK  T   + +G  LG G  GKV    ++ +    A+K++ K+                 
Sbjct: 105 IKSFTKDDFDIGLKLGKGKFGKVFCVRHKESGFICALKVMQKT----------------- 147

Query: 74  PDSLPYGIEREII----IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKG 129
            D L Y +ER+ I    I   L H N+  LY  +     +Y+I+EY   GEL+  L   G
Sbjct: 148 -DILQYKLERQFIREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHG 206

Query: 130 PLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKL 189
           P     A  +  QI   I Y H   I+HRD+KPEN+L+     +K+ DFG + +  +   
Sbjct: 207 PFENAVATNYVYQIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLR 266

Query: 190 LETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KV 248
             T CG+  Y +PEIV    Y     D+W+ G++ + LL G  PF+E   N ++L   ++
Sbjct: 267 RRTFCGTIDYLSPEIVDYKEY-DHNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERI 322

Query: 249 QSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPS 297
           + G    P   +++ +A+D I RIL ++P KR+  +EI+ HP + KY S
Sbjct: 323 RRGDIVFP--KQVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 135/241 (56%), Gaps = 13/241 (5%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K + H N++   D +E +SN+Y++LE    G L  LL  +  L E E VRFF   
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H FE D+WS GV+L+ALL G+ PF   D N   +  +++   F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY--PSI-----KDSKSIKNLPREDTY 313
           +S + + LI  IL++DP +R    EI+ +   +    PSI      ++ +  N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSL 365

Query: 314 L 314
           +
Sbjct: 366 I 366

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  155 bits (391), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 146/280 (52%), Gaps = 31/280 (11%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A    T +  A+KIISK              V    D    G+ RE+
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKR------------KVVGVMD----GVAREL 235

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            +++ L H  ++SL   +E   + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 236 EVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 295

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 296 AVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 204 IVSGIPYHGFES-------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-E 254
           ++SG      E        D+WS G +++ +LTG LPF    G+ +N L K + +G + E
Sbjct: 356 VISGKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHE 412

Query: 255 MP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
            P  D  +S DA+D I   L VDP  R+   + L+HP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  150 bits (378), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 151/279 (54%), Gaps = 24/279 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +  G+TLG G+ G V+ A N  T +  A+KI+ K         N+  + A         +
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALK----GNKIQLEA---------L 83

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ L H N+++  D +E+    Y+I + A+ GELF+ +++KG   E +AVR   
Sbjct: 84  YDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 197
           +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----F 253
            Y APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +G+    F
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRF 260

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             P  D +S  A+  I + L +DP +R    ++L  P +
Sbjct: 261 HRPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  149 bits (376), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 145/273 (53%), Gaps = 24/273 (8%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG GS G V+ A   ++ +  AIKI+ K     K    E  M+ +           
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGK--DVELQMLYD----------- 94

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++   D +E+    Y++ + A  GELF+ ++++G   E++AVR   QI
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQI 154

Query: 144 IIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMAA-LETEDKLLETSCGSPHY 199
           +  + Y H+  IVHRDLKPENLL         + + DFG+A  L+ +D+L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGY 214

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+V+    HG   D+WS GV+ + LL G  PF  E  ++   L +   G+    F  
Sbjct: 215 VAPEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTIGRTPVTFHK 271

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           P    +S +A+D I R LTV+P  R    E+L+
Sbjct: 272 PYWSNISNEAKDFILRALTVNPHDRPTATELLQ 304

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  154 bits (388), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 122/209 (58%), Gaps = 6/209 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K + H N++   D +E +SN+Y++LE    G L  LL  +  L E E VRFF   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H FE D+WS GV+L+ALL G+ PF   D N   +  +++   F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKH 289
           +S + + LI  IL++DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  154 bits (388), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 122/209 (58%), Gaps = 6/209 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K + H N++   D +E +SN+Y++LE    G L  LL  +  L E E VRFF   
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQ 187

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H FE D+WS GV+L+ALL G+ PF   D N   +  +++   F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKH 289
           +S + + LI  IL++DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  149 bits (376), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 154/287 (53%), Gaps = 24/287 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +  G+TLG G+ G V+ A   +T +  A+KI+ K     K N  +  ++ +         
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKAL--KGNDVQLQLLYD--------- 88

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ L H N++   D +E+    Y++ + A  GELF+ ++ KG   E +AV+   
Sbjct: 89  --ELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVT 146

Query: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 197
           QI+  + Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L++ D+L+  + GS 
Sbjct: 147 QILSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSL 206

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG----QF 253
            Y APE+++    HG   D+WS GV+ + LL+G  PF  E  ++   L +   G    +F
Sbjct: 207 GYVAPEVLT-TSGHGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKF 263

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300
             P  D +S DA++ I R L + P+KR    E+L+ P +    S K+
Sbjct: 264 HKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  150 bits (380), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/312 (31%), Positives = 155/312 (49%), Gaps = 42/312 (13%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           + LG+ LG G    V+ A N+TT +  A+KI     F+ + N ++               
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKI-----FHPQQNDDQKKNKQ---------F 238

Query: 82  EREIIIMKLLRHANVLSLYD-----VWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
             E  I+  + H N+++L D     + +T    Y++LE  + GELF+ +V+K  LP++E+
Sbjct: 239 REETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEES 298

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKIAD 177
              F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIAD
Sbjct: 299 KAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIAD 358

Query: 178 FGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE 237
           FG+A    E +   T CG+P Y APE++    Y   + D+WS GVIL+  L G  PF ++
Sbjct: 359 FGLAKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQ 417

Query: 238 DG--NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295
            G  +++  ++  +   F  P  DE+   A  LIS +L +DP  R        HP L   
Sbjct: 418 LGPPSLKEQIMSAKYA-FYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSV 476

Query: 296 PSIKDSKSIKNL 307
             +  S ++K L
Sbjct: 477 SHLDVSHNLKRL 488

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 146/285 (51%), Gaps = 35/285 (12%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A    T +  A+KII           N+  ++ N       G+ RE+
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKII-----------NKRKVMGNLD-----GVTREL 249

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            +++ L H ++++L   +E   N YM++E+   G+L + +   GP+ E       RQI+ 
Sbjct: 250 TVLQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILE 309

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     + T CG+  Y APE
Sbjct: 310 AVKYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPE 369

Query: 204 IVSG--------IP-----YHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250
           +V+G        +P     ++    D+WS G +++ +LTG LPF       + L  ++  
Sbjct: 370 VVNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGK 427

Query: 251 GQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
             + E+P  D  +S  A+D I  +L VDP  R+     L+HP +Q
Sbjct: 428 ASYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 122/209 (58%), Gaps = 6/209 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K + H N++   D +E +SN+Y++LE    G L  LL  +  L E E VRFF   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H FE D+WS GV+L+ALL G+ PF   D N   +  +++   F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKP 305

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKH 289
           +S + + LI  IL++DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 154/297 (51%), Gaps = 37/297 (12%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A    T +  A+KII           N+  +V N       G+ RE+
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKII-----------NKRKVVGNMD-----GVSREL 235

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            +++ L H  ++SL   +E  +N YM++E+   G+L + +   G + E+      RQI+ 
Sbjct: 236 EVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILE 295

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            I Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++    +++T CG+  Y APE
Sbjct: 296 AIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPE 355

Query: 204 IVSGIP-------------YHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQ 249
           ++ G                +    D+WS G ++F +LTG LPF    G+ +  L  +++
Sbjct: 356 VIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIR 412

Query: 250 SGQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSI 304
            G + E P  D  +S +A+D I  +L VD +KR+   + L HP +++  S  D+ S+
Sbjct: 413 KGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 138/236 (58%), Gaps = 7/236 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR-Q 142
           EI I K ++H N++   D +E ++N+Y++LE    G +  LL ++  L E E VRF   Q
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPE-VRFCMIQ 195

Query: 143 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           II  I Y H+  ++HRDLK  N+  D ++N+KI DFG+AA+   DK  + T CG+P+Y A
Sbjct: 196 IIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIA 255

Query: 202 PEIVSGIPY-HGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE+++G    H +E D+WS GV+L+ALL G+ PF  ++  +  +  +++   F  P D  
Sbjct: 256 PEVLTGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKP 313

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLPREDTYLF 315
           +S DA++LIS +L ++P  R    EI  +   +  +PS   S   K +P  D   F
Sbjct: 314 VSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFDHLSF 369

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 147/283 (51%), Gaps = 34/283 (12%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A   TT +  A+KII           N+  ++ N       G+ RE+
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKII-----------NKRKVMGNLD-----GVTREL 234

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            ++K L H  ++SL   +E N + YM++E+   G+L + +   G + E       RQI+ 
Sbjct: 235 EVLKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILE 294

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 295 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 354

Query: 204 IVSGIPYHGFES----------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGQ 252
           ++     +  E           D+WS G +++ +LTG LPF    G+ +  L K +  G 
Sbjct: 355 VIGSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGS 411

Query: 253 F-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
           + E P  D  +S +A+D I  +L VDP+ R+     L+HP ++
Sbjct: 412 YHEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/347 (29%), Positives = 173/347 (49%), Gaps = 47/347 (13%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLP 78
           +G +++ + +G GS GKV LA +  T+++  +K   K                N P+   
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKTSDK----------------NDPN--- 78

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
             I RE+   +   +  +  +Y++  T + ++M LEY    EL++ L+    +P  E   
Sbjct: 79  --IVREVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTE 136

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
            F QI+  + Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+  
Sbjct: 137 LFAQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTV 196

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD- 257
           Y APE++    Y GF+ D+W+ GVIL+ ++ G +PFDE+D  ++     V     E PD 
Sbjct: 197 YMAPELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD-EVKTKWKIVN----EDPDF 251

Query: 258 -DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFP 316
            ++  S D +DLI ++L  DPT+R   REILKH  L+ Y      K+ K + R+      
Sbjct: 252 TNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPYGFTILEKTDKIIQRQ------ 305

Query: 317 LSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363
                        +N  + +H + ++++  +LK SG + +   ++++
Sbjct: 306 -------------RNDSIHFHSKIEKRLLKRLKRSGFDTQSIKHSIM 339

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 146/280 (52%), Gaps = 31/280 (11%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A    T +  A+KII           N+  ++ N       G+ RE+
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKII-----------NKRKVMGNMD-----GVTREL 235

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            +++ L H  ++SL   +E   + Y+++E+   G+L + +   G + E       RQ++ 
Sbjct: 236 EVLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 295

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            + Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 296 AVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 355

Query: 204 IVSGIPYHGFES-------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-E 254
           ++SG      E        D+WS G +++ +LTG LPF    G+ +  L K + +G + E
Sbjct: 356 VISGKNSEEKEGNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHE 412

Query: 255 MP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
            P  D  +S DA+D I   L V+P  R+   + LKHP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (58%), Gaps = 7/229 (3%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I K ++H N++   D +E ++N+Y++LE    G L  LL ++  L E E VRFF   
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 144 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 201
           I G I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVCGTPNYIA 310

Query: 202 PEIVSG-IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           PE++ G    H +E DVWS GV+++ALL G+ PF  +D N   +  +++   F  P +  
Sbjct: 311 PEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKP 368

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK-YPSIKDSKSIKNLP 308
           +S +A+ L+  +L++DP +R    EI+ +   +  +P    S  +  +P
Sbjct: 369 ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVP 417

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 190/386 (49%), Gaps = 36/386 (9%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G TLG GS G V+ A   +TN+  AIKI+ K     + N+ +  M           +  
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKAL--QGNNIQLQM-----------LYE 95

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++S  D +E+    Y++ + A  GELF+ ++ +G   E +AV    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQI 155

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ ++ L+  + GS  Y
Sbjct: 156 LGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPY 274

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK--------YPSIKDSKSIKNLPR 309
            D +S DA+  I + L ++P  R    E+L  P +           P +K   S++   R
Sbjct: 275 WDNISVDAKRFILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLR 334

Query: 310 EDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL-YRFKI 368
           +   +  L  NN +     L+N+ +L  G D +    +   +G+  +    +L   RF+ 
Sbjct: 335 DAIEIVKL--NNRI---KRLRNMYLL--GDDGDNDIEENSPTGSCLDGITRSLHDLRFQP 387

Query: 369 EAENLSAKQEQVKRKQSIIKKSTANV 394
           + + +   +EQ+K K ++ K +   +
Sbjct: 388 QKKVVELSKEQMKLKSALTKDAFVQI 413

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/280 (31%), Positives = 147/280 (52%), Gaps = 19/280 (6%)

Query: 12  PTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVA 71
           P++  D    +   E LG G   +      +      A KI+SK    T           
Sbjct: 83  PSVIKDNSKKYFRRECLGEGGFARC-FHIKDDVGISFACKIVSKKSIKT----------- 130

Query: 72  NTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPL 131
              +   + +  EI I + LR+++++   D +E   N+Y++LE    G L +LL ++  L
Sbjct: 131 ---ERTKFKLLSEIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKIL 187

Query: 132 PEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLL 190
            E E      Q+   I+Y H+  I+HRDLK  N+  D  FNIKI DFG+AA L    +  
Sbjct: 188 TEAEVKFMTTQVCGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKK 247

Query: 191 ETSCGSPHYAAPEIV-SGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ 249
            T CG+P+Y APE++ S    H FE+D+WS G++++A++ G+ PF  +D  +  +  K++
Sbjct: 248 YTMCGTPNYIAPEVILSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKD--VTTIYEKIK 305

Query: 250 SGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
             Q+E P D  ++ D + LI  +L +DP++R +  +ILK+
Sbjct: 306 LCQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKY 345

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 90/295 (30%), Positives = 151/295 (51%), Gaps = 36/295 (12%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
           + E +G G+   V+ A   TT +  A+KIISK             ++ N       G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-----------KVIGNMD-----GVTR 243

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ +++ L H  ++ L   +E   + YM++E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 144 IIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 201
           +  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y A
Sbjct: 304 LEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 202 PEIVSG----IPYHGFES--------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-V 248
           PE++ G    +    +E         D+WS G +++ +LTG LPF    G+ ++ L K +
Sbjct: 364 PEVIRGKDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 249 QSGQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDS 301
             G + E P  D  +S +A+D I  +L VDP  R+   + L HP ++  P +  S
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  152 bits (385), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 149/290 (51%), Gaps = 36/290 (12%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
           + E +G G+   V+ A   TT +  A+KIISK             ++ N       G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-----------KVIGNMD-----GVTR 243

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ +++ L H  ++ L   +E   + YM++E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 144 IIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 201
           +  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y A
Sbjct: 304 LTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 202 PEIVSGIPYHG----FES--------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-V 248
           PE++ G         +E         D+WS G +++ +LTG LPF    G+ ++ L K +
Sbjct: 364 PEVIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 249 QSGQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYP 296
             G + E P  D  +S +A+D I  +L VDP+ R+   + L HP ++  P
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  147 bits (371), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 145/275 (52%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G TLG GS G V+ A   +TN+  AIKI+ K     + N+ +  M           +  
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKAL--QGNNVQLQM-----------LYE 95

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N+++  D +E+    Y++ + A  GELF+ ++ +G   E +AV    QI
Sbjct: 96  ELSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQI 155

Query: 144 IIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPY 274

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S DA+  I + L +DP  R    E+L  P +
Sbjct: 275 WDSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  152 bits (383), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 145/278 (52%), Gaps = 30/278 (10%)

Query: 28  LGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREIII 87
           +G G+   V+ A   +T +  A+KII K     K +                G++RE+ +
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD----------------GVKRELDV 241

Query: 88  MKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGI 147
           ++ L H  ++ L D +E N N YM++E+   G+L + +   G + E       RQ++  +
Sbjct: 242 LQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAV 301

Query: 148 SYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 205
            Y H  GI HRDLKP+N+++  D    IKI DFG+A ++ ++  L T CG+  Y APE++
Sbjct: 302 KYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVI 361

Query: 206 SGI--------PYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-EMP 256
            G           +    D+WS G +++ +LTG LPF  +  N   L  +++ G + E P
Sbjct: 362 DGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGP 419

Query: 257 -DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
             D  +S +A++ I  +L VDP +R+   + L+HP ++
Sbjct: 420 LKDYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  145 bits (367), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 148/277 (53%), Gaps = 28/277 (10%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS-IFNTKPNSNETSMVANTPDSLPYG 80
           +++  TLG GS G+V L  +    +  AIK++ K  I   K        + +T D     
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMK-------QIEHTND----- 140

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
            ER +  +KL+ H  ++ L+  ++ + NL+M+++Y E GELF+LL +    P   A  + 
Sbjct: 141 -ERRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 197

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            ++++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    +  T CG+P Y 
Sbjct: 198 AEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYI 255

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           APE+++  PY+    D WS GV+++ +L G  PF   D        K+  G+   P    
Sbjct: 256 APEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG-- 310

Query: 261 MSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
              D  DL++R++T D TKR+      +R++  HP  
Sbjct: 311 FHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  152 bits (383), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 148/290 (51%), Gaps = 36/290 (12%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
           + E +G G+   V+ A   TT +  A+KIISK             ++ N       G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-----------KVIGNMD-----GVTR 243

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ +++ L H  ++ L   +E   + YM++E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 144 IIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 201
           +  I Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y A
Sbjct: 304 LTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 202 PEIVSG----IPYHGFES--------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-V 248
           PE++ G    +    +E         D+WS G +++ +LTG LPF    G+ ++ L K +
Sbjct: 364 PEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 249 QSGQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYP 296
             G + E P  D  +S +A+D I  +L VDP  R    + L HP ++  P
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSP 470

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  145 bits (365), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 149/280 (53%), Gaps = 26/280 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K          +   + +T D  
Sbjct: 59  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QIVKMKQIEHTND-- 110

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++ ++NL+M+++Y E GELF+LL +    P   A 
Sbjct: 111 ----ERRM--LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAK 164

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A   T   +  T CG+P
Sbjct: 165 FYAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVT--TVTWTLCGTP 222

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS G++++ +L G  PF   D        K+  G+   P 
Sbjct: 223 DYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYP- 278

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
               + D  DL+S+++T D T+RI      T+EI  HP  
Sbjct: 279 -SFFNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  146 bits (368), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 147/275 (53%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G TLG GS G V+ A   +TN+  AIKI+ K     + N+ +  M           +  
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKAL--QGNNVQLQM-----------LYE 95

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++S  D +E+    Y++ + A  GELF+ ++ +G   E +AV    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQI 155

Query: 144 IIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F +P 
Sbjct: 216 VAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPY 274

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S DA+  I + L ++PT+R    E+L  P +
Sbjct: 275 WDNISIDAKRFILKALRLNPTERPTATELLDDPWI 309

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 144/265 (54%), Gaps = 24/265 (9%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A   ++ +  A+KI+ K     K  S +  M+ +           
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKAL--KGQSVQLQMLYD----------- 94

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++   D +E+    Y++ + A  GELF+ ++EKG   E +AV   +QI
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQI 154

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSPHY 199
           + G+ Y H   IVHRDLKPEN+L  +K +   + I DFG+A  L+ +++L+  + GS  Y
Sbjct: 155 LQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGY 214

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEM 255
            APE+++    HG   D+WS GVI + LL G  PF  E  +    + +  SGQ    F  
Sbjct: 215 VAPEVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESAD--GFIEECTSGQYPVVFHK 271

Query: 256 PDDDEMSRDAQDLISRILTVDPTKR 280
           P  + +S+ A++ I   LTV P +R
Sbjct: 272 PYWNNVSKTAKEFILWALTVSPKRR 296

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  146 bits (368), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 147/271 (54%), Gaps = 22/271 (8%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG G+ G V+ A N   ++  A+KI+ K         +E +M+ +           
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALK----GDELNMLYD----------- 100

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E++I++ L H +++   D +E+    Y++ + A  GELF+ +++KG   E +AV+   Q+
Sbjct: 101 ELMILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQM 160

Query: 144 IIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  I Y H+  +VHRDLKPEN+L         + I+DFG+A  L +ED L+  + GS  Y
Sbjct: 161 LEAIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGY 220

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL G  PF  E  +G +  +        F  P 
Sbjct: 221 VAPEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPY 279

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILK 288
            + +S +A++ I + LT+DP++R    E+L+
Sbjct: 280 WNSISVEAKEFILKALTLDPSERPTATELLQ 310

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 144/275 (52%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G TLG GS G V+ A   +TN+  AIKI+ K     + N+ +  M           +  
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKAL--QGNNVQLQM-----------LYE 95

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H N++S  D +E+    Y++ + A  GELF+ ++ +G   E +AV    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQI 155

Query: 144 IIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E+ L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGY 215

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPY 274

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D +S D +  I + L ++P  R    E+L  P +
Sbjct: 275 WDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 148/290 (51%), Gaps = 36/290 (12%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
           + E +G G+   V+ A   TT +  A+KIISK             ++ N       G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-----------KVIGNMD-----GVTR 243

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ +++ L H  ++ L   +E   + YM++E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 144 IIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 201
           +  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y A
Sbjct: 304 LAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 202 PEIVSG-----IPYHGFES-------DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-V 248
           PE++ G      P    E        D+WS G +++ +LTG LPF    G+ ++ L K +
Sbjct: 364 PEVIRGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 249 QSGQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYP 296
             G + E P  D  +S +A+D I  +L VDP  R+   + L HP ++  P
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score =  147 bits (371), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 167/315 (53%), Gaps = 39/315 (12%)

Query: 8   KKAIPTIKGDTIGPWKLGETLGLGSTGKVQ---LAFNETTNQQAAIKIISKSIFNTKPNS 64
           ++++P IK       +LG T+G GS G V+   L F+ +     A+K      F   P  
Sbjct: 5   QESLPVIKDV-----ELGGTIGEGSFGCVRSARLKFDSSV--VVAVK------FVHLPTC 51

Query: 65  NETSMVANTPDSLPYGIEREIIIM-KLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
            E+ +           + RE+++  K  +HANVL + D       L+++LE A+ G+LF+
Sbjct: 52  AESGLSQKD-------VSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFD 104

Query: 124 LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA- 182
            +     +    A  +F+Q+I  ++Y H +G+ HRD+KPEN+LLD K N+K+ADFG+A+ 
Sbjct: 105 KIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQ 164

Query: 183 LETEDKLLETSC---GSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFD---E 236
              +D  L  S    GSP Y APEI+S   Y+   +D+WS GV+LF LLTG +P+    +
Sbjct: 165 FRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAK 224

Query: 237 EDGNIRNLL---LKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
           ED N    +    KV  G +E  +  +M     +L+ +IL  DP KR+   ++  HP L 
Sbjct: 225 EDDNYEWFVNNEGKVSLGPWERVELRQM-----NLLRKILQPDPRKRVSLEKLRHHPWLT 279

Query: 294 KYPSIKDSKSIKNLP 308
               + +S+ + N P
Sbjct: 280 SRSKLANSEGLCNNP 294

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 144/279 (51%), Gaps = 21/279 (7%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G V+ A    +++  A+KI+ K                         I  E+ 
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEP--------------IYDELN 115

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
           I++ L H N++   D +ET S  Y++ + A  GELF+ ++  G   E++AV    QI+  
Sbjct: 116 IIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKA 175

Query: 147 ISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSPHYAAP 202
           + Y H+  I+HRDLKPENLL LD   +  I +ADFG+A  LE +D ++    GS  Y AP
Sbjct: 176 VEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAP 235

Query: 203 EIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDDDE 260
           E+ +    HG  SD+WS GVI + LL G  PF  E  DG +  +       +F+ P  D 
Sbjct: 236 EVFTS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDG 294

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIK 299
           +S  A++ I RIL +DP  R    E+L  P +Q   S++
Sbjct: 295 ISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 149/278 (53%), Gaps = 20/278 (7%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +  G+TLG GS G V+ A   +T++  A+KII K     K N  +  M+ +         
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKAL--KGNDVQLQMLYD--------- 95

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ L H N++   D +E+    Y++ + A  GELF+ ++++G   E +AV+   
Sbjct: 96  --ELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIII 153

Query: 142 QIIIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMAA-LETEDKLLETSCGSP 197
           Q++  I Y H+  IVHRDLKPEN+L         + IADFG+A  L+  D L+  + GS 
Sbjct: 154 QMLKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSL 213

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEM 255
            Y APE+++    HG   D+WS GVI + LL G   F  E  +G +      +   +F  
Sbjct: 214 GYVAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHE 272

Query: 256 PDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
           P  + +SR+A++ I + LT++P +R    E+L  P ++
Sbjct: 273 PYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  147 bits (371), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 151/283 (53%), Gaps = 18/283 (6%)

Query: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKII--SKSIFNTKPNSNETSMVANTPDS 76
           +G W    TLG G+ G V+LA +  + Q  A+KI    +S+   K N+     V  + + 
Sbjct: 52  LGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQSVILNKCNTQNIEDVKCSKE- 110

Query: 77  LPYGIE------REIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130
               I+      +E  + ++LRH ++   Y + E   + YM LEY +   L   +  +  
Sbjct: 111 FKTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRYHYYMFLEYIQGCTLLEYVSSQNA 170

Query: 131 --LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL-DHKFNIKIADFGMAALETED 187
             L E+ A  F  QI+  ++Y H+  IVHRDLK EN+++ +    IK+ DFG+     ++
Sbjct: 171 KKLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENIMVTNEDKTIKLIDFGLGCFYDQN 230

Query: 188 KLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 247
             L   CGS +YAAPE++    Y G E D+WS GV+L+ ++TG+LPF    G  +  L+K
Sbjct: 231 STLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVLYIMVTGKLPF---KGRSKGRLMK 287

Query: 248 -VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289
            + SGQ + P  + +S D   L+SRIL +D + R    +I+KH
Sbjct: 288 HILSGQVKFP--NFLSMDVISLLSRILEIDLSFRFSLSDIIKH 328

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 147/280 (52%), Gaps = 26/280 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K          +   V +T D  
Sbjct: 68  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QVVKMKQVEHTND-- 119

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++   N++M+++Y E GELF+LL +    P   A 
Sbjct: 120 ----ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAK 173

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P
Sbjct: 174 FYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTP 231

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS GV+++ +L G  PF   D        K+  G+   P 
Sbjct: 232 DYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP- 287

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
                 D  DL+S+++T D T+RI      +R+I  HP  
Sbjct: 288 -PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  144 bits (364), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 145/275 (52%), Gaps = 20/275 (7%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
            G+TLG GS G V+ A   +T +  A+KI+ K     + N     M+ +           
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKAL--QGNEVHLQMLYD----------- 86

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           E+ I++ L H ++++  D +E+    Y++ + A  GELF+ ++ +G   E +AV+   Q+
Sbjct: 87  ELSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQL 146

Query: 144 IIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMA-ALETEDKLLETSCGSPHY 199
           +  + Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+  D ++  + GS  Y
Sbjct: 147 LDAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGY 206

Query: 200 AAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPD 257
            APE+++ +  HG   D+WS GVI + LL+G   F  E  +G +           F  P 
Sbjct: 207 VAPEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPY 265

Query: 258 DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            D++S +A+  I   LT++P +R    ++L HP +
Sbjct: 266 WDKISDEAKKFILSALTIEPEERPTAEQLLSHPWI 300

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 120/211 (56%), Gaps = 5/211 (2%)

Query: 84  EIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQI 143
           EI I   L H N+  LY  +  +  +Y+I+EY   GEL+++L + GP  +  A  F  Q+
Sbjct: 174 EIEIQSNLNHENLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQL 233

Query: 144 IIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
              I Y H   I+HRDLKPEN+L+D    IKI DFG +         +T CG+  Y +PE
Sbjct: 234 TNAIRYLHKKRIIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPE 293

Query: 204 IVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSR 263
           +++   Y G   DVW+ G+I + L+ G  PF+E+   +     ++++     P    +S+
Sbjct: 294 LINSKEYDGL-IDVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFP--AHVSQ 348

Query: 264 DAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           DA++LIS +L ++P++RI   ++LKHP + K
Sbjct: 349 DAKNLISSLLKLNPSERITLTDVLKHPWINK 379

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  143 bits (360), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 147/280 (52%), Gaps = 26/280 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K          +   V +T D  
Sbjct: 66  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QVVKMKQVEHTND-- 117

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++   N++M+++Y E GELF+LL +    P   A 
Sbjct: 118 ----ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAK 171

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P
Sbjct: 172 FYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTP 229

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS GV+++ +L G  PF   D        K+  G+   P 
Sbjct: 230 DYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP- 285

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
                 D  DL+S+++T D T+RI      +R+I  HP  
Sbjct: 286 -PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 147/280 (52%), Gaps = 26/280 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K          +   V +T D  
Sbjct: 67  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QVVKMKQVEHTND-- 118

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++   N++M+++Y E GELF+LL +    P   A 
Sbjct: 119 ----ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAK 172

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P
Sbjct: 173 FYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTP 230

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS GV+++ +L G  PF   D        K+  G+   P 
Sbjct: 231 DYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP- 286

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
                 D  DL+S+++T D T+RI      +R+I  HP  
Sbjct: 287 -PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  142 bits (358), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 137/255 (53%), Gaps = 21/255 (8%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  AIK++ K              + +T D      ER + 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKE------QVIRMKQIEHTND------ERRM- 94

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
            +KL+ H  ++ ++  ++ + NL+M+++Y E GELF+LL +    P   A  +  ++I+ 
Sbjct: 95  -LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 153

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++
Sbjct: 154 LEYLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIA 211

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS G+++F +L G  PF   D        K+  G+   P       D  
Sbjct: 212 TKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVV 266

Query: 267 DLISRILTVDPTKRI 281
           DL+S+++T D T+R+
Sbjct: 267 DLLSKLITADLTRRL 281

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 145/265 (54%), Gaps = 23/265 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS-IFNTKPNSNETSMVANTPDS 76
           T+  +++  TLG GS G+V L  +    +  AIK++ K  IF  K        + +T D 
Sbjct: 70  TLKDFQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMK-------QIEHTND- 121

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
                ER+I  +K++ H  ++ ++  ++ + NL+M+++Y E GELF+LL +    P   A
Sbjct: 122 -----ERKI--LKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 174

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 196
             +  ++I+ + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+
Sbjct: 175 KFYAAEVILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGT 232

Query: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256
           P Y APE+++  PY+    D WS G++++ +L G  PF   D        K+  G+   P
Sbjct: 233 PDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYP 289

Query: 257 DDDEMSRDAQDLISRILTVDPTKRI 281
                  D  DL++R++T D T+R+
Sbjct: 290 --SFFHPDVIDLLARLITADLTRRL 312

>TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494
           bp, 497 aa] {ON} Anc_2.352 YDL101C
          Length = 497

 Score =  145 bits (366), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 144/299 (48%), Gaps = 46/299 (15%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           + +G+ LG+G    V+   N+ T Q  AIKI    + + +  + +               
Sbjct: 181 YVVGKELGVGHYATVKEGINKKTEQIVAIKIFHPQLNDDQKKNKQ--------------F 226

Query: 82  EREIIIMKLLRHANVLSLYDVW-ETNS----NLYMILEYAEKGELFNLLVEKGPLPEKEA 136
           + E  I+  ++H+N++ L D + ET S      Y++LE  + GELF+ ++ K  L + E 
Sbjct: 227 KEETDILMRVKHSNIVKLLDSYVETVSKSQIQKYLVLEKIDDGELFDRILRKTSLRQDET 286

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKFNIKIAD 177
              F+QI+ G+ Y H + I+HRD+KPEN+LL                   +    +KIAD
Sbjct: 287 KALFKQILTGLQYLHGMNIIHRDIKPENILLNITKRSDPKELQKGPWDADEIDIQVKIAD 346

Query: 178 FGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE 237
           FG+A    E +   T CG+P Y APE++    Y   + D+WS GV+L+  L G  PF + 
Sbjct: 347 FGLAKFTGEMQFTNTLCGTPSYVAPEVLRKTDYSS-KVDMWSAGVLLYVCLCGFPPFSDT 405

Query: 238 DGNIRNLLLKVQSGQ----FEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            G      LK Q  Q    F  P  DE+      LIS +L V+PT R    + ++HP  
Sbjct: 406 LGPPS---LKEQIAQGIFAFYSPYWDEIDDSVLHLISHLLVVNPTNRYSVEDTIRHPWF 461

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  145 bits (366), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 150/309 (48%), Gaps = 42/309 (13%)

Query: 25  GETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIERE 84
           G+ LG G    V+ A N+ T Q AA+KI     F+ + N ++                 E
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKI-----FHPQQNDDQKKTKQ---------FRDE 237

Query: 85  IIIMKLLRHANVLSLYD-----VWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRF 139
             I+  ++H N++ L D     V +++   Y++LE    GELF+ +V K  L + E    
Sbjct: 238 TKILMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAI 297

Query: 140 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKIADFGM 180
           F+Q++ G+ Y H+  I+HRD+KPEN+LL  +                     +KIADFG+
Sbjct: 298 FKQLLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGL 357

Query: 181 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG- 239
           A    E K   T CG+P Y APE+++   Y   + D+WS GV+L+  L G  PF E+   
Sbjct: 358 AKFTGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSP 416

Query: 240 -NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
            +++  +L+ +   F  P  DE+   A  LIS +L V+P +R    + + HP        
Sbjct: 417 PSMKEQILQGKYA-FYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWFDGMRQD 475

Query: 299 KDSKSIKNL 307
             S S+K L
Sbjct: 476 SMSSSMKRL 484

>NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON}
           Anc_1.182
          Length = 409

 Score =  143 bits (360), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 145/265 (54%), Gaps = 23/265 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-SIFNTKPNSNETSMVANTPDS 76
           TI  + +  T G GS G+V L  +    +  A+K++ K ++   K        V +T D 
Sbjct: 95  TIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLK-------QVEHTND- 146

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
                ER ++ + +  HA ++ L+  ++ + +L+MI++Y E GELF+LL      P   A
Sbjct: 147 -----ERRMLSVSV--HAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVA 199

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 196
             +  ++ + + Y H+L I++RDLKPENLLLD   +IK+ DFG A    +  +  T CG+
Sbjct: 200 KFYAAEVCLALDYLHSLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYVPD--VTYTLCGT 257

Query: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256
           P Y APE++S  PY+    D WS G++++ +L+G  PF   D +       + +   + P
Sbjct: 258 PDYIAPEVISAKPYNK-SVDWWSFGILIYEMLSGHTPF--YDSSTMKTYENILNAPLKFP 314

Query: 257 DDDEMSRDAQDLISRILTVDPTKRI 281
                + DAQDL+SR++T D T+R+
Sbjct: 315 --KYFTPDAQDLLSRLITRDLTERL 337

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  142 bits (359), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 148/280 (52%), Gaps = 26/280 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K+             + +T D  
Sbjct: 80  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKT------QVVRMKQIEHTND-- 131

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++   NL+M+++Y E GELF+LL +    P   A 
Sbjct: 132 ----ERRM--LKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVAK 185

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P
Sbjct: 186 FYAAEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-SVTWTLCGTP 243

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS G+++F +L G  PF   D        K+  G+   P 
Sbjct: 244 DYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP- 299

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
                 D  DL+S+++T D T+RI      +++I +HP  
Sbjct: 300 -PFFHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 144/273 (52%), Gaps = 26/273 (9%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  A+K++ K I            V +T D        E +
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVV------RLKQVEHTND--------ERL 137

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
           ++ ++ H  ++ ++  ++ +  ++MI++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS G++++ +L G  PF   D N      K+ + +   P     + D +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVK 310

Query: 267 DLISRILTVDPTKRI-----KTREILKHPLLQK 294
           DL+SR++T D ++R+      T ++  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 149/279 (53%), Gaps = 20/279 (7%)

Query: 20  GPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPY 79
           G +  G+TLG G+ G V+ A   +T++  A+KII K     K N  +  M+ +       
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKAL--KGNDIQLQMLYD------- 87

Query: 80  GIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRF 139
               E+ I++ L H N++   D +E+    Y++ + A  GELF+ ++ KG   E +AV+ 
Sbjct: 88  ----ELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKI 143

Query: 140 FRQIIIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCG 195
             QI+  I Y H+  +VHRDLKPEN+L     +   I IADFG+A  L+ ++ L+  + G
Sbjct: 144 VVQILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAG 203

Query: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQSGQF 253
           S  Y APE+++    HG   D+WS GVI + LL G   F  E  +G +          +F
Sbjct: 204 SLGYVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTRSKFPVKF 262

Query: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
             P  D +S +A++ I R LT++P +R    E+L+ P +
Sbjct: 263 HKPYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  141 bits (355), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 144/276 (52%), Gaps = 25/276 (9%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS---IFNTKPNSNETSMVANTPDSLP 78
           +++G  LG G  GKV    ++ +    A+K+++K     FN +                 
Sbjct: 118 FEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ--------------- 162

Query: 79  YGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR 138
              +REI I   L H N+  LY  +  + N+Y+++EY   GEL+ LL + GP+ +  A  
Sbjct: 163 --FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITASN 220

Query: 139 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 198
           +  Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +     ++  +T CG+  
Sbjct: 221 YVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTID 280

Query: 199 YAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDD 258
           Y +PE++S   Y     DVW+ G++ + L+ G  PF+E+         ++     + P +
Sbjct: 281 YLSPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFPPN 337

Query: 259 DEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
             +S +A+DLI+ +L V P++R   ++++ HP ++K
Sbjct: 338 --VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 143/273 (52%), Gaps = 26/273 (9%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  A+K++ K I            V +T D        E +
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVV------RLKQVEHTND--------ERL 137

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
           ++ ++ H  ++ ++  ++    ++MI++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS G++++ +L G  PF   D N      K+ + +   P     + D +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVK 310

Query: 267 DLISRILTVDPTKRI-----KTREILKHPLLQK 294
           DL+SR++T D ++R+      T ++  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 146/289 (50%), Gaps = 40/289 (13%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A   +T +  A+KIISK             M +N       G+ RE+
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISK----------RKVMGSNMD-----GVSREL 250

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            +++ L H  ++ L   +E + N YM++E+   G+L + +   G + E       RQI+ 
Sbjct: 251 EVLQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILE 310

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            I Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 311 AIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPE 370

Query: 204 IVSGI----------------PYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 247
           I+SG                  Y     D+WS G +++ +LTG LPF    G+ +  L K
Sbjct: 371 IISGKNDGELRENADANSERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQKQLYK 426

Query: 248 -VQSGQF-EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293
            +  G + E P  D  +S +A+D I  +L V P  R+   + L+HP ++
Sbjct: 427 QISRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  140 bits (354), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 146/280 (52%), Gaps = 26/280 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K          +   V +T D  
Sbjct: 69  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QIVKMKQVEHTND-- 120

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++   N++M+++Y E GELF+LL +    P   A 
Sbjct: 121 ----ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAK 174

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++I+ + Y H   I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P
Sbjct: 175 FYAAEVILALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTP 232

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS GV+++ +L G  PF   D        K+  G+   P 
Sbjct: 233 DYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP- 288

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
                 D  DL+S+++T D T+RI      +R+I  HP  
Sbjct: 289 -PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.336
           YBR274W
          Length = 534

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 167/320 (52%), Gaps = 34/320 (10%)

Query: 1   MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQ--AAIKIISKSIF 58
           M+T  E  + +P IK D I    +GET+G GS G V+ A  + +NQ    AIK I     
Sbjct: 1   MSTFCE--EDLPKIK-DVI----IGETIGQGSFGIVKSARIKDSNQNNIFAIKFIHL--- 50

Query: 59  NTKPNSNETSMVANTPDSLPYGIEREI-IIMKLLRHANVLSLYDVWETNSNLYMILEYAE 117
              P++N+  +           I RE+ I MK   H N+L   D   TN  L+M+LE A+
Sbjct: 51  ---PSANDKGITERE-------ISREVSIHMKCSNHPNILKFIDCNVTNKFLWMVLEMAD 100

Query: 118 KGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCH-ALGIVHRDLKPENLLLDHKFNIKIA 176
            G+LF+ +     +    A  +F+Q+I  + Y H   GI HRD+KPEN+LLD   N+K+A
Sbjct: 101 GGDLFDKIEPDYGVDSHIAQFYFQQLIRALDYLHNTCGIAHRDIKPENILLDKDGNLKLA 160

Query: 177 DFGMA-ALETEDKLLETSC---GSPHYAAPEIVS-GIPYHGFESDVWSCGVILFALLTGR 231
           DFG+A + + +D  +  S    GSP Y APEI++   PYH   +D+WS GV+LF LL G+
Sbjct: 161 DFGLASSFKRKDGTMRLSHDQRGSPPYMAPEILTLNSPYHANITDIWSVGVLLFVLLAGQ 220

Query: 232 LPFD---EEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288
           +P++    ED +  N  +K  +G        ++  D  +L+ +IL  DP+KR     +  
Sbjct: 221 VPWELPVNEDSD-YNAFIK-NNGNINAGPWSKIKLDQLNLLRKILHSDPSKRATLTTLKS 278

Query: 289 HPLLQKYPSIKDSKSIKNLP 308
           H    K     +SK +   P
Sbjct: 279 HRWFLKKNMYANSKGLCKDP 298

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 143/273 (52%), Gaps = 26/273 (9%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  A+K++ K I            V +T D        E +
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVV------RLKQVEHTND--------ERL 137

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
           ++ ++ H  ++ ++  ++    ++MI++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS G++++ +L G  PF   D N      K+ + +   P     + D +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVK 310

Query: 267 DLISRILTVDPTKRI-----KTREILKHPLLQK 294
           DL+SR++T D ++R+      T ++  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  139 bits (351), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 142/271 (52%), Gaps = 26/271 (9%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  AIK++ K+         +   + +T D      ER + 
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKA------QVVKMKQIEHTND------ERRM- 102

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
            +KL+ H  ++ ++  ++ + NL+M+++Y E GELF LL +    P   A  +  ++ + 
Sbjct: 103 -LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLA 161

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE+++
Sbjct: 162 LEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVIA 219

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS GV+++ +L G  PF   D        K+  G+   P     + D  
Sbjct: 220 TKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYP--QFFNSDVI 274

Query: 267 DLISRILTVDPTKRI-----KTREILKHPLL 292
           DL+S++LT D T+RI       ++I  HP  
Sbjct: 275 DLLSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa]
           {ON} YER129W (PAK1) - DNA polymerase alpha suppressing
           protein kinase [contig 211] FULL
          Length = 1127

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 160/315 (50%), Gaps = 53/315 (16%)

Query: 24  LGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIER 83
           +GE LG G  GKV+LA +  T Q  AIKI+ ++       SN  S   NT  S    I+R
Sbjct: 108 IGE-LGQGQHGKVKLARDLVTKQLVAIKIVDRN----GGKSNRFSFKKNTNGSDK--IKR 160

Query: 84  EIIIMKLLRHANVLSLYDVWE--TNSNLYMILEYAEKGEL-----FNLLVE-KGP--LPE 133
           EI IMK   H +V+ L +V +  T+  +Y++LEY  KGE+       L  E +GP  L  
Sbjct: 161 EIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQLETEARGPPLLTF 220

Query: 134 KEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM--------AALET 185
           + A   FR +++G+ Y H  GI+HRD+KP NLL+     +KI+DFG+        A   +
Sbjct: 221 QRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGVSFAASKSGAGYGS 280

Query: 186 EDKL-LETSCGSPHYAAPEIVSGIPY------------HG----FESDVWSCGVILFALL 228
            D+L L  + G+P + APEI  G               HG    +  D+W+ GV L  LL
Sbjct: 281 LDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYNIDIWAIGVTLHCLL 340

Query: 229 TGRLPFDEE------DGNI-RNLLLK----VQSGQFEMPDDDEMSRDAQDLISRILTVDP 277
            G LPF  E      D  I + L+LK    + S       + E    A+DL+ R+LT +P
Sbjct: 341 FGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYEAAKDLLGRLLTKNP 400

Query: 278 TKRIKTREILKHPLL 292
            KRIK  EI KHP +
Sbjct: 401 FKRIKIAEIKKHPFV 415

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  139 bits (349), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 84/255 (32%), Positives = 136/255 (53%), Gaps = 21/255 (8%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  AIK++ K              + +T D      ER + 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKE------QVIRMKQIEHTND------ERRM- 94

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
            +KL+ H  ++ ++  ++ + NL+M+++Y E GELF+LL +    P   A  +  ++I+ 
Sbjct: 95  -LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 153

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++
Sbjct: 154 LEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIA 211

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS G+++F +L G  PF   D        K+  G+   P       D  
Sbjct: 212 TKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVV 266

Query: 267 DLISRILTVDPTKRI 281
           DL+ +++T D T+R+
Sbjct: 267 DLLCKLITSDLTRRL 281

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  142 bits (359), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 147/297 (49%), Gaps = 42/297 (14%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           + LG+ LG G    V+ A N+ T QQ A+KI     F+ + N ++               
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQQNDDQKKNKQ---------F 245

Query: 82  EREIIIMKLLRHANVLSLYD-----VWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
             E  I+  ++H N+++L D     + ++    Y++LE  + GELF  +V K  L + E+
Sbjct: 246 REETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDES 305

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKFNIKIAD 177
              F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +KIAD
Sbjct: 306 KALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIAD 365

Query: 178 FGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEE 237
           FG+A    E +   T CG+P Y APE+++   Y   + D+WS GVIL+  L G  PF ++
Sbjct: 366 FGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQ 424

Query: 238 DG--NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            G  +++  +L+ +   F  P  D++      LIS +L ++P +R    E L HP  
Sbjct: 425 LGPPSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  141 bits (356), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 91/279 (32%), Positives = 147/279 (52%), Gaps = 24/279 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +  G TLG G+ G V+ A   +T Q  A+KI+ K     K N  +  M+ +         
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKAL--KGNDVQLQMLYD--------- 107

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
             E+ I++ LRH N++   D +E+    Y++ + A  GELF+ ++ KG   E++AV+   
Sbjct: 108 --ELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVV 165

Query: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 197
           Q++  + Y H+  IVHRDLKPEN+L     +   + IADFG+A  L   D+L+  + GS 
Sbjct: 166 QMLNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSL 225

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   L +V   ++ +  
Sbjct: 226 GYVAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKF 282

Query: 258 DDE----MSRDAQDLISRILTVDPTKRIKTREILKHPLL 292
            ++    +S +A+  I R L ++P  R    E+L  P +
Sbjct: 283 HEQYWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  139 bits (350), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 117/214 (54%), Gaps = 5/214 (2%)

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
             RE+ I   L+H N+  LY  +     +Y+++EY   GEL+  L   GP  +  A  F 
Sbjct: 168 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFV 227

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            Q+   ++Y H+  I+HRD+KPEN+LL  +  +K+ DFG +     +   +T CG+  Y 
Sbjct: 228 HQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYL 287

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           +PE++    Y   + DVW+ GV+ + LL G  PF+E+   +     ++       P  D+
Sbjct: 288 SPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQ 342

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +S  A+DLISR+L  DP  RI  +++ +HP ++K
Sbjct: 343 VSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  140 bits (353), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 146/274 (53%), Gaps = 20/274 (7%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +++G  LG G  GKV    ++ +   +A+K++ K             +V+   +      
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKK-----------EIVSYNAEK---QF 220

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELF-NLLVEKGPLPEKEAVRFF 140
           +RE+ +   L H N++ ++  ++    +Y+I+EY   GEL+ +L    GP  +  A  + 
Sbjct: 221 KREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNYI 280

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +     +   +T CG+  Y 
Sbjct: 281 YQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDYL 340

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           APE+V+   Y  +  D+W+ G++ + L+ G  PF+EE  ++     ++ +     P    
Sbjct: 341 APELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDLT--YKRIINVDLNFP--QT 395

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +S DA+DLI+R+L  DP+KR+   +++KHP + K
Sbjct: 396 VSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 143/273 (52%), Gaps = 26/273 (9%)

Query: 27  TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREII 86
           TLG GS G+V L  +    +  A+K++ K I            V +T D        E +
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVV------RLKQVEHTND--------ERL 134

Query: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146
           ++ ++ H  ++ ++  ++    ++MI++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 135 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 194

Query: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 206
           + Y H+  I++RDLKPEN+LLD   ++KI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 195 LEYLHSKDIIYRDLKPENILLDKNGHVKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 252

Query: 207 GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQ 266
             PY+    D WS G++++ +L G  PF   D N      K+ + +   P     + D +
Sbjct: 253 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNDDVK 307

Query: 267 DLISRILTVDPTKRI-----KTREILKHPLLQK 294
           DL+SR++T D ++R+      T ++  HP  ++
Sbjct: 308 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 340

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  138 bits (347), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 90/278 (32%), Positives = 146/278 (52%), Gaps = 26/278 (9%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77
           T+  +++  TLG GS G+V L  +    +  AIK++ K              + +T D  
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QVVRMKQIEHTND-- 91

Query: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137
               ER +  +KL+ H  ++ ++  ++ + NL+M+++Y E GELF+LL +    P   A 
Sbjct: 92  ----ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAK 145

Query: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 197
            +  ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG P
Sbjct: 146 FYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGPP 203

Query: 198 HYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD 257
            Y APE+++  PY+    D WS GV++F +L G  PF   D        K+  G+   P 
Sbjct: 204 DYIAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYP- 259

Query: 258 DDEMSRDAQDLISRILTVDPTKRI-----KTREILKHP 290
                 D  DL+ +++T D T+RI      +++I  HP
Sbjct: 260 -TFFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHP 296

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 119/214 (55%), Gaps = 5/214 (2%)

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
             RE+ I   L H N+  LY  +  +  +Y+I+EY   GEL+ LL   GP  +  A RF 
Sbjct: 199 FRREVEIQTSLNHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFV 258

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            QI   +++ H  GI+HRDLKPEN+L+     +K+ DFG + +  +    +T CG+  Y 
Sbjct: 259 YQIADALNHLHEKGIIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYL 318

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           +PE++    Y     DVW+ GV+ + L+ G  PF+E+   +     ++  G+   P    
Sbjct: 319 SPEMIRSREYDD-TVDVWALGVLTYELVAGDPPFEEDSKEL--TYKRILKGEIRFP--GT 373

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +S+D +DLISR+L  DP +RI  +E++ HP + +
Sbjct: 374 VSQDVRDLISRLLKNDPKERILLKEVMVHPWIMR 407

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 118/214 (55%), Gaps = 5/214 (2%)

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
             RE+ I   L H N+  LY  +  +  +Y+++EY   GEL+ LL  KGPL +  A  + 
Sbjct: 154 FRREVEIQSSLNHQNLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYV 213

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            Q+   + Y H   I+HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y 
Sbjct: 214 YQMADALDYMHQRNIIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYL 273

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           +PE+++   Y   + DVW+ GV+ F L+    PF+E+   + +   ++  G  + P  + 
Sbjct: 274 SPELIASKEYDD-KVDVWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NH 328

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +S DAQDLI+++L  +   RI  RE+ +HP + K
Sbjct: 329 ISSDAQDLITKLLRHNSKDRISLREVKQHPWITK 362

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/287 (30%), Positives = 147/287 (51%), Gaps = 33/287 (11%)

Query: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85
           E +G G+   V+ A    T +  A+KII           N+  ++ N       G+ RE+
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKII-----------NKRKVMGNVD-----GVTREL 264

Query: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIII 145
            +++ L H  ++SL   +E + + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 265 EVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 324

Query: 146 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 203
            + Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 325 AVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPE 384

Query: 204 IVSGIPYHG-------FES--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 253
           ++ G    G       + S  D+WS G +++ +LTG LPF    G+ +  L K + +G +
Sbjct: 385 VIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSY 441

Query: 254 -EMP-DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSI 298
            E P  D  +S +A+D I  +L ++P  R+     L+HP L    SI
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 373

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 145/277 (52%), Gaps = 28/277 (10%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS-IFNTKPNSNETSMVANTPDSLPYG 80
           +++  TLG GS G+V L  +    +  AIK++ K  I   K        + +T D     
Sbjct: 63  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIRMK-------QIEHTND----- 110

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
            ER +  +KL+ H  ++ ++  ++ + NL+M+++Y E GELF+LL +    P   A  + 
Sbjct: 111 -ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 167

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            ++ + + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y 
Sbjct: 168 AEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYI 225

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           APE+++  PY+    D WS G+++F +L G  PF   D        K+  G+   P    
Sbjct: 226 APEVITTKPYNK-SVDWWSLGILIFEMLAGYTPF--YDVTPVKTYEKILQGKVVYP--PF 280

Query: 261 MSRDAQDLISRILTVDPTKRIKT-----REILKHPLL 292
              D  DL+ R++T D T+R+       ++I  HP  
Sbjct: 281 FHPDVVDLLGRLITADLTRRLGNLQSGPQDIKSHPWF 317

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  137 bits (346), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 118/214 (55%), Gaps = 5/214 (2%)

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
           + REI I  +L H N+  LY  +     +Y+++EY  +GEL+ LL   GP  +  A  + 
Sbjct: 147 VRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYV 206

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            QI   + Y H   I+HRD+KPEN+L+     +K+ DFG + +  +    +T CG+  Y 
Sbjct: 207 YQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYL 266

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           +PEI++   Y     D+W+ GV+ + L+ G   F+EE   +     ++  G+ + P  + 
Sbjct: 267 SPEIITSKEY-DHTVDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGELKFP--EH 321

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           +    +DLI RIL ++P+KR+  +EI +HP + K
Sbjct: 322 LPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {ON}
           highly similar to uniprot|P06245 Saccharomyces
           cerevisiae YPL203W TPK2 Involved in nutrient control of
           cell growth and division cAMP-dependent protein kinase
           catalytic subunit
          Length = 362

 Score =  137 bits (346), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 151/298 (50%), Gaps = 31/298 (10%)

Query: 5   AENKKAIPTIKGDTIGPWKLGE-----TLGLGSTGKVQLAFNETTNQQAAIKIISKSIFN 59
           + +K  +P   G + G + L +     TLG GS G+V L  +    +  A+K++ K    
Sbjct: 30  SHHKSLLPQRSGISKGKYSLKDFQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQ--- 86

Query: 60  TKPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKG 119
                 +   + +T D      ER +  +KL+ H  ++ ++  ++   NL+M+++Y E G
Sbjct: 87  ---QVVKMKQIEHTND------ERHM--LKLVEHPFIIRMWGTFQDAKNLFMVIDYIEGG 135

Query: 120 ELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFG 179
           ELF+LL +    P   A  +  ++ + + Y H+  I++RDLKPENLLLD   +IKI DFG
Sbjct: 136 ELFSLLRKSHRFPNPVAKFYAAEVTLALDYLHSHNIIYRDLKPENLLLDRNGHIKITDFG 195

Query: 180 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG 239
            A  +    +  T CG+P Y APE+++  PY+    D WS GV++F +L G  PF   D 
Sbjct: 196 FA--KEVVTVTWTLCGTPDYIAPEVITTKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDA 250

Query: 240 NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
                  K+  G+   P       D  DL+S+++  D T+R+      +++I  HP  
Sbjct: 251 TAMKTYEKILQGKVNYP--PFFHPDVVDLLSKLIMADLTRRLGNLQSGSQDIKSHPWF 306

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  141 bits (355), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 156/320 (48%), Gaps = 45/320 (14%)

Query: 8   KKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNET 67
           KK I T        + LG+ LG G    V+ A N+ T QQ A+KI     F+ + N ++ 
Sbjct: 187 KKIIKTKPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQQNDDQK 241

Query: 68  SMVANTPDSLPYGIEREIIIMKLLRHANVLSLYD-----VWETNSNLYMILEYAEKGELF 122
                           E  I+  + H N+++L D     + ++    Y++LE  + GELF
Sbjct: 242 KNKQ---------FREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELF 292

Query: 123 NLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL--------------- 167
             +V K  L + E+   F+Q++ G+ Y H   I+HRD+KPEN+LL               
Sbjct: 293 ERIVRKTCLGQDESRALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGP 352

Query: 168 ----DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVI 223
               +    +KIADFG+A    E +   T CG+P Y APE+++   Y   + D+WS GVI
Sbjct: 353 WDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVI 411

Query: 224 LFALLTGRLPFDEEDG--NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRI 281
           L+  L G  PF ++ G  +++  +++ +   F  P  D++      LIS +L ++P +R 
Sbjct: 412 LYVCLCGFPPFSDQLGPPSLKEQIMQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERY 470

Query: 282 KTREILKHPL---LQKYPSI 298
              E + HP    L+K+ S+
Sbjct: 471 NIDEAMNHPWFKDLKKHNSV 490

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 156/299 (52%), Gaps = 36/299 (12%)

Query: 4   LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63
           L  N +  PT    ++  +++  TLG GS G+V L  +    +  A+KI+ K +      
Sbjct: 96  LQPNLQGKPTSGKYSLKDFQILRTLGTGSFGRVHLIRSNHNGRFYALKILKKRLIV---- 151

Query: 64  SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123
             +   V +T D        E +++ L+ H  ++ ++  ++ + +LYM+++Y E GELF+
Sbjct: 152 --KLKQVEHTND--------ERLMLSLVSHPFIVRMWGTFQDSVHLYMVMDYVEGGELFS 201

Query: 124 LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183
           LL +    P   A  +  ++ + + Y H+  I++RDLKPEN+LLD   +IK+ DFG A  
Sbjct: 202 LLRKSQRFPNPVAKFYAAEVCLSLEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKY 261

Query: 184 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDG---- 239
             +  +  T CG+P Y APE+VS  PY+    D WS G++++ +L G  PF + +     
Sbjct: 262 VPD--VTYTLCGTPDYIAPEVVSTKPYNK-SVDWWSFGILIYEMLAGHTPFYDSNTVKTY 318

Query: 240 -NIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRI-----KTREILKHPLL 292
            NI N  LK  +  F  P       D +DL+S+++T D + R+      + ++ +HP  
Sbjct: 319 ENILNAKLKFPA--FFHP-------DVRDLLSQLITKDLSNRLGNLQNGSEDVKRHPWF 368

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 140/260 (53%), Gaps = 21/260 (8%)

Query: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGI 81
           +++  TLG GS G+V L  +    +  A+K+I K+             + +T D      
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKKN------TVVRLKQIEHTND------ 145

Query: 82  EREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFR 141
           ER +  + ++ H  ++ ++  ++ +  ++MI++Y E GELF+LL      P   A  +  
Sbjct: 146 ERRM--LSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAA 203

Query: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 201
           ++ + + Y H+L I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y A
Sbjct: 204 EVCLALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIA 261

Query: 202 PEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEM 261
           PE+VS  PY+    D WS G++++ +L+GR PF   D +       + S     P    +
Sbjct: 262 PEVVSSKPYNK-SVDWWSFGILIYEMLSGRTPF--YDRSTIKTYENILSAPLTFP--SYL 316

Query: 262 SRDAQDLISRILTVDPTKRI 281
             D QDL++R++T D +KR+
Sbjct: 317 HEDVQDLLNRLITRDLSKRL 336

>Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {ON}
           YKL166C (TPK3) - cAMP-dependent protein kinase catalytic
           subunit [contig 108] FULL
          Length = 375

 Score =  137 bits (346), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 142/265 (53%), Gaps = 23/265 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISK-SIFNTKPNSNETSMVANTPDS 76
           T+  + +  TLG GS G+V L  +    +  A+K++ K +I   K        V +T D 
Sbjct: 61  TLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLK-------QVEHTND- 112

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
                ER +  + ++ H  ++ ++  ++   +++MI++Y E GELF+LL +    P   A
Sbjct: 113 -----ERRM--LSVVSHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVA 165

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 196
             +  ++ + + Y HA  I++RDLKPEN+LLD   ++KI DFG A    +  +  T CG+
Sbjct: 166 KFYAAEVCLALEYLHAQDIIYRDLKPENVLLDKNGHVKITDFGFAKFVPD--VTYTLCGT 223

Query: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256
           P Y APE+VS  PY+    D WS G+++F +L G  PF   D N       + + + + P
Sbjct: 224 PDYIAPEVVSTKPYNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFP 280

Query: 257 DDDEMSRDAQDLISRILTVDPTKRI 281
                  D QDL+S+++T D +KR+
Sbjct: 281 --PFFHSDVQDLLSQLITRDLSKRL 303

>TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.214
           YPL203W
          Length = 402

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 143/265 (53%), Gaps = 23/265 (8%)

Query: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS-IFNTKPNSNETSMVANTPDS 76
           T+  +++  TLG GS G+V L  +    +  AIK++ K  I   K        + +T D 
Sbjct: 88  TLQDFQILRTLGTGSFGRVHLVRSIHNRRYYAIKVLKKQQIIRMK-------QIEHTND- 139

Query: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136
                ER I  +K++ H  ++ ++  ++ + NL+M+++Y E GELF+LL +    P   A
Sbjct: 140 -----ERRI--LKMVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 192

Query: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 196
             +  ++I+ + Y H+ GI++RDLKPENLLLD   +IK+ DFG A  +    +  T CG+
Sbjct: 193 KFYAAEVILALDYLHSHGIIYRDLKPENLLLDRLGHIKMTDFGFA--KEISTVTWTLCGT 250

Query: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256
           P Y APE+V+  PY+    D WS G++++ +L G  PF   D        K+ +G+   P
Sbjct: 251 PDYIAPEVVASKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILNGKVNYP 307

Query: 257 DDDEMSRDAQDLISRILTVDPTKRI 281
                  +  DL+S ++T D T+R 
Sbjct: 308 --SFFHPNIVDLLSNLITADLTRRF 330

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 118/214 (55%), Gaps = 5/214 (2%)

Query: 81  IEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFF 140
             RE+ I   LRH N+  LY  +  +  +Y+++EY   GEL+  L   GP  +  A  + 
Sbjct: 185 FRREVEIQASLRHPNLTQLYGYFYDDKRVYLLMEYLVNGELYRHLRVNGPFNDILASYYV 244

Query: 141 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 200
            Q+   ++Y H   ++HRD+KPEN+L+  +  +K+ DFG + + T     +T CG+  Y 
Sbjct: 245 NQMADALNYMHDRNVLHRDIKPENILIGFQNTLKLTDFGWSVISTTGAKRKTLCGTLDYL 304

Query: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE 260
           +PE+V    Y   + DVW+ GV+ + LL G  PF+E    +    +  +  +F     D+
Sbjct: 305 SPELVKYREYDE-KVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFP----DQ 359

Query: 261 MSRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294
           MS DA+DLI R+L  DP+ RI  +++L HP + K
Sbjct: 360 MSIDARDLIGRLLENDPSTRISLKDVLSHPWIVK 393

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,889,409
Number of extensions: 5245999
Number of successful extensions: 28315
Number of sequences better than 10.0: 2220
Number of HSP's gapped: 25091
Number of HSP's successfully gapped: 2517
Length of query: 1117
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 997
Effective length of database: 39,721,479
Effective search space: 39602314563
Effective search space used: 39602314563
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)