Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B085701.83ON53253225970.0
NDAI0A006101.83ON56553220950.0
Suva_5.41.83ON59053320690.0
YEL063C (CAN1)1.83ON59051320370.0
Smik_5.241.83ON59052420250.0
Skud_5.261.83ON59053320190.0
KNAG0C007901.83ON57951219690.0
TDEL0C061801.83ON58351318990.0
CAGL0J08184g1.83ON57252818890.0
TPHA0B044801.83ON60351118530.0
TBLA0A054501.83ON60652218240.0
SAKL0C02662g1.83ON54852918000.0
YNL270C (ALP1)1.83ON57351217950.0
Smik_14.671.83ON57352917920.0
Skud_14.701.83ON57350817880.0
KAFR0D007001.83ON57453717830.0
NDAI0F042001.83ON56652217710.0
NCAS0A006001.83ON54451617640.0
Kpol_2000.651.83ON59553117620.0
ZYRO0F16654g1.83ON58052817560.0
Suva_14.731.83ON49747917470.0
SAKL0C02684gsingletonON58853417490.0
SAKL0C02640gsingletonON54851317410.0
Kwal_33.134011.83ON55952817280.0
KNAG0C05920singletonON59951317270.0
KLLA0C02343g1.83ON58151316780.0
KLTH0F02398g1.83ON55552616740.0
TPHA0B044701.84ON59952716640.0
KNAG0F004801.84ON59752716570.0
NDAI0F041901.84ON59950716560.0
TBLA0A054601.84ON60853216510.0
Smik_14.681.84ON61150816510.0
Suva_14.751.84ON61151016500.0
Skud_14.711.84ON61251016490.0
YNL268W (LYP1)1.84ON61152816450.0
CAGL0J08162g1.84ON59751216300.0
Kpol_2000.641.84ON61052916230.0
NCAS0A006101.84ON60750716230.0
TDEL0C061701.84ON57352816190.0
Ecym_10871.83ON57053716150.0
KAFR0D039401.83ON59753615970.0
SAKL0C02728g1.84ON56252915500.0
Ecym_10881.84ON56752115490.0
KLTH0F02420g1.84ON62151315460.0
Kwal_33.134111.84ON56053115320.0
KLLA0C02365g1.84ON57953315050.0
ZYRO0F16632g1.84ON60750615060.0
AFR668W1.83ON55651814870.0
AFR667C1.84ON56351514680.0
CAGL0A01199gna 1ON6135148231e-102
SAKL0G14916gna 1ON5815307874e-97
YPL265W (DIP5)na 1ON6085097754e-95
TBLA0A07060na 1ON6255557765e-95
KLLA0E16281gna 1ON6055327702e-94
Kwal_33.15545na 1ON5765107656e-94
TPHA0M00130singletonON6115147678e-94
Kpol_358.3na 1ON5755157612e-93
KAFR0B06430singletonON5935157622e-93
Kwal_26.69407.44ON5705307603e-93
Smik_6.473na 1ON6065097614e-93
Suva_16.40na 1ON6065097606e-93
Skud_16.12na 1ON6075127591e-92
NCAS0D02260na 1ON5974787536e-92
KLTH0D01474g7.44ON6245187557e-92
KLTH0B01166gna 1ON5774977482e-91
TDEL0C00930singletonON5955067475e-91
TPHA0H028507.44ON6015497441e-90
NDAI0I02660na 1ON5945427413e-90
ZYRO0D03762g1.244ON6005137406e-90
KNAG0L02470singletonON6385117427e-90
Kwal_27.126811.244ON5935067292e-88
KNAG0L02460singletonON5885447264e-88
Ecym_2480na 1ON5865267247e-88
SAKL0G14014g5.158ON6055217268e-88
SAKL0B10956g7.44ON5725127193e-87
Kpol_543.78singletonON6055067214e-87
TDEL0H040707.44ON5775457177e-87
KNAG0C02140singletonON5985107143e-86
KNAG0E003907.44ON5995267135e-86
SAKL0C01232gsingletonON6135367145e-86
KLTH0E15642g1.244ON5965067127e-86
Suva_2.716singletonON6035147111e-85
ZYRO0D17908gna 1ON5185127032e-85
AFR156W7.44ON5585257053e-85
Kpol_543.791.244ON6055067083e-85
Ecym_60211.244ON6005137073e-85
TDEL0C065101.50ON6425247095e-85
NDAI0B052201.244ON6115267067e-85
KAFR0D005001.50ON6175267068e-85
AFR698C1.50ON6095207041e-84
Skud_11.2751.244ON6025517031e-84
SAKL0F09790gsingletonON5585177002e-84
NDAI0E038007.44ON6215447042e-84
CAGL0B01012g1.50ON6235437032e-84
Ecym_47895.158ON5885216986e-84
YCL025C (AGP1)1.50ON6335167016e-84
YOR348C (PUT4)7.44ON6275417007e-84
Skud_4.7841.50ON6635297029e-84
YKR039W (GAP1)1.244ON6025356989e-84
KAFR0E018505.158ON5605556941e-83
Suva_2.6881.50ON6615327002e-83
KLTH0B02046g5.158ON5895266942e-83
Smik_4.7901.50ON6635196992e-83
CAGL0K05753g1.50ON6605216983e-83
NDAI0D021605.158ON5874916925e-83
KAFR0D00510na 2ON6175326935e-83
KAFR0A011203.284ON5925266917e-83
TPHA0B010901.244ON6065126918e-83
Suva_7.4855.158ON6035436901e-82
NCAS0B085801.50ON6275336911e-82
Ecym_80357.44ON5635356862e-82
KLLA0A11770g5.158ON5815436872e-82
Kpol_367.77.44ON5845536872e-82
Smik_3.531.50ON6335366903e-82
Smik_16.1155.158ON6035246873e-82
SAKL0C01650g1.50ON6135366883e-82
Suva_3.1891.50ON6335146894e-82
NCAS0A071105.158ON5925006856e-82
KAFR0D00520na 3ON5985436856e-82
TBLA0C01240singletonON6295406868e-82
YDR508C (GNP1)1.50ON6635196898e-82
Kwal_33.154075.158ON5875226821e-81
TDEL0A08030singletonON5144586761e-81
SAKL0D00836gna 4ON6015166831e-81
TPHA0A002405.158ON6035296822e-81
AGR319W5.158ON6265306832e-81
YGR191W (HIP1)5.158ON6035166813e-81
Skud_7.5255.158ON6035286813e-81
NCAS0B079001.244ON6195326823e-81
NDAI0C029505.158ON6095546804e-81
TBLA0B077605.158ON6585276834e-81
CAGL0B03773g5.158ON6055146804e-81
Kwal_33.132041.50ON6075276795e-81
Kwal_23.4026singletonON5345166745e-81
Smik_15.5327.44ON6315386806e-81
Suva_4.3073.284ON6095376762e-80
CAGL0E05632g7.44ON5985266752e-80
Ecym_10561.50ON6065266762e-80
Skud_3.381.50ON6335166763e-80
Suva_8.4027.44ON6835506777e-80
Kpol_2000.921.50ON6375166731e-79
KNAG0G009005.158ON6135216701e-79
TBLA0A051801.50ON6765386741e-79
YBR068C (BAP2)3.284ON6095426701e-79
NCAS0D018705.158ON5955426681e-79
KAFR0C051607.44ON5845306672e-79
TPHA0A047005.158ON5695266662e-79
Suva_11.2731.244ON6015236672e-79
Smik_11.3021.244ON5534856634e-79
NDAI0A006401.50ON6414956676e-79
SAKL0D04664g1.244ON5935136621e-78
Kpol_1010.325.158ON5995086622e-78
TPHA0E036601.50ON6475166642e-78
NCAS0E022607.44ON5935486593e-78
KAFR0D04120na 3ON6485186633e-78
Ecym_26643.285ON5755226551e-77
Skud_2.1913.284ON6095376543e-77
TBLA0A05190na 3ON6675336573e-77
ACL135Wna 1ON5885326514e-77
KLTH0F01584g1.50ON5965406515e-77
TDEL0F02830na 5ON5615036486e-77
CAGL0L03267g1.244ON5975146507e-77
KLLA0C01606g1.50ON6205096527e-77
Skud_15.5157.44ON6265226511e-76
SAKL0F16544gsingletonON5675306461e-76
AGR038C3.284ON5805356453e-76
AFR230C1.244ON6045186464e-76
Kwal_8.590na 6ON6295286466e-76
Smik_2.2013.284ON6095366447e-76
AGR039Cna 7ON5865056411e-75
KLTH0B00154gna 6ON5565256372e-75
KLLA0F23419g7.44ON5735446374e-75
KAFR0C004003.284ON5825286375e-75
KLTH0C05170g3.284ON5985196385e-75
Suva_2.2033.284ON6045346386e-75
Kwal_33.14276na 4ON5965046368e-75
Smik_4.2843.284ON6045336368e-75
NCAS0A004201.50ON6795366419e-75
SAKL0D02926g3.285ON5835336341e-74
SAKL0D02970g3.284ON6015336342e-74
YDR046C (BAP3)3.284ON6045336315e-74
TBLA0G031203.284ON6735466349e-74
Kpol_2002.441.50ON6275356319e-74
CAGL0H08393g3.284ON6125246291e-73
Skud_6.2na 8ON5584986232e-73
CAGL0M00154gsingletonON5505166206e-73
KLLA0F27093gsingletonON5634886209e-73
Smik_13.1singletonON5235166152e-72
KLLA0A06886gsingletonON5875256182e-72
SAKL0C13992gsingletonON5525066153e-72
ZYRO0F17446g1.50ON6335356204e-72
KNAG0H011503.284ON6175216185e-72
NDAI0A056203.284ON5715356147e-72
Skud_4.3003.284ON6045136168e-72
NCAS0J00140na 8ON5584896139e-72
KLLA0A06930g1.244ON5875126141e-71
KNAG0J022003.284ON6075296141e-71
KNAG0F002701.50ON6345166143e-71
YFL055W (AGP3)na 8ON5585226084e-71
Ecym_2663na 7ON5895146096e-71
KAFR0D041401.50ON6375166118e-71
KLTH0F01606gna 3ON6045066062e-70
Ecym_26623.284ON5895346052e-70
NCAS0A106803.284ON5935196053e-70
ZYRO0C18502g7.44ON5755446033e-70
NDAI0F043901.50ON6675006093e-70
Kwal_27.105383.284ON6025296044e-70
ZYRO0G07172gna 5ON5675036024e-70
KNAG0C005901.50ON6345016064e-70
NDAI0A074903.284ON5965246001e-69
AEL030W1.368ON5825075982e-69
NDAI0A01340singletonON5544895953e-69
NDAI0G060301.368ON5995125983e-69
Kwal_23.2817na 9ON5805575963e-69
KAFR0D04130na 2ON6445076004e-69
CAGL0L07546g3.284ON6345465994e-69
KNAG0L00110na 8ON5715035954e-69
Kwal_26.9612singletonON5434785926e-69
TPHA0B047501.50ON6395255987e-69
KLLA0A10813g1.368ON5845135948e-69
Skud_15.1381.368ON5925115941e-68
NCAS0I015303.284ON5955425932e-68
SAKL0D02948gna 7ON5945295913e-68
KLTH0F04048gsingletonON5835535894e-68
YOL020W (TAT2)1.368ON5925115895e-68
TDEL0E05750singletonON5485235866e-68
ZYRO0A00308gsingletonON5644955868e-68
AGR040C3.285ON5735255823e-67
KAFR0F02250singletonON5545085788e-67
NCAS0A089201.368ON5995125791e-66
TPHA0M012003.284ON6075365792e-66
TDEL0D00200singletonON5675365753e-66
Suva_15.1481.368ON5925115747e-66
KLLA0B14685gna 9ON5715195737e-66
KNAG0J022103.285ON5815255737e-66
SAKL0A09724gna 10ON5515015719e-66
TBLA0I020103.285ON6285125751e-65
Sklu_YGOB_Anc_1.3681.368ON5414455682e-65
SAKL0H08184gna 11ON5984995713e-65
TBLA0C012101.368ON6005115703e-65
NCAS0I008503.397ON5845285694e-65
CAGL0D02178g1.368ON5775035684e-65
Kpol_1065.133.284ON5965275694e-65
ADL272Wna 11ON5645165674e-65
Smik_15.1461.368ON5935115694e-65
TDEL0C053403.397ON5755185676e-65
KLTH0H13398g1.368ON5875225668e-65
KLTH0C08052gna 12ON5995135679e-65
Ecym_8297na 11ON5695275623e-64
Kwal_33.13215na 3ON5985065633e-64
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B08570
         (532 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}           1004   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   811   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   801   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   789   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   784   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   782   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              763   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   736   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   732   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   718   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   707   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   697   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   696   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   694   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   693   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   691   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            686   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   684   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   683   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   681   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   677   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   678   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   675   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   670   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            669   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   650   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   649   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   645   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                642   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   642   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   640   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   640   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   640   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   639   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   638   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   632   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   629   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              629   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   628   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   626   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   619   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   601   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   601   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   600   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   594   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   584   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   584   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   577   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   570   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   321   e-102
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   307   4e-97
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   303   4e-95
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   303   5e-95
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   301   2e-94
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   299   6e-94
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     300   8e-94
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   297   2e-93
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   298   2e-93
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   297   3e-93
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   297   4e-93
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   297   6e-93
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   296   1e-92
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              294   6e-92
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   295   7e-92
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   292   2e-91
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   292   5e-91
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   291   1e-90
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   290   3e-90
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   289   6e-90
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             290   7e-90
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   285   2e-88
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             284   4e-88
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   283   7e-88
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   284   8e-88
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   281   3e-87
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   282   4e-87
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   280   7e-87
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   279   3e-86
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   279   5e-86
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   279   5e-86
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   278   7e-86
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   278   1e-85
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   275   2e-85
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   276   3e-85
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   277   3e-85
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   276   3e-85
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   277   5e-85
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   276   7e-85
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      276   8e-85
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   275   1e-84
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   275   1e-84
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   274   2e-84
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     275   2e-84
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   275   2e-84
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   273   6e-84
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   274   6e-84
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   274   7e-84
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   275   9e-84
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   273   9e-84
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   271   1e-83
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   274   2e-83
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   271   2e-83
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   273   2e-83
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   273   3e-83
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    271   5e-83
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      271   5e-83
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   270   7e-83
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   270   8e-83
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   270   1e-82
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   270   1e-82
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   268   2e-82
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   269   2e-82
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   269   2e-82
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   270   3e-82
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   269   3e-82
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   269   3e-82
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   270   4e-82
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   268   6e-82
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   268   6e-82
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   268   8e-82
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   270   8e-82
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   267   1e-81
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            265   1e-81
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   267   1e-81
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   267   2e-81
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   267   2e-81
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   266   3e-81
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   266   3e-81
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   267   3e-81
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    266   4e-81
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   267   4e-81
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   266   4e-81
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   266   5e-81
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   264   5e-81
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   266   6e-81
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   265   2e-80
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   264   2e-80
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   265   2e-80
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   265   3e-80
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   265   7e-80
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   263   1e-79
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   262   1e-79
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   264   1e-79
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   262   1e-79
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   261   1e-79
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   261   2e-79
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   261   2e-79
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   261   2e-79
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   259   4e-79
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   261   6e-79
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   259   1e-78
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   259   2e-78
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   260   2e-78
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     258   3e-78
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   259   3e-78
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   256   1e-77
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   256   3e-77
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   257   3e-77
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   255   4e-77
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   255   5e-77
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   254   6e-77
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   254   7e-77
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   255   7e-77
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   255   1e-76
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   253   1e-76
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   253   3e-76
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   253   4e-76
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   253   6e-76
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   252   7e-76
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   251   1e-75
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   249   2e-75
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   249   4e-75
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                249   5e-75
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   250   5e-75
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   250   6e-75
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   249   8e-75
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   249   8e-75
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   251   9e-75
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   248   1e-74
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   248   2e-74
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   247   5e-74
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              248   9e-74
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   247   9e-74
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   246   1e-73
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      244   2e-73
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   243   6e-73
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   243   9e-73
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    241   2e-72
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   242   2e-72
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   241   3e-72
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   243   4e-72
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              242   5e-72
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            241   7e-72
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   241   8e-72
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      240   9e-72
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   241   1e-71
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   241   1e-71
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   241   3e-71
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   238   4e-71
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   239   6e-71
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              239   8e-71
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   238   2e-70
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   237   2e-70
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   237   3e-70
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   236   3e-70
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   239   3e-70
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   237   4e-70
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   236   4e-70
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   238   4e-70
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   235   1e-69
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   234   2e-69
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              233   3e-69
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   234   3e-69
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   234   3e-69
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              235   4e-69
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   235   4e-69
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   233   4e-69
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   232   6e-69
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   234   7e-69
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   233   8e-69
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   233   1e-68
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              233   2e-68
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   232   3e-68
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   231   4e-68
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   231   5e-68
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            230   6e-68
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   230   8e-68
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   228   3e-67
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              227   8e-67
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   227   1e-66
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   227   2e-66
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                226   3e-66
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   225   7e-66
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   225   7e-66
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   225   7e-66
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   224   9e-66
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   226   1e-65
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   223   2e-65
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   224   3e-65
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   224   3e-65
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   223   4e-65
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   223   4e-65
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   223   4e-65
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   223   4e-65
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   223   4e-65
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   223   6e-65
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   222   8e-65
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   223   9e-65
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   221   3e-64
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   221   3e-64
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   219   4e-64
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   219   5e-64
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   221   7e-64
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   220   1e-63
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   219   2e-63
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   219   2e-63
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   218   2e-63
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   219   2e-63
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              219   2e-63
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   218   3e-63
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   219   3e-63
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   216   5e-63
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   217   1e-62
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   217   1e-62
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   217   2e-62
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   212   7e-62
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   212   8e-62
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   219   8e-62
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   212   9e-62
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   213   1e-61
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   213   2e-61
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   214   2e-61
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   213   3e-61
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   213   5e-61
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   216   1e-60
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   213   1e-60
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   211   2e-60
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   210   3e-60
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   209   6e-60
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   213   6e-60
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   209   9e-60
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              208   2e-59
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   207   3e-59
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   211   7e-59
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   206   9e-59
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   206   1e-58
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   205   2e-58
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    205   2e-58
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   205   2e-58
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   206   3e-58
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   208   6e-58
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   204   6e-58
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   207   1e-57
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   201   5e-57
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   201   5e-57
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   201   6e-57
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   199   8e-57
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   200   1e-56
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      200   1e-56
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                200   1e-56
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   199   2e-56
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   204   2e-56
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   200   2e-56
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              200   2e-56
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   198   7e-56
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   202   7e-56
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   201   1e-55
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   197   2e-55
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   196   7e-55
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   196   7e-55
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   194   1e-54
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   194   2e-54
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   194   3e-54
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   194   3e-54
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   197   4e-54
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   193   9e-54
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   196   1e-53
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   191   1e-53
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   191   3e-53
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   194   3e-53
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   190   3e-53
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   189   6e-53
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   194   6e-53
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   189   2e-52
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   192   2e-52
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                189   2e-52
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   186   2e-51
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   186   4e-51
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   187   2e-50
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   183   2e-50
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   182   4e-49
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   182   6e-49
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   177   3e-47
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     150   3e-40
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     150   5e-40
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   150   5e-38
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         123   1e-30
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   116   1e-26
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   107   8e-26
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          91   4e-20
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      91   1e-19
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     91   5e-19
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    83   8e-18
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      76   1e-15
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      72   1e-14
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          67   3e-12
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    64   5e-11
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    38   0.062
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    35   0.66 
ZYRO0G03058g Chr7 complement(233580..234464) [885 bp, 294 aa] {O...    34   0.66 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    35   0.68 
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              33   0.76 
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    34   0.77 
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              31   2.3  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    33   2.4  
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    32   3.5  
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    32   4.8  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    32   5.1  
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    32   5.6  
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    31   7.1  

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/532 (93%), Positives = 498/532 (93%)

Query: 1   MLGGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           MLGGHNQDSKMKEEIREISVEVEAETVRRELKQRH                 VSTPLMNA
Sbjct: 1   MLGGHNQDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNA 60

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120
           GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW
Sbjct: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120

Query: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
           CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA
Sbjct: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180

Query: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF
Sbjct: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV 300
           QGTELVGITAGEAANPRKTVPRAIKKVV                 VPYDDWKLTSTDSYV
Sbjct: 241 QGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYV 300

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT
Sbjct: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
           TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA
Sbjct: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFI 480
           LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFI
Sbjct: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFI 480

Query: 481 AIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           AIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA
Sbjct: 481 AIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/532 (74%), Positives = 447/532 (84%), Gaps = 4/532 (0%)

Query: 5   HNQDSKMKEEIREISV---EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
           H+  S++  E +E  +   ++    V+RELKQRH                 +STPL NAG
Sbjct: 34  HSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAG 93

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
           PVGALIAYLFM TL YSVTQSLGEMATFIPVTSSFTVFSQRF+SP+FGAANGYMYWFSW 
Sbjct: 94  PVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWA 153

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
           ITFALELSVVGQ+IQFWT AVP+ AWISIFWVLL  MNMFPV++YGEFEFWVA +KV+AI
Sbjct: 154 ITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAI 213

Query: 182 MGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           MGFLIYC CMVCGAGVTGPVGFRYWR+PG  GPGIIAK+ N+A+FLGWVSSLINAAFT+Q
Sbjct: 214 MGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQ 273

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS 301
           GTELVGITAGEAANPRK+VPRAIKKVV                 VPY+D KLTS DSYV+
Sbjct: 274 GTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVA 333

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASPFII+I+NSGT +LPHIFNAVI++TIISA NSN+YVGSRIM+GLS S+LAP ILSRT 
Sbjct: 334 ASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTN 393

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           ++GVPWV+V+ T LFGALAYMETSTGG+ AFNWLLNITGVAGFF+WLFIS+SH+RFMQAL
Sbjct: 394 KNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQAL 453

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFI 480
           E RGISRDDLPFKAK+MPGLAYY +FFMTLIIIIQGFTSFCP ++GIDFL AYIS F+FI
Sbjct: 454 EYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFI 513

Query: 481 AIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           AIWI FQ WFRCRLIW++EDVDIDTDRR +EE VW +  P  FWDKFWNVVA
Sbjct: 514 AIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/533 (73%), Positives = 445/533 (83%), Gaps = 3/533 (0%)

Query: 3   GGHNQDS-KMKEEIR-EISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           G + QD+  M+E+I+ E   EV+   V+RELKQRH                 +STPL NA
Sbjct: 58  GVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNA 117

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120
           GPVGALI+YLFM +LAYSVTQSLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW
Sbjct: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177

Query: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
            +TFALELSVVGQVIQFWT+AVPLAAWISIFWV++T MNMFPVKYYGEFEFWVA +KV+A
Sbjct: 178 AVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237

Query: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           I+GFLIYCFCMVCGAGVTGPVGFRYWR+PGA+GPGII+K+KN+ARFLGWVSSLINAAFTF
Sbjct: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV 300
           QGTELVGITAGEAANPRKTVPRAIKKVV                 VPY+D KLTS  SYV
Sbjct: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV 357

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           S SPFIIAIENSGT VLPHIFNAVI+ TIISA NSNIYVGSR+++GLS S+LAP   S+T
Sbjct: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKT 417

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
           T+ GVP++AV  TS+FGALAYMETSTGG K F WLLNITGVAGFF WLFIS+SHIRFMQA
Sbjct: 418 TKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQA 477

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMF 479
           L+ RGISRD+LPFKAK MPGLAYY  FFM +II+IQGFTSF P +NG++FL AYISVF+F
Sbjct: 478 LKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLF 537

Query: 480 IAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +AIWI F+  FRCR +W++EDVDID+DRR +E  VW E EP+  WDKFWNVV 
Sbjct: 538 LAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/513 (75%), Positives = 431/513 (84%), Gaps = 1/513 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           EV+   V+RELKQRH                 +STPL NAGPVGALI+YLFM +LAYSVT
Sbjct: 78  EVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVT 137

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QSLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW ITFALELSVVGQVIQFWT+
Sbjct: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            VPLAAWISIFWV++T MN+FPVKYYGEFEFWVA +KV+AI+GFLIYCFCMVCGAGVTGP
Sbjct: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           VGFRYWR+PGA+GPGII+KDKN+ RFLGWVSSLINAAFTFQGTELVGITAGEAANPRK+V
Sbjct: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320
           PRAIKKVV                 VPY+D KLT + SYVS SPFIIAIENSGT VLPHI
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHI 377

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FNAVI+ TIISA NSNIYVGSRI++GLS ++LAP  LSRTT+ GVP++AV VT+ FGALA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           YMETSTGG K F WLLNITGVAGFF WLFIS+SHIRFMQAL+ RGISRD+LPFKAK MPG
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
           LAYY   FMT+IIIIQGFT+F P +NG+ F  AYIS+F+F+A+WI FQ  FRCR IW++ 
Sbjct: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557

Query: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           DVDID+DRR +E  VW + EP+ FWDKFWNVVA
Sbjct: 558 DVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/524 (73%), Positives = 435/524 (83%), Gaps = 2/524 (0%)

Query: 11  MKEEIR-EISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAY 69
           M + IR E   EV    V+RELKQRH                 +S PL NAGPVGALI+Y
Sbjct: 67  MGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISY 126

Query: 70  LFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129
           LFM +LAYSVTQSLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW ITFALELS
Sbjct: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186

Query: 130 VVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCF 189
           VVGQVI+FWT  VPLAAWISIFWV++T MN+FPVKYYGEFEFWVA +KV+AI+GFLIYCF
Sbjct: 187 VVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCF 246

Query: 190 CMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGIT 249
           CMVCGAGVTGPVGFRYWR+PGA+GPGII+KDKN+ RFLGWVSSLINAAFTFQGTELVGIT
Sbjct: 247 CMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGIT 306

Query: 250 AGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAI 309
           AGEAANPRKTVPRAIKKVV                 VPY+D KLT+  SYVS SPFIIAI
Sbjct: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAI 366

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
           ENSGT VLPHIFNAVI+ TIISA NSNIYVGSRI++GLS ++LAP  LSRTT+ GVP++A
Sbjct: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIA 426

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
           V +T++FGALAYMETSTGG K F WLLNITGVAGFF WL IS+SHIRFMQAL+ RGISRD
Sbjct: 427 VFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRD 486

Query: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQA 488
           +LPFKAK MPGLAY+   FM +II+IQGFT+F P ++GIDFL AYIS+F+F+AIWI F+ 
Sbjct: 487 ELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEI 546

Query: 489 WFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            FRCR IW++EDVDID+DRR +E  VW + EP+ FWDKFWNVVA
Sbjct: 547 IFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/533 (73%), Positives = 441/533 (82%), Gaps = 3/533 (0%)

Query: 3   GGHNQDS-KMKEEIR-EISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           G + QD+  M+E ++ E   EV+   V+RELKQRH                 +STPL NA
Sbjct: 58  GVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANA 117

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120
           GPVGALIAYLFM +LA+SVTQSLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW
Sbjct: 118 GPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177

Query: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
            ITFALELSVVGQVIQFWT  VPLAAWISIFWVL+T MN+FPVKYYGEFEFWVA +KV+A
Sbjct: 178 AITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIA 237

Query: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           I+GFLIYCFCMVCGAGVTGPVGFRYWR+PGA+GPGII+K+KN+ RFLGWVSSLINAAFTF
Sbjct: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV 300
           QGTELVGITAGEAANPRKTVPRAIKKVV                 VPY+D KLT   SYV
Sbjct: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           S SPFI+AI+NSGT VLPHIFNAVI+ TIISA NSNIYVGSRI++GLS ++LAP  LSRT
Sbjct: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
           ++ GVP++AV  T++FGALAYMETSTGG K F WLLNITGVAGFF WLFIS+SHIRFMQA
Sbjct: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMF 479
           L+ RGISRD+LPFKAK MPGLAYY  FFM +IIIIQGFT+F P +NG  FL AYIS+F+F
Sbjct: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLF 537

Query: 480 IAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           IA+WI F+  FRCR IW++EDVDID+DRR +E  VW + EP+ FWDKFWNVVA
Sbjct: 538 IAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/512 (72%), Positives = 421/512 (82%), Gaps = 1/512 (0%)

Query: 22  VEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQ 81
           V    V+RELKQRH                 +STPL  AGPVGALI+Y+FM TL YSVTQ
Sbjct: 68  VHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQ 127

Query: 82  SLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
           SLGEMATFIPVTSSFTVF+QRF+SP+ GAA GYMYWFSW +TFALELSV+GQVIQ+WT+A
Sbjct: 128 SLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYA 187

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV 201
           VPLAAWISIFWV++T  NMFPVKYYGE EFW+A +KV+AI+GFL+YC CMVCGAGVTGPV
Sbjct: 188 VPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPV 247

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           GFRYWR+PG +GPGII+KDKN+ARFLGWVSSLIN AFT+QGTELVGI+AGEAANPRK VP
Sbjct: 248 GFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVP 307

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
           RAIKKVV                 VPY+D  L +TDSYV++SPFIIAI+NSGT VLPHIF
Sbjct: 308 RAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIF 367

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI  TI+SAGNSN+YVGSRI++GLS ++LAP ILSRTT+ GVPW+AVLVTS+ GALAY
Sbjct: 368 NAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAY 427

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           METSTGGQ AFNWLLNIT VAGFFTWLFISLSHIRFMQAL+ RGISRDDLPFKA  MPGL
Sbjct: 428 METSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGL 487

Query: 442 AYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED 500
           AYY  F M +IIIIQGFT+F P ++G DF  AYIS+F+FI IW  FQ  FRCR I +VED
Sbjct: 488 AYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVED 547

Query: 501 VDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           VDIDTDRR +E  VW + EP+  WDKFWN++A
Sbjct: 548 VDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/513 (70%), Positives = 419/513 (81%), Gaps = 1/513 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           +V    V+R LKQRH                 +STPL NAGPVG LIAYLFMATL YSV 
Sbjct: 71  QVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVV 130

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QSLGEMATFIPVTS+FTVFS RF+SPAFGAA+GYMYWFSW ITFALELSVVGQ+I+FWT 
Sbjct: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
           AVP+AAWI+IFWVLLT  N+FPVKYYGEFEFW+A +KV+A++GF+IYC CMVCGAG+TGP
Sbjct: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           VGFRYWR+PGA+GPGII+KDKN+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+V
Sbjct: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320
           PRAIKKVV                 VPY+D KL S+DSYVS+SPFIIAIENSGT VLPHI
Sbjct: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FNAV++ TIISAGNSN+YVGSRIMYGL+  +LAP    RT   GVP+ AV  TS FGALA
Sbjct: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           YME STGG  AFNWLLNITGVAGFFTW+ IS  HIRFMQAL+ RGISRDDLPFKAK+MP 
Sbjct: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
           LAYY +FFM +II+IQGFT+F P ++G+DF  AY+SVF+FIAIW+  Q WFRCR+  R++
Sbjct: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD 550

Query: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +VDIDTDRR +E  VW ++ P+  WDKFWN+VA
Sbjct: 551 EVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/528 (66%), Positives = 418/528 (79%), Gaps = 4/528 (0%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
            Q   +  E  E+   +E   V+R LKQRH                 ++TPL NAGPVGA
Sbjct: 48  TQYEDLATEKDEL---LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGA 104

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           L+AYLFM T+ +SVTQSLGEMATFIPVTSSF+VF+QRF+SPA GAANGYMY+ SWC TFA
Sbjct: 105 LVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFA 164

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LELSVVGQ+IQFWTF VPLAAWISIFWVLLT  NMFPVK+YGEFEFW+A +KV+A+MGFL
Sbjct: 165 LELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFL 224

Query: 186 IYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
           IY  C+VCGAG TGP+GFRYWR+PGA GPGII+ +  +ARFLGWVSSLINAAFT+QGTEL
Sbjct: 225 IYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTEL 284

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPF 305
           VGITAGEAANPRK VPRAI+KV+                 VPY+D KLTSTDSYVS+SPF
Sbjct: 285 VGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPF 344

Query: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365
           II I+N+GT VLPHIFNAVI+ TIISAGNSN+YVGSRI++ ++ + LAP  L++TT  GV
Sbjct: 345 IITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGV 404

Query: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425
           P+++VL  S FG+L+YME STGG KAFNWLLNITGVAGFF WL IS SH+RFMQAL+ RG
Sbjct: 405 PYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRG 464

Query: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWI 484
           ISRDDLP+KA WMP LAYY +FFM +II+IQGFTSF P ++G DF+ AYISV +F+  W 
Sbjct: 465 ISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWG 524

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            FQ +FRCR+IW++EDVDIDTDRR +E  VW +  P+  WDKFW+ VA
Sbjct: 525 FFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/511 (70%), Positives = 423/511 (82%), Gaps = 2/511 (0%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           EAE V+R+LKQRH                 ++TPL NAGPVGALIAYLFMAT+ +SVTQS
Sbjct: 94  EAE-VKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGEMATFIPVTSSFTVFS RF+SPA GAANGYMYWFSW +TFALELSVVGQ+IQFWT AV
Sbjct: 153 LGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAV 212

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVG 202
           PL+AWI I+WV+LT MN+FPVK+YGEFEFWVA +KV+AI+GFLIYC CMVCGAGVTGPVG
Sbjct: 213 PLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVG 272

Query: 203 FRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 262
           FRYWR+PG +GPGII+KD N+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPR
Sbjct: 273 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 332

Query: 263 AIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFN 322
           AIKKV                  VPYDD KLTSTDSY+SASPFIIAIENSGT +LPHIFN
Sbjct: 333 AIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIFN 392

Query: 323 AVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYM 382
           AVI++TIISAGNSN+YVGSRI++GL+ ++LAP     T++ GVP+ +V  TS FGALA++
Sbjct: 393 AVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFL 452

Query: 383 ETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLA 442
           E S+GG KAFNWLLNI  VAGFF WL IS++H+RFMQAL+ RGISRDDLPFKA++MP LA
Sbjct: 453 EVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLA 512

Query: 443 YYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDV 501
           YY +FFMT+IIIIQGFT+F P +NG DF+ AYIS+F+F  +W+ FQ +FR +L+W VE+V
Sbjct: 513 YYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEV 572

Query: 502 DIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           DIDTDRR V+  +W +  P+ FWDKFW+VVA
Sbjct: 573 DIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/522 (69%), Positives = 421/522 (80%), Gaps = 4/522 (0%)

Query: 12  KEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
           +E+I    V VE   V+RELK RH                 ++TP+ NAGPVG+LIAY+F
Sbjct: 88  EEDIDATGV-VEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIF 146

Query: 72  MATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131
           M TL +SVTQSLGEMATFIPVTSSFTVF+ RFVS  FGAA GYMYWFSW ITFALELSVV
Sbjct: 147 MGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206

Query: 132 GQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191
           GQVI+FWTF VPLAAWISIFWVL+  MN FPVK YGEFEFWVA +KV+AI+GF+IYC CM
Sbjct: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266

Query: 192 VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           VCGAG+TGPVGFRYWRHPG +GPGII+KDKN+ARFLGWVSSLINAAFT+QGTELVGITAG
Sbjct: 267 VCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIEN 311
           EAANPRK+VPRAIKKV                  VPY+D KL+STDSYVSASPFIIAI+N
Sbjct: 327 EAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQN 386

Query: 312 SGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVL 371
           SGT VLPHIFNAVI+ TIISA NSN+YVGSRI+YGLS+++LAP    + T++GVP++AVL
Sbjct: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVL 445

Query: 372 VTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDL 431
            T+ FGALAYMETS GGQ AFNWLLNITGVAGFF WL IS+SHIRFMQ L+ RG+SRDDL
Sbjct: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505

Query: 432 PFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWF 490
           P+KA  MPGLAYYG FF+TLII+IQGFT+F P ++   FLTAYIS F+F+ I+I  Q +F
Sbjct: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYF 565

Query: 491 RCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           R RL   ++DVDIDTDRR ++  +W E+ P+ FWDKFW V+A
Sbjct: 566 RTRLWRTLDDVDIDTDRRDIDTVIW-EEGPQTFWDKFWAVIA 606

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/529 (65%), Positives = 411/529 (77%), Gaps = 7/529 (1%)

Query: 11  MKEEIREISVEVEA-----ET-VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           +K  I E +V +E+     ET V+R LK RH                 +STPL NAGPVG
Sbjct: 20  IKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           ALIAY+F+ TLAYSVTQSLGEMATFIPVTSSFTVF+QRF+SPA G+ANGY+YW SW ITF
Sbjct: 80  ALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITF 139

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           ALELSVVGQ+IQFWT AVPL AWI+IFWV+LT  N+FPVKYYGE EFW+A +KV+AI+GF
Sbjct: 140 ALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGF 199

Query: 185 LIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           +IY F MVCGAG TGPVGFRYWR+PG +GPGII+KD N+ RFLGWVSSLI+AAFT+QGTE
Sbjct: 200 IIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
           LVGITAGEAANPRKTVPRAI KV                  VP++D KL S DSY+S+SP
Sbjct: 260 LVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSP 319

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+IAIENSGT VLPHIFNAVI++TIISAGNSN+YVGSRI Y ++ + LAP  L+ TT+ G
Sbjct: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           +P+ AVL TS+ G LAY+E+S+G    FNWLLNIT VAGFFTW+ IS+SHIRFMQAL+ +
Sbjct: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI-DFLTAYISVFMFIAIW 483
           GISRDDLPFKAK+MP  AYY  FF+ +IIIIQGFT+F P   + DF TAYISV +F   W
Sbjct: 440 GISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFW 499

Query: 484 IAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           I FQ WFR  L  + ED+D+DTDRR +++ VW EQ+PR  W+KFW  +A
Sbjct: 500 IGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/512 (64%), Positives = 406/512 (79%), Gaps = 2/512 (0%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   V+R+LKQRH                 +  PL +AGPVGALI+YLFM T+ YSVTQS
Sbjct: 62  ERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGEM TFIPVTSSF+VF+QRF+SPA GA NGYMYW SWC TFALELSV+G+VIQ+WT AV
Sbjct: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT-GPV 201
           PLAAWI IFW LLT MNMFPVKYYGEFEF +A +KV+A++GF+I+ FC+VCGAG + GP+
Sbjct: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           GFRYWR+PGA+GPGII+ DKN+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK +P
Sbjct: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
           RAIKKVV                 VPY+D KL S   +VS+SPF+I+IENSGT VLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAV++ TI+SAGNSN+Y+GSR++Y LS + LAP  LS  T+ GVP+ +VL TS+FG LA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +E S G  KAFNWLLNITGVAGFF WL IS SHIRFMQA+  RGISRDDLP+KA+ MP L
Sbjct: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481

Query: 442 AYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED 500
           AYY  FF+ LI++IQGFT+F P +  IDF+ AYIS+F+F+AIW++FQ WF+CRL+W+++D
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQD 541

Query: 501 VDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +DID+DRR +EE VWIE E +  W + W+V++
Sbjct: 542 IDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/529 (63%), Positives = 411/529 (77%), Gaps = 6/529 (1%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N DS  + E    +   +   V+R+LKQRH                 +  PL +AGPVGA
Sbjct: 49  NNDSAKETE----TSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGA 104

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           LI+YLFM T+ YSVTQSLGEMATFIPVTSSF+VF+QRF+SPA GA NGYMYW SWC TFA
Sbjct: 105 LISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFA 164

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LELSV+GQ+IQ+WT AVPL AWI IFW LLT MNMFPVKYYGEFEF +A +KV+A++GF+
Sbjct: 165 LELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFI 224

Query: 186 IYCFCMVCGAGVTG-PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
            + FC+VCGAG +G P+GFRYWR+PGA+GPGII+K+KN+ RFLGWVSSLINAAFT+QGTE
Sbjct: 225 FFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTE 284

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
           LVGITAGEAANPR+ VPRAIKKVV                 VPY+D KL S  ++VS+SP
Sbjct: 285 LVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSP 344

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+I+IENSGT VLP IFNAV++ TI+SAGNSN+Y+GSR++Y LS + LAP  LS  T+ G
Sbjct: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGG 404

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           VP+ AVL TS FG LA++ETS G  K FNWLLNITGVAGFF WL ISLSHIRFMQA++ R
Sbjct: 405 VPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKR 464

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIW 483
           GISRDDLP++A+ MP LAYY  FF+ LI++IQGFT+F P +  IDF+ AYISVF+FIAIW
Sbjct: 465 GISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIW 524

Query: 484 IAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           + FQ WF+CR +W+++DVDID+DRR +EE VWIE E +  W   W++++
Sbjct: 525 LLFQVWFKCRFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/508 (65%), Positives = 405/508 (79%), Gaps = 2/508 (0%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R+LK+RH                 +  PL +AGPVGALI+YLFM T+ YSVTQSLGEM
Sbjct: 66  VQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
           ATFIPVTSSF+VF+QRF+SPA GA NGYMYW SWC TFALELSV+GQ+IQ+WT AVPLAA
Sbjct: 126 ATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAA 185

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGV-TGPVGFRY 205
           WI IFW LLT MNMFPVKYYGEFEF +A +KV+ ++GF+I+ FC+VCGAG   GP+GFRY
Sbjct: 186 WIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRY 245

Query: 206 WRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 265
           WR+PGA+GPGII+ +KN+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK VPRAIK
Sbjct: 246 WRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIK 305

Query: 266 KVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVI 325
           KVV                 VPY+D KL S  ++VSASPF+I+IENSGT VLP IFNAV+
Sbjct: 306 KVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAVV 365

Query: 326 VATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETS 385
           + TI SAGNSN+Y+GSR++Y LS + LAP  LS  T+ GVP++AVL+TSLFG LA++ETS
Sbjct: 366 LITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETS 425

Query: 386 TGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYG 445
            G  KAFNWLLNITGVAGFF WL IS SHIRFMQA++ RGISRDDLP+KA+ MP LAYY 
Sbjct: 426 AGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYA 485

Query: 446 VFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDID 504
            FF+ LI++IQGFT+F P +  +DF+ AYISVF+F  IW++FQ WF+CRLI +++D+DID
Sbjct: 486 SFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDID 545

Query: 505 TDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +DRR +EE VWIE E +  W + W++++
Sbjct: 546 SDRREIEEQVWIEPECKTRWQRVWDILS 573

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/537 (66%), Positives = 420/537 (78%), Gaps = 9/537 (1%)

Query: 5   HNQDSKMKEEIREI--SVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
              D+    E  E+  S  V    V+RELKQRH                 +STPL ++GP
Sbjct: 38  QQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGP 97

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
           VG+LIAY+F+ TL Y+VTQSLGEMATFIPVTSSFTVF+ RF+SP+ GAA GYMYWFSW +
Sbjct: 98  VGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAV 157

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
           TFALELSVVGQ++ +WTFAVP+AAWISIFWV+LT +NMFPVK+YGE EFWVA VKVVAI+
Sbjct: 158 TFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIV 217

Query: 183 GFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGI------IAKDKNQARFLGWVSSLINA 236
           GFLIYC CMVCGAGVTGPVGFRYWR+PG +G G+      I+K+KN  RFLGW +SLINA
Sbjct: 218 GFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINA 277

Query: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST 296
           AFT+QGTELVGITAGEAANPRKTVPRAIKKVV                 VP+DD KL+S 
Sbjct: 278 AFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSD 337

Query: 297 DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356
           DSYVS+SPFIIAIENSGT +LP IFNA+I+ TIISAGNSNIYVGSRI++ L+ + LAP I
Sbjct: 338 DSYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKI 397

Query: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416
           LSRTT+ GVPWV+VL T++FG LAYMET+ GGQ  F+WL+NIT +AGF+ WLFI +SHIR
Sbjct: 398 LSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIR 457

Query: 417 FMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYIS 475
           FMQ L+ RGISRDDLPFKA  MPGLAYY VF M +III QGFT+F P ++  DF  AYIS
Sbjct: 458 FMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYIS 517

Query: 476 VFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           V +F  IW AFQ WF+CR IW++EDVDID++RR VE+ +W + EP+ FWDKFWNVVA
Sbjct: 518 VILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/522 (63%), Positives = 404/522 (77%), Gaps = 2/522 (0%)

Query: 12  KEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
           KE + E + + E   V+R+L +RH                 ++ PLM +GPVG+LIAYLF
Sbjct: 46  KENVSE-NEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLF 104

Query: 72  MATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131
           + T+ YSVTQSLGEMATFIPVT+SFT+FS RF+SPA GAANGYMYWFSW +TFALELSVV
Sbjct: 105 LGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164

Query: 132 GQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191
           GQ+IQFWTFAVPL AWISIFWV+LT  N+FPV+ YGE EFW+A +KV AI+GF+IYCFC+
Sbjct: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224

Query: 192 VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           VCGAG TGPVGFRYWR+PG +G GII+ +  +ARFLGW SSLINAAFTFQGTELVGITAG
Sbjct: 225 VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAG 284

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIEN 311
           EAANPR+TVP+AI+KVV                 VPYDD KL S +SYVS+SPFIIAIEN
Sbjct: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIEN 344

Query: 312 SGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVL 371
           SGT +LPHIFN VI+ TIISAGNSN+Y+GSR+++GL+ +   P + ++TT+ GVP  AV+
Sbjct: 345 SGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVV 404

Query: 372 VTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDL 431
            TSLFGALA+METSTGG +AF WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR+DL
Sbjct: 405 FTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDL 464

Query: 432 PFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWF 490
           PFKAK+MP LAYY    M +II  QGFT+F P ++ ++F  +YISVF+F   W +FQ WF
Sbjct: 465 PFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWF 524

Query: 491 RCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +CR +W++ D+DID DRR +E+ VW +  P   W KFW+ VA
Sbjct: 525 KCRYVWKLVDIDIDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/516 (65%), Positives = 410/516 (79%), Gaps = 4/516 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           + + + V+RELK+RH                 ++ PL+ AGP+GALIAYLFM T+ +SVT
Sbjct: 29  QEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVT 88

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QSLGEM TFIPVT+SFTVF+QRF+SPAFGAANGYMYWFSW +TFALELSVVGQ+IQFWT 
Sbjct: 89  QSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTM 148

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
           AVPLAAWISI WVLLT  N+FPV+ YGE EFW+A VKV+AI+GF+IY  C++CGAGVTGP
Sbjct: 149 AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTGP 208

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           VGFRYW++PG +G GII+ + N+ARF GWVSSLINAAFTFQGTELVGITAGE   PRKTV
Sbjct: 209 VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTV 268

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320
           P+AIKKVV                 VPY+D KL S DSYVS+SPFII I+N+GT +LPHI
Sbjct: 269 PKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHI 328

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FNAVI+ TIISAGNSN+Y+GSRI+YGL+ ++ AP   + T++ GVP+V VL TS+FG+LA
Sbjct: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           YMET+TGG KAF WLLNI GVAGFF WL IS SHIRFM+AL+ RGISR+DLP+KA  MP 
Sbjct: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
           LAYY VFFM +II+IQGFTSF P +   +F  AYISVF+FI  W+AFQ WF+CRL+W+++
Sbjct: 449 LAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQ 508

Query: 500 DVDIDTDRRAVEEAVW---IEQEPRGFWDKFWNVVA 532
           DVD+DTDRR +EE VW   +E + + +WD+FWN VA
Sbjct: 509 DVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/531 (67%), Positives = 425/531 (80%), Gaps = 2/531 (0%)

Query: 3   GGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           G H+      E   +  V  +AE V+RELKQRH                 +STPL NAGP
Sbjct: 66  GSHSVSGDEDEPYVDQGVVQDAE-VKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGP 124

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
           VG+LIAYLFMAT+ +SVTQSLGEMATFIPVTSSFTVFS RF+SP+ GAANGYMYWFSW I
Sbjct: 125 VGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAI 184

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
           TFALELSVVGQ+IQFWT AVPL+AWI I+W +LT MNMFPVK+YGEFEFWVA +KV+AIM
Sbjct: 185 TFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIM 244

Query: 183 GFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           GFLIYC CMVCGAGVTGPVGFRYWR+PG +GPGII+    + RFLGWVSSLINAAFT+QG
Sbjct: 245 GFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQG 304

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA 302
           TELVGITAGEAANPRKTVPRAIKKV                  VP+DD KL+S DSYVS+
Sbjct: 305 TELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSS 364

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SPFIIAI+NSGT VLPHIFNAVI++TIISAGNSNIYVGSR+M+GL+ ++LAP     TT+
Sbjct: 365 SPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTK 424

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
           HGVP++AVL TS FGALA++E S+GG KAFNWLLNI GVAGFF WL IS++H+RF+Q LE
Sbjct: 425 HGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLE 484

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIA 481
            RGISRDDLPFKA  MP LAYY +FFM +IIIIQGFT+F P +NG DF+ AYISVF+F  
Sbjct: 485 HRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFF 544

Query: 482 IWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +W++FQ +FRC+L W +++VDIDTDRR ++  +W +  P+ FWD+FW+VVA
Sbjct: 545 LWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/528 (61%), Positives = 406/528 (76%), Gaps = 1/528 (0%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           + +  + + +     EV +  V+R LK RH                 +S PL NAGPVG 
Sbjct: 53  DNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGM 112

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           LIAYLFMAT+A+SV QSLGEMAT+IPVTS+F+VFSQRF+SPAFGAANGYMYWFSW ITFA
Sbjct: 113 LIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFA 172

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LELSV+GQ++Q+WTF VP+AAWISIFWVL+ G+N  PVK+YGEFEFW+A +KVVAI+GF+
Sbjct: 173 LELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFI 232

Query: 186 IYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
           IYCF MVCGAG TGPVGFRYWRH  AFG GII+K+KN+ARFLGWVSSLINAAFT+QGTEL
Sbjct: 233 IYCFIMVCGAGKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTEL 292

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPF 305
           VGITAGEAANPRKTVP++IK+ +                 VP++D  L  + SY ++SPF
Sbjct: 293 VGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPF 352

Query: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365
           I+AI+NSGT  LP IFNAVI+ T+ISA NS++YVGSR+MY ++ +RLAP IL++ ++ GV
Sbjct: 353 ILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGV 412

Query: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425
           P+ AVL TS  GALAY+ETS+ G   FNWL+NITGVAGFF+W  IS SH+RFM+AL+ RG
Sbjct: 413 PYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRG 472

Query: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWI 484
           ISR+DLPFKA +MP +A Y  FFMTLII++QGFT F P +   DF+ +YISV +F  IW 
Sbjct: 473 ISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWA 532

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            FQ WFRC L+  + ++DIDTDRR V+  VW ++ P+  WDKFWN+VA
Sbjct: 533 VFQIWFRCPLLVPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/479 (68%), Positives = 392/479 (81%), Gaps = 2/479 (0%)

Query: 56  PLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYM 115
           PL +AGPVGALI+Y+FM T+ YSVTQSLGEMATFIPVTSSF+VF+QRF+SPA GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 116 YWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
           YW SWC TFALELSV+GQ+IQ+WT AVPL+AWI IFW LLT MNMFPVKYYGEFEF +A 
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 176 VKVVAIMGFLIYCFCMVCGAGV-TGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLI 234
           +KV+A++GF+IY FCMVCGAG   GP+GFRYWR+PGA+GPGII+ DKN+ RFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 235 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT 294
           NAAFT+QGTELVGITAGEAANPRK VPRAIKKVV                 VPY+D KL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 295 STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAP 354
           S  S+VSASPF+I+IENSGT VLP IFNAV++ TI+SAGNSN+Y+GSR++Y LS + LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 355 GILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSH 414
             LS  T+ GVP+ AVL TS+FG LA++ETS G  KAFNWLLNITGVAGFF WL IS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 415 IRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAY 473
           IRFMQA+  RGISR+DLP+KA+ MP LAYY  FF+ LI++IQGFT+F P +  +DF+ AY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 474 ISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           ISVF+F+AIW +FQ WF+C +I +++DVDID+DRR +EE VWIE   +  W   W+V+A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/534 (64%), Positives = 413/534 (77%), Gaps = 7/534 (1%)

Query: 6   NQDSKMKEEIREISVE------VEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMN 59
           +Q S M+     +S++      V+   V+R LK RH                 +S+PL +
Sbjct: 55  SQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLAD 114

Query: 60  AGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFS 119
           AGPVGALIAY+FM T+AY VTQSLGEMATFIPVTSSFTVF+QRF+SPAFG ANGY+YWFS
Sbjct: 115 AGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFS 174

Query: 120 WCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVV 179
           WCITFALELSVVGQ+IQFWTFAVPL AWI+IFWV+LT  N+FPVKYYGE EFW+A +KV+
Sbjct: 175 WCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVL 234

Query: 180 AIMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 239
           AI+GF+IY F MVCGAG TGPVGFRYWR+PG +GPGII+KD N+ RFLGWVSSLINAAFT
Sbjct: 235 AIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFT 294

Query: 240 FQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY 299
           +QGTELVGITAGE+ NPR+TVPRAI KV                  VP++D KL S DSY
Sbjct: 295 YQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSY 354

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
           +S+SPF+IAIENSGT VLPHIFNAVI++TIISAGNSNIYVGSR++YGL+ ++LAP + +R
Sbjct: 355 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFAR 414

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
            T+ GVP+++VL T+ FG LAY+  S   QK F+WLLNIT +AGFF WLFISL+HIRFMQ
Sbjct: 415 ATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQ 474

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFM 478
            L+ R +SR+DLPFKAK+MP  AYY  FF++LIIIIQGFT+F P +N  +F  AYISVF+
Sbjct: 475 VLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFL 534

Query: 479 FIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           F+AIW+ FQ  FR R I    DVDIDTDRR ++  VW E+ P+  WDKFW  +A
Sbjct: 535 FLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPKNAWDKFWAAMA 588

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/513 (64%), Positives = 395/513 (76%), Gaps = 1/513 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
            V+   V+R LK RH                 +STPL NAGPVGALIAY+F+ TLAY V+
Sbjct: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QSLGEMATFIPVTSSF VF+QRF+SPA GAANGYMY+ SW ITFALELSVVGQVIQFWT 
Sbjct: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
           AVPL AWI I WV+L   N+ PVK+YGE EFW+A +KV+AI+GF+IY F MVCGAG TGP
Sbjct: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP 215

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           VGFRYWR+PG +GPGII+KD N+ RFLGWVSSLI+AAFT+QGTELVGITAGEAANPRKTV
Sbjct: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320
           PRAI KV                  VP++D KL S DSY+S+SPF+IAIENSGT VLPHI
Sbjct: 276 PRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FNAVI++TIISAGNS++Y+ SR++Y +  + LAP  L+ TT+ G+P+ AVL TSL G LA
Sbjct: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           Y+E+S G    F+WLLNIT VAGFF W+ IS++HIRFMQAL+ +GISRDDLPFKAK+MP 
Sbjct: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
            AYY  FF+ +IIIIQGFT+F P +N  DF TAY+SV +F A+WI FQ WFR  L  + E
Sbjct: 456 GAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515

Query: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           D+D+DTDRR ++  VW E EP+  W+KFW+ VA
Sbjct: 516 DIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/528 (61%), Positives = 400/528 (75%), Gaps = 1/528 (0%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           +Q+++  ++ +  S       V+R+LK RH                 + +PL NAGPVGA
Sbjct: 32  DQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGA 91

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           LI+YLFM ++AY VTQSLGEMATFIPVTSSFTVF++RF+S   GAANGYMY FSW +T+A
Sbjct: 92  LISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYA 151

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LELS+VGQ+I++WT AVP AAWI+IFWV +T  N+ PVK+YGEF+FW+AL+KVVAI+GFL
Sbjct: 152 LELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFL 211

Query: 186 IYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
           +YC CMVCGAG TGPVGFRYWR+PG +G GII+ D ++ RFLGWVSSL+NAAFT+QGTEL
Sbjct: 212 VYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTEL 271

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPF 305
           VGI+AGE+ANPRKTVP+AI KV                  VP++D KLTS+DSY + SPF
Sbjct: 272 VGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPF 331

Query: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365
           IIAI+NSGT +LP IFNAVI+ATIISA NSN+YVGSR++YGL+  RLAP   +RT +HGV
Sbjct: 332 IIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGV 391

Query: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425
           P VAVL  + FG L Y+  S G  KAF+WLLNIT +AGFF+WLFISL H+RFMQAL+++G
Sbjct: 392 PDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQG 451

Query: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWI 484
           ISRDDLPFKAK MP  AYY  FF+TLIIIIQGFTS  P +N  +F  AYISVFMF+ IW 
Sbjct: 452 ISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWA 511

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            FQ W+R R+I R+E VDID+DRR V+   W   EP   W KFW  +A
Sbjct: 512 VFQCWYRTRIIHRIEHVDIDSDRREVDAQQWDNTEPTTLWGKFWAAMA 559

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/513 (63%), Positives = 398/513 (77%), Gaps = 1/513 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
            V+  +V+R LK RH                 ++ PL NAGPVGALIAY+F+ T+ +SVT
Sbjct: 87  HVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVT 146

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QSLGEM TFIPVTSSFTVFS RF+SPAFGAANGYMYWFSW +TFA+ELSV+G+VIQFWT 
Sbjct: 147 QSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTT 206

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
           AVPLAAWI IFW LLT  NMFPVKYYGE EFW+A +KV++++GFLI+C C+  GAG  GP
Sbjct: 207 AVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGP 266

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
            GFRYWR PGA+GPGIIA+D+++ARFLGWVSSLINAAFT+QGTELVGITAGEAANPRK V
Sbjct: 267 FGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 326

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320
           P+AIKKV+                 VP++D KLTS  S+VS+SPFIIAI+NSG  +LP I
Sbjct: 327 PKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSI 386

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FN VI+ TIISAGNSN+YVGSRI++GL+ S LAP   +RTT+ GVP+VAVL TSLFG+LA
Sbjct: 387 FNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLA 446

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           ++E +T G K FNWLL+I  +AGFF WL ISLSHIRFM+ALE RGISR+ LPFKA +MP 
Sbjct: 447 FLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPW 506

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
           LAYY   F+ LII+IQGFT+F P +N  DF+ +YIS+ +F+ IW  FQA  +CR+ W+VE
Sbjct: 507 LAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVE 566

Query: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           D+D+D+DR+ +E+  W +  P+ FW K W  +A
Sbjct: 567 DIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/513 (64%), Positives = 395/513 (76%), Gaps = 4/513 (0%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +AE V+R LK RH                 +S PL NAGPVG+LIA++ + TLAYSVTQS
Sbjct: 70  QAE-VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQS 128

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGEMATFIPVTSSFTVFSQRF+SPA GAANGYMYWFSW ITFALELS+VGQ+IQ+WT AV
Sbjct: 129 LGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVG 202
           PL AWI+IFWVLL   NMFPVK+YGEFEFWVA +KV+AI+GFLIY  CMVCGAG  GP+G
Sbjct: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIG 248

Query: 203 FRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 262
           FRYWR PG +G GIIAK+ N+ARFLGWVSSLI+AAFT+QGTELVGITAGE  NPRK VPR
Sbjct: 249 FRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPR 308

Query: 263 AIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD--SYVSASPFIIAIENSGTHVLPHI 320
           AI KV                  VPY+D KL  +D  SY++ SPF+IAI N  T VLPHI
Sbjct: 309 AINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHI 368

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FNAVI+ TIISAGNSN+YVGSRI++GLS + LAP   S+TT+HGVP++AVL+T++FG LA
Sbjct: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           Y+  S   Q+ F+WLLNIT +AGF TWL IS+SHIRFMQ L+ RGISRDDLP+KAK+MP 
Sbjct: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPY 488

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
            AYY  FF+T+IIIIQGFT+F P +N  DF  AYISVF+F  +W  FQ  +R +L   ++
Sbjct: 489 AAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLD 548

Query: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +VDID+DRR ++  +W E+EP+  W+KFW V A
Sbjct: 549 EVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/526 (60%), Positives = 399/526 (75%), Gaps = 1/526 (0%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           D  ++++ +  +   +   ++R LK RH                 ++ PL +AGPVG+LI
Sbjct: 30  DGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLI 89

Query: 68  AYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALE 127
           +YLFM +LA+ VTQSLGEMATFIPV SSFTVF++RF+SPA GAANGYMY FSWCITFALE
Sbjct: 90  SYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALE 149

Query: 128 LSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
           LS+VG++IQ+WT  VP AAWI IFWV ++  N+  VK+YGEF+FW+AL+KV+AI+GFLIY
Sbjct: 150 LSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIY 209

Query: 188 CFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVG 247
           C CMVCGAG TGPVGFRYWR+PG +G GII+K K++ RFLGWVSSL+NAAFT+QGTELVG
Sbjct: 210 CLCMVCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVG 269

Query: 248 ITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFII 307
           ++AGE+ANPRKTVP+AI+KV                  VP++D KL ST +Y ++SPFII
Sbjct: 270 VSAGESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFII 329

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367
           AI+NSGT  LP IFNAVI+ TIISA NSN+YVGSR++YGL+   LAP I+ R  +HGVP+
Sbjct: 330 AIQNSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPY 389

Query: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427
           + V + SLFG L Y+  S+G  KAF+WLLNIT +AGFF WLFISL HIRFMQAL+ +GIS
Sbjct: 390 ICVGIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGIS 449

Query: 428 RDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAF 486
           RDDLPFKAK MP  AYY  FF+ LIIIIQGFT+F P +N  +F  AY+SVF+FIA+W+ F
Sbjct: 450 RDDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIF 509

Query: 487 QAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           Q  F+ RLI +VEDVDID+DRR +E  VW + EP   W KFW  +A
Sbjct: 510 QVIFKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/527 (58%), Positives = 390/527 (74%), Gaps = 2/527 (0%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N D  + +   E +  V+   V+R LKQRH                 +STPL NAGPVGA
Sbjct: 75  NGDLDLSDT--EEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGA 132

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           LIAY+FM ++ Y +TQSLGEMATFIPVTSS TVFS+RF+SPAFG  NGYMYWF+W IT+A
Sbjct: 133 LIAYIFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYA 192

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           +E+SVVGQVIQ+WT AVPLAAWI+IFWV +T +N FPVK YGE EFWVA +KV+AI+G+L
Sbjct: 193 VEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYL 252

Query: 186 IYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
           IY   +VCG    GP+GFRYWR+PG +GPGII+KD N+ RFLGWVSSLINAAFT+QGTEL
Sbjct: 253 IYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTEL 312

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPF 305
           VGITAGEAANPRK+VPRAI KVV                 VPY+D  L+S DSY+++SPF
Sbjct: 313 VGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPF 372

Query: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365
           +I+I+N+GT+ LP IFNAV++ TIISA NSN+YVGSR++Y L+ +  AP   +  T+HGV
Sbjct: 373 VISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGV 432

Query: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425
           PW+ V+VT+  G LA++  +     AFNWL+NI+ +AG   W FI+LSHIRFMQAL+ RG
Sbjct: 433 PWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRG 492

Query: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIA 485
           ISRDDLPFKAK MP  AYY  FF+ +II IQGF +F PW+   F T+YIS+ + + ++I 
Sbjct: 493 ISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTPWDTTTFFTSYISLILLVVVFIG 552

Query: 486 FQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            Q ++RCR + +VED+DIDTDRR +E  +W + EP+  W+KFW  VA
Sbjct: 553 CQLYYRCRFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/527 (57%), Positives = 387/527 (73%)

Query: 2   LGGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
           L     D    +   E+  EV    V+R LKQRH                 +STPL  AG
Sbjct: 67  LNSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAG 126

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
           PVG+LIAY+FM T+ Y VTQSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W 
Sbjct: 127 PVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWA 186

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
           IT+A+E+SV+GQVIQ+WT AVPLAAWI+IFWVL+T MN FPVK YGE EFW+A VKV+AI
Sbjct: 187 ITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAI 246

Query: 182 MGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           +G+LIY   +VCG    GP+GFRYWRHPGAFGPGII+K+KN  +FLGWV+SLINAAFT+Q
Sbjct: 247 VGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQ 306

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS 301
           GTELVGITAGEAANPRKTVPRAI KVV                 +PY+D +L++ D+ ++
Sbjct: 307 GTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIA 366

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           +SPF+I+I+N+ T VLP IFNAV++ T++SA NSN+YVGSR++Y L+ +  AP   S  T
Sbjct: 367 SSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVT 426

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           ++GVP++ V+ T+  G LA++  +     AFNWL+NI+ +AG   WLFISL+HIRFMQAL
Sbjct: 427 RYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQAL 486

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIA 481
           + RGISRDDLPFKAK MP  AYY  FF+T+II IQG+ +FCPW+   F T+YIS+ +   
Sbjct: 487 KFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCPWDVSTFFTSYISLILLAV 546

Query: 482 IWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFW 528
           + +  Q ++R R + ++ED+DIDTDRR +E  VW + EP+  WDKFW
Sbjct: 547 LVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFW 593

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/507 (60%), Positives = 382/507 (75%), Gaps = 1/507 (0%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R LKQRH                 ++TPL N+GPVG+LIAYLFM ++ Y +TQSLGEM
Sbjct: 93  VKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLGEM 152

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
           ATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W ITFA+E+SVVGQVI++WT  VPLAA
Sbjct: 153 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKVPLAA 212

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGFRYW 206
           WI+IFWVL+T +N FPVK YGE EFW+A +KV+AIMG+L+Y   +VCG    GP+GFRYW
Sbjct: 213 WIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIGFRYW 272

Query: 207 RHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKK 266
           R+PG +GPGII+KD N  RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAI K
Sbjct: 273 RNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINK 332

Query: 267 VVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIV 326
           VV                 VPY+D +L ST + +++SPF+I+I+N+GT VLP IFNA+++
Sbjct: 333 VVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFNAIVM 392

Query: 327 ATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETST 386
            TIISA NSN+YVGSR++Y L+ S  AP   +  T++GVP++ V+VTS  G LA++  + 
Sbjct: 393 ITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFLVVNN 452

Query: 387 GGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGV 446
               AFNWL+NI+ +AG   WLFIS+SHIRFMQAL+ RGISRDDLPFKAK MP  AYY  
Sbjct: 453 NANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGAYYAT 512

Query: 447 FFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDT 505
           FF+T+II IQGF +F P W+   F T+YIS+ +   ++I  Q ++RCR  WRVED+DID+
Sbjct: 513 FFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDIDIDS 572

Query: 506 DRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           DRR +E  +W + EP+  WDKFW  VA
Sbjct: 573 DRREIEAVIWEDDEPKTLWDKFWAAVA 599

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/532 (57%), Positives = 390/532 (73%), Gaps = 2/532 (0%)

Query: 3   GGHNQDSKMK-EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
             H  ++++  +E      E +   V+R LK RH                 +S PL  +G
Sbjct: 77  ASHPSEARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSG 136

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
           PVG+LIAY+FM T+ Y VTQ+LGEMATFIPVTSS TVFS RF+SPAFG +NGY+YWF+W 
Sbjct: 137 PVGSLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWA 196

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
           IT+A+E+SVVGQVI+FWT  VPLAAWISIFWVL+T +N FPV  YGE EFWVA VKV+AI
Sbjct: 197 ITYAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAI 256

Query: 182 MGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           +G+LIY   +VCG    GP+GFRYWRH  A G G+I+KDKN+ARFLGWV+SLINAAFT+Q
Sbjct: 257 VGYLIYALVIVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQ 316

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS 301
           GTELVGITAGEAANPRK+VPRAI KVV                 VPY+D KL S  SY++
Sbjct: 317 GTELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIA 376

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           +SPF+I+IEN+GT  LPHIFNA+I+ TIISA NSN+YV SR++Y L+ S  AP I +R T
Sbjct: 377 SSPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVT 436

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
             GVP++ V+VT+L G LA++  +    +AFNWL+NI+ +AG   WLFIS+SH+RFM+AL
Sbjct: 437 PQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEAL 496

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFI 480
           + RGISRDDLPFKA++MP  +YY  FF+T+II IQGFT+F P ++   F TAYIS+ +  
Sbjct: 497 KYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLA 556

Query: 481 AIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            ++I  Q ++RCR  W+VED+DIDTDRR ++E VW + EP+  WDKFW  VA
Sbjct: 557 VLFIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/508 (59%), Positives = 388/508 (76%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           + V+R LKQRH                 +STPL NAGPVG+LIAY+FM T+ Y +TQSLG
Sbjct: 104 KHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLG 163

Query: 85  EMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPL 144
           EMATFIPVTSS TVFS+RF+SPAFG +NGYMYWF+W IT+A+E+SV+GQVIQ+WT  VPL
Sbjct: 164 EMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 223

Query: 145 AAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGFR 204
           AAWI+IFWVL+T MN FPVK YGEFEFWVA VKV+AI+G+LIY   +VCG    GP+GFR
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFR 283

Query: 205 YWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 264
           YWR+PGA+GPGII+K+K++ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAI
Sbjct: 284 YWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 343

Query: 265 KKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAV 324
            KVV                 VPY++ +L+ + + +++SPF+I+I+N+GT+ LP IFNAV
Sbjct: 344 NKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAV 403

Query: 325 IVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMET 384
           ++ T+ISA NSN+YVGSR++Y L+ S  AP      T+ GVP++ VL T+  G LA++  
Sbjct: 404 VLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVV 463

Query: 385 STGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYY 444
           +     AFNWL++I+ +AG   WLFISL+HIRFMQAL+ RGISRDDLPFKAK MP  AYY
Sbjct: 464 NNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYY 523

Query: 445 GVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDID 504
             FF+T+II IQGF +FCP++  +F T+YIS+ +   ++I+ Q +++CR IW++ED+DID
Sbjct: 524 ASFFVTIIIFIQGFQAFCPFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 505 TDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +DRR +E  +W + EP+  W+KFW  VA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/510 (59%), Positives = 383/510 (75%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E + VRR LKQRH                 +STPL NAGPVG+LIAY+FM T+ Y VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGEMATFIPVTSS TVFS+RF+SPAFG +NGYMYWF+W IT+A+E+SV+GQVI++WT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVG 202
           PL  WI+IFWVL+T MN FPVK YGEFEFWVA VKV+AIMG+LIY   +VCG    GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 203 FRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 262
           FRYWR+PGA+GPGII+ DKN+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 263 AIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFN 322
           AI KVV                 VPY D +L+++ + +++SPF+I+I+N+GT+ LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 323 AVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYM 382
           A+++ T+ISA NSN+YVGSR++Y L+ +  AP      T+ GVP++ VL T+  G LA++
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 383 ETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLA 442
             +     AFNWL+NI+ +AG   WLFISLSHIRFMQAL  RGISRDDLPFKAK+MP  A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 443 YYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVD 502
           YY  FF+T+II IQGF SFCP+   DF T+YIS+ +   ++   Q +++CR IW++ED+D
Sbjct: 522 YYASFFVTVIIFIQGFQSFCPFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDID 581

Query: 503 IDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           ID+DRR +E  +W + EP+  W+KFW  VA
Sbjct: 582 IDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/510 (59%), Positives = 384/510 (75%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E + V+R LKQRH                 +STPL  AGPVG+LI+Y+FM T+ Y +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W IT+A+E+SV+GQVIQ+WT  V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVG 202
           PLA WI+IFWVL+T MN FPVK YGEFEFWVA VKV+AIMG+LIY   +VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 203 FRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 262
           FRYWR+PGA+GPGII+ DKN+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 263 AIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFN 322
           AI KVV                 VPY++ +L+++ + +++SPF+I+I+N+GT+ LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 323 AVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYM 382
           AV++ T+ISA NSN+YVGSR++Y L+ +  AP      T+ GVP++ VL T+  G LA++
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 383 ETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLA 442
             +     AFNWL+NI+ +AG   WLFISL+HIRFMQALE RGISRDDLPFKAK MP  A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 443 YYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVD 502
           YY  FF+T+II IQGF +FCP+   DF T+YIS+ +   ++   Q +++CR IW++ED+D
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCPFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDID 582

Query: 503 IDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           IDTDRR +E  +W + EP+  W+KFW  VA
Sbjct: 583 IDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/528 (57%), Positives = 391/528 (74%), Gaps = 4/528 (0%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H  D    EE        E + V+R LKQRH                 +STPL NAGPVG
Sbjct: 88  HETDINEDEE----EAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVG 143

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           +LIAY+FM T+ Y VTQSLGEMATFIPVTSS TVFS+RF+SPAFG +NGYMYWF+W IT+
Sbjct: 144 SLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITY 203

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           A+E+SV+GQVI++WT  VPLAAWI+IFWV++T MN FPVK YGEFEFWVA VKV+AIMG+
Sbjct: 204 AVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGY 263

Query: 185 LIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           LIY   +VCG    GP+GFRYWR+PGA+GPGII+ DK++ RFLGWVSSLINAAFT+QGTE
Sbjct: 264 LIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTE 323

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
           LVGITAGEAANPRKTVPRAI KVV                 VPY+D +L+++ + +++SP
Sbjct: 324 LVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSP 383

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+I+I+N+GT+ LP IFNAV++ T++SA NSN+YVGSR++Y L+ +  AP      T+ G
Sbjct: 384 FVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQG 443

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           VP++ V+ T+  G LA++  +     AFNWL+NI+ +AG   WLFISL+HIRFMQAL+ R
Sbjct: 444 VPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHR 503

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWI 484
           GISRDDLPFKAK MP  AYY  FF+T+II IQGF +FCP+   +F T+YIS+ +   ++I
Sbjct: 504 GISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLILLAVVFI 563

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
             Q +++CR IW++ED+DID+DRR +E  +W + EP+  W+KFW  VA
Sbjct: 564 GCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/512 (59%), Positives = 387/512 (75%), Gaps = 1/512 (0%)

Query: 22  VEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQ 81
           V    V+R LKQRH                 +STPL N+GPVGALIAY+FM T+ Y VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 82  SLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
           SLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W IT+A+E+SV+GQVIQ+WTF 
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV 201
           VPLAAWI IFWVL+T MN FPVK YGEFEFWVA +KV+AI+G+LIY   +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           GFRYWR+PGA G GII+ D  +ARFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
           RAI KVV                 VPY+D +L+++ + +++SPF+I+I+N+GT VLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAV++ T+ISA NSN+YVGSR++Y L+ S  AP   +  T+HGVP++ V+ T+L G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  +     AFNWL+NI+ +AG   WLFISL+HIRFMQAL+ RGISRDDLPFKAK+MP  
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 442 AYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED 500
           AYY  FF+T+II IQGF +F P ++  +F TAYIS+ + + ++   Q ++RCR +W++ED
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 501 VDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +DID+DRR ++  VW + EP+  W+KFW  VA
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/529 (57%), Positives = 387/529 (73%), Gaps = 6/529 (1%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+ +    EE      + +   V+R LKQRH                 ++TPL NAGPVG
Sbjct: 87  HDDEESDTEE-----AQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVG 141

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           +LIAY+FM ++ Y VTQSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W IT+
Sbjct: 142 SLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITY 201

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           A+E+SV+GQVIQ+WT AVPLAAWI IFWV++T MN FPVK YGEFEFW+A +KV+AIMG+
Sbjct: 202 AVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGY 261

Query: 185 LIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           LIY   +VCG    GP+GFRYWR+PG +GPGII+    +ARFLGWVSSLINAAFT+QGTE
Sbjct: 262 LIYALIIVCGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTE 321

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
           LVGITAGEAANPRK+VPRAI KVV                 VP++D +L +  + +++SP
Sbjct: 322 LVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSP 381

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+I+I+N+GT  LP IFNAV++ TIISA NSN+YVGSR++Y L+ +  AP I S  T++G
Sbjct: 382 FVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYG 441

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           VP++ V+ T+  G LA++  +     AFNWL+NI+ +AG   WLFISLSHIRFMQAL+ R
Sbjct: 442 VPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYR 501

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIW 483
           GISRDDLPFKAK MP  AYY  FF+T+II IQGF +F P ++   F T+YIS+ +   ++
Sbjct: 502 GISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLF 561

Query: 484 IAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
              Q ++RCR IW+VED+DID+DRR +E  +W E EP+  W+KFW  VA
Sbjct: 562 SGCQLYYRCRFIWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/507 (59%), Positives = 383/507 (75%), Gaps = 1/507 (0%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R LKQRH                 +S PL N+GPVG+LIAYLFM ++ YS+TQSLGEM
Sbjct: 101 VKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEM 160

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
           ATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W IT+A+E+SVVGQVI++WT  VPLAA
Sbjct: 161 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVPLAA 220

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGFRYW 206
           WI+IFWV +T MN FPVK YGE EFW+A +KV+AI G+L+Y   +VCG    GP+GFRYW
Sbjct: 221 WIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIGFRYW 280

Query: 207 RHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKK 266
           R+PG +G GII+KDKN +RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI K
Sbjct: 281 RNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINK 340

Query: 267 VVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIV 326
           VV                 VPYDD +L+S  + V++SPF+I+I+N+GT +LP IFNA+++
Sbjct: 341 VVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFNAIVM 400

Query: 327 ATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETST 386
            T+ISA NSN+YVGSR++Y L+ +  AP   +  T+HGVP++ VL T+  G LA++  + 
Sbjct: 401 ITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVVNN 460

Query: 387 GGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGV 446
               AFNWL+NI+ +AG   WLFIS+SHIRFMQAL+ RGISRDDLPFKAK+MP  AYY  
Sbjct: 461 NANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYYAT 520

Query: 447 FFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDT 505
           FF+T+II IQGF +F P ++   F TAYIS+ +   ++I  Q ++RCR  W++ED+DIDT
Sbjct: 521 FFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDIDIDT 580

Query: 506 DRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           DRR +EE +W + EP+ +WDKFW  VA
Sbjct: 581 DRREIEEVIWEDDEPKTYWDKFWAAVA 607

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/528 (58%), Positives = 392/528 (74%), Gaps = 2/528 (0%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N    ++EE  E         V+R LKQRH                 ++TPL NAGPVG+
Sbjct: 47  NVCDGLEEEDAE-EAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGS 105

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           LIAYLFM ++ Y +TQSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W IT+A
Sbjct: 106 LIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYA 165

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           +E+SV+GQVIQFWT AVPLAAWI+IFWV ++ +N FPVK YGE EFWVA +KV+AI+G+L
Sbjct: 166 VEISVIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYL 225

Query: 186 IYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
           IY   +VCG    GP+GFRYWR+PG +GPGII+ DKN+ RFLGWVSSLINAAFT+QGTEL
Sbjct: 226 IYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTEL 285

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPF 305
           VGITAGEAANPRK+VPRAI KVV                 VP++D +L S  + +++SPF
Sbjct: 286 VGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPF 345

Query: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365
           +I+I+N+GT VLPHIFNAV++ TIISA NSN+YVGSR++Y LS +  AP      T+HGV
Sbjct: 346 VISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGV 405

Query: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425
           P++ V+ TSL G LA++  +     AFNWL+NI+ +AG   WLFISLSHIRFMQAL+ RG
Sbjct: 406 PYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRG 465

Query: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWI 484
           ISRDDLPFKAK MP  AYY  FF+T+II IQGF +F P ++   F TAYIS+ + + + I
Sbjct: 466 ISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLI 525

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
             Q ++RCR +W++ED+DIDTDRR +E  +W E+EP+  W+KFW+++A
Sbjct: 526 GCQLYYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/537 (57%), Positives = 390/537 (72%), Gaps = 12/537 (2%)

Query: 5   HNQDSKMKEEI---REISVEVEA------ETVRRELKQRHXXXXXXXXXXXXXXXXXVST 55
           H++     E I   +E   EVE+        V+R+LK RH                 +++
Sbjct: 31  HHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIAS 90

Query: 56  PLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYM 115
           P+  AGPVG+L+AYLFM T+A+ VTQSLGEMATFIPVTSSFT+++QRF+SPA GAANGY+
Sbjct: 91  PIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYL 150

Query: 116 YWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
           YWFSWC+TFALELS++GQ+IQ+WTFAVPL+ WI +FW+LLT  NM PV++YGE EFW+A 
Sbjct: 151 YWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAA 210

Query: 176 VKVVAIMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLIN 235
           +KV++I GFLIY   MVCG    G +GFRYW++PG +G G+I+ +K +ARFLGWVSSLI 
Sbjct: 211 LKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIK 270

Query: 236 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-T 294
           AAFT+QGTELVGITAGE+ NPRKTVP+AI KV                  VPY D +L T
Sbjct: 271 AAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLST 330

Query: 295 STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAP 354
           ++DS ++ SPF++AI+NSGT VLP +FN VI+ TI+SAGNSNIY+GSR++YGLS S LAP
Sbjct: 331 TSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP 390

Query: 355 GILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSH 414
            +  +T + GVP+ AVL +S+FG LAY+  S   +K F+WLL IT VAGFF WL ISLSH
Sbjct: 391 SLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSH 450

Query: 415 IRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAY 473
           IRFMQ L+ RGISR+DLPFKAK+MP  AYY  FF+T+II+IQGF SF P +   +F+  Y
Sbjct: 451 IRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADY 510

Query: 474 ISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWI-EQEPRGFWDKFWN 529
           ISVF+FI  W+ FQ  F+ RLI R EDVDIDTDRR ++  VW  + EP+    K W 
Sbjct: 511 ISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/536 (55%), Positives = 393/536 (73%), Gaps = 16/536 (2%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H++D++          + E + V+RELKQRH                 ++TPL +AGPVG
Sbjct: 70  HDEDAE--------EADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVG 121

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           ALIAY+FM ++ Y VTQ+LGEMATFIPVTSS TVFSQRF+SPAFG ANGYMYWF+W ITF
Sbjct: 122 ALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITF 181

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           A+E+SVVGQVIQ+WT AVPLAAWI+IFWVL+T MN FPVK YGE EFWVA +KV+AI+G+
Sbjct: 182 AVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGY 241

Query: 185 LIYCFCMVC-GAGVTGPVGFRYWRHPGAFGPGI------IAKDKNQARFLGWVSSLINAA 237
           L+Y   +VC G+   GP+GFRYWR+PGA+G G+      I   K + RFLGWV+SLINAA
Sbjct: 242 LLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAA 301

Query: 238 FTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD 297
           FT+QGTELVGITAGEAANPRKTVPRAI KVV                 VP+ D +L+   
Sbjct: 302 FTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDT 361

Query: 298 SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 357
           + +++SPF+I+IEN+GT +LP IFNA+++ T++SA NSN+YVGSR++Y L+ +++AP I 
Sbjct: 362 TVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIF 421

Query: 358 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 417
           +R T+ GVP++ V+ TSL G LA++        AFNWL++I+ +AG   WLFISL+H+RF
Sbjct: 422 ARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRF 481

Query: 418 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISV 476
           MQ L+ RGISRDDLPFKAK+MP  +YY  F++ +II +QGF +F P ++   F T YIS+
Sbjct: 482 MQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISL 541

Query: 477 FMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
            +   ++I  Q ++RCR +W++EDVDID+DRR +E+A+W + EP+  WDKFW  +A
Sbjct: 542 ILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/529 (57%), Positives = 390/529 (73%), Gaps = 4/529 (0%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+ D+   E+      E E   V+R LK RH                 +++PL  +GPVG
Sbjct: 37  HSGDNAPCEKGEGDCRETE---VKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVG 93

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           ALIAY+F+ ++ Y VTQSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W IT+
Sbjct: 94  ALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITY 153

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           A+E++VVGQVIQ+WT AVPLAAWI+IFWVL+T  N FPVK+YGE EFWVA VKV+AI+G+
Sbjct: 154 AVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGY 213

Query: 185 LIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           LIY   +VCG    GP+GFRYWR+PG +GPGII+KD N+ RFLGWVSSLINAAFT+QGTE
Sbjct: 214 LIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTE 273

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
           LVGITAGEAANPRKTVPRAI KV                  VPYDD +L++T + +++SP
Sbjct: 274 LVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSP 333

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+I+I+N+GT VLPHIFNA+++ TIISA NSN+YVGSR++Y L+ S  AP      T+ G
Sbjct: 334 FVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQG 393

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           VP++ V+VT+L G LA++  +    +AFNWL+NI+ +AG   WLFISLSH+RFMQ L+ R
Sbjct: 394 VPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHR 453

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIW 483
           GISR+DLPFKAK MP  AYY  FF+ +IIIIQGF +F P +   DF T+YIS+ +   ++
Sbjct: 454 GISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLF 513

Query: 484 IAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           +  Q ++RCR IW ++D+DID+DRR ++  VW + EP+  W+KFW  VA
Sbjct: 514 LGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/521 (54%), Positives = 379/521 (72%), Gaps = 2/521 (0%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E  E   +     V+R LK RH                 +++PL  AGPVG+LIAY+FM 
Sbjct: 47  EEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMG 106

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ YS+TQSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W ITFA+ELSVVGQ
Sbjct: 107 TVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQ 166

Query: 134 VIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC 193
           +I +WT  VPL AWI+IFW+++T +N FPV++YGE EFW+A VKV+ I+G+LIY F +VC
Sbjct: 167 IINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVC 226

Query: 194 GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEA 253
           G    GP+GFR WR+PG +G G+I+ ++ +ARFLGWVSSLI AAFT+QGTELVGITAGE+
Sbjct: 227 GGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGES 286

Query: 254 ANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST-DSYVSASPFIIAIENS 312
            NPRKTVP+AI KV                  VPY+D ++ +T D+ V+ASPF+I+I N+
Sbjct: 287 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNA 346

Query: 313 GTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLV 372
           GT +LP IFNAV++ T++SA NSN+Y+GSR++Y L+ S  AP       +HGVP + V+V
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 373 TSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLP 432
           T+L G +A++  +   + AFNWL+NI+ +AG   WLFISL+HIRFMQ L+ RGISRD LP
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 433 FKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFR 491
           FKAK+MP  AYY   F+ +II IQG+T+F P ++   F TAYIS+ + + ++I  Q +++
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYK 526

Query: 492 CRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           CR +W++ED+DIDT+RR ++  VW + EP+  WDKFW+ +A
Sbjct: 527 CRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/513 (55%), Positives = 374/513 (72%), Gaps = 1/513 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           +++   V+R LK RH                 +++PL  +GPVGALIAY+FM T+ Y VT
Sbjct: 109 DMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVT 168

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QS+GEMATFIPVTSS TVFS RF+SPAFG ANGYMYWF+W ITFA+ELSV GQVI++WT 
Sbjct: 169 QSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTE 228

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
           AVP AAWI+IFWVL+T  N FPV++YGE EFWVA +KV+AI+G+LIY   +VCG    GP
Sbjct: 229 AVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQGP 288

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +GFRYWR+PG +G GII+KDK++ RFLGWV+SLINA+FT+QGTELVGITAGEAANPR+TV
Sbjct: 289 IGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTV 348

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320
           PRAI KV                  VPY+   L  T + +++SPF+I+I+N+GT  LP I
Sbjct: 349 PRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRALPDI 408

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
           FNAV++ TIISA NSN+YVGSR+++ L+ + +AP + S  T  GVP++ V+VTSL G LA
Sbjct: 409 FNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLA 468

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           ++  +    +AFNWL+NI+ +AG   WLFIS+SHIRFMQ L+ RGISRDDLPFK+K MP 
Sbjct: 469 FLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPY 528

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499
            AYY  F++T+II +QGF +F P +   +F T+YIS+ + + ++   Q ++RCR   R+E
Sbjct: 529 GAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLE 588

Query: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           D+DID+DRR  +  +W + EP   W KFW  VA
Sbjct: 589 DIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/531 (53%), Positives = 377/531 (70%), Gaps = 5/531 (0%)

Query: 3   GGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           GG   +S  +++      +++   V+R LK RH                 +++PL +AGP
Sbjct: 34  GGSGHNSSFEDD----EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGP 89

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
           VGALIAY+FM ++ Y VTQS+GEMATFIPVTSS TVFS RF+SPAFG ANGYMYWF+W I
Sbjct: 90  VGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAI 149

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
           T+A+E+SV+GQVIQ+WT AVPLAAWI IFWV +T  N FPV++YGE EFWVA +KV+AI+
Sbjct: 150 TYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIV 209

Query: 183 GFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           G+L+Y   +VCG    GP+GFRYWR+PG +G GII+ DK++ RFLGWV+SLINA+FT+QG
Sbjct: 210 GYLLYALIIVCGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQG 269

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA 302
           TELVGITAGEAANPRKTVP+AI KV                  VPY+   L    S +++
Sbjct: 270 TELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIAS 329

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SPF+I+I+++GT +LP IFNAV++ TIISA NSN+YVGSRI++ L+ + +AP   S  T 
Sbjct: 330 SPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTN 389

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            GVP++ V+ T+L G LA++       + FNWL+NI+ +AG   WLFIS+SHIRFMQ L+
Sbjct: 390 QGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLK 449

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIA 481
            RGISRDDLPFK+K MP  AYY  F++ +II +QGF +FCP +   +F T YIS+ +   
Sbjct: 450 QRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAV 509

Query: 482 IWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           ++   Q ++RCR   R+ED+DID+DRR ++  +W E+EP   W KFW  VA
Sbjct: 510 VFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/533 (54%), Positives = 385/533 (72%), Gaps = 7/533 (1%)

Query: 7   QDSKMKEEIREISVEVEAE------TVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
            D ++  E+ + +   E E       V+R LK RH                 ++ PL  +
Sbjct: 47  SDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLS 106

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120
           GPVG+LIAY+FM ++ Y VTQSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W
Sbjct: 107 GPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNW 166

Query: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
            IT+A+ELSV+GQ+I +WT AVPLAAWI+IFWVLLT  N FPVK+YGEFEF VA +KV+A
Sbjct: 167 AITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIA 226

Query: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           I+G+L+Y   +VCG    GP+GFRYWR+PG +G G IAK+ N+ARFLGWV SL+NA+FT+
Sbjct: 227 IVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTY 286

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV 300
           QGTELVGITAGEA+NPRKTVP+AI KV                  VPY+  +L S  + +
Sbjct: 287 QGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVI 346

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           ++SPF+I+I+N+GT VLP IFNAV++ TI+SAGNSN+YVGSR++Y L+ S  AP   S  
Sbjct: 347 ASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYV 406

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
           T+ GVP++ V+ T+L G LA++ T+     AFNWL+NI+ +AG   W FIS++HIRFMQ 
Sbjct: 407 TKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQC 466

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMF 479
           L++RGISRD LPFKAK MP  AYY  FF+ LI+ IQGFT+F P ++  +F TAYIS+ + 
Sbjct: 467 LKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILL 526

Query: 480 IAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           + ++I  Q ++RCR + ++ED+DID+DRR ++  +W + EP+  W+KFW  +A
Sbjct: 527 VVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/506 (55%), Positives = 365/506 (72%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R LK RH                 +S PL  +GPVG+LIAY+FM ++ Y VTQSLGEM
Sbjct: 102 VKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSLGEM 161

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
           ATFIPVTSS TVF++RF+SPA G +NGYMYWF+W ITFA ELSV GQ+IQ+WT+ VPLAA
Sbjct: 162 ATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKVPLAA 221

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGFRYW 206
           WI IFWV++  +N FPVK YGE EFWV+ VKV+AI+G+LIY   +VCG    GP+GFRYW
Sbjct: 222 WIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQGPIGFRYW 281

Query: 207 RHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKK 266
           RH  AFG G I+K+K++ARFLGWVSSLINAAFT+QGTELVGI+AGEAANPRKTVPRAI K
Sbjct: 282 RHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTVPRAINK 341

Query: 267 VVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIV 326
           V+                 VPY+D +L+   + +++SPF+I++ N+GT  LP IFNAVI+
Sbjct: 342 VIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALPDIFNAVIL 401

Query: 327 ATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETST 386
            T++SA NS++Y+ SR++Y L+    AP   +   ++GVP++ V VT L G LA++  S 
Sbjct: 402 ITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFLVVSN 461

Query: 387 GGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGV 446
               AFNWL+NI+ +AG   W FI  +HIRFMQAL+ +GISRDDLPFKA++MP  AYY  
Sbjct: 462 NANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMPWGAYYAA 521

Query: 447 FFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTD 506
           FF+ LII IQG+ +F PW+   F T+YIS+ +F  +++    ++R RL+ ++ED+DIDTD
Sbjct: 522 FFVGLIIFIQGYDAFTPWDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIKIEDIDIDTD 581

Query: 507 RRAVEEAVWIEQEPRGFWDKFWNVVA 532
           R+ VE  VW E  PR +W+KFW  VA
Sbjct: 582 RKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/518 (56%), Positives = 375/518 (72%), Gaps = 2/518 (0%)

Query: 13  EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
            E+  +  +     V+RELK RH                 +++P+ NAGPVG+L+AY+F+
Sbjct: 35  SEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFV 94

Query: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132
           AT+AY VTQSLGEMATFIPVTSSFTVF+ RFVSPA GAANGY+YW SWCITFALE+SV+G
Sbjct: 95  ATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIG 154

Query: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
           ++I +W+ AVP+ AW++IFWVLLT +N+ PVK+YGEFEFW+A +KV+AI+ FL Y   +V
Sbjct: 155 RLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV 214

Query: 193 CGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGE 252
           CG    G +GFRYW+ PG +G GI++++ + A+FLGWVSSLI AAFTFQGTELVG+TAGE
Sbjct: 215 CGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGE 274

Query: 253 AANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV--SASPFIIAIE 310
             NPR+TVP+AI  V                  V YDD +L    S    +ASPF++AI 
Sbjct: 275 TKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAIN 334

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
            +GT VLP I N VI+ TIISAGNSNIYVGSR++YGL  S LAP  +SRTT  GVP+VAV
Sbjct: 335 AAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAV 394

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           L TS+FGAL Y+  S+     F+WLL+IT V+GFFTWL IS+SHIRFMQ L+ RGISRDD
Sbjct: 395 LATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDD 454

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWF 490
           LPFKAK+MP  AYY  FF+ +II++QGFT+F P++ +DF+  YIS F+F+ IW+ FQ  F
Sbjct: 455 LPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLF 514

Query: 491 RCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFW 528
           + R    V+++DIDTDRR ++  +W + +P   W K W
Sbjct: 515 KGRWFHTVDEIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/515 (54%), Positives = 368/515 (71%), Gaps = 3/515 (0%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           + +   V+R LK RH                 +++PL  AGPVG+L+AY+F+ T+ YS+T
Sbjct: 49  DYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSIT 108

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           QSLGEMATFIPVTSS TVFS+RF+SPAFG ANGYMYWF+W ITFA+ELSVVGQ+IQ+WT 
Sbjct: 109 QSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTD 168

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            VP+AAWI IFWVL+T +N FPV++YGE EFW+A VKV+ I+G+LIY F +VCG    GP
Sbjct: 169 RVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGP 228

Query: 201 VGFRYWRHPGAFGPGIIAK-DKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
           +G        A G    ++  + +  FLGWVSSLI AAFT+QGTELVGITAGE+ NPRK 
Sbjct: 229 IGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKN 288

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIENSGTHVLP 318
           VP+AI KV                  VPYDD +L S  S  V+ASPF+I+I+N+GT +LP
Sbjct: 289 VPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILP 348

Query: 319 HIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGA 378
            IFNAV++ T+ISA NSN+Y+GSR+ Y L+ +  AP  L+  T+ GVP+  VL+TSL G 
Sbjct: 349 DIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGL 408

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           ++++  +     AF+WL+NI+ +AG   WLFISL+HIRFMQ L+ RGISRDDLPFKAK+M
Sbjct: 409 MSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFM 468

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWR 497
           P  AYY  FF+T+II IQG+T+F P ++   F T+YIS+F+ + ++I  Q +++CR +W 
Sbjct: 469 PWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWA 528

Query: 498 VEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532
           VED+DID+DRR ++  VW E EP+  WDKFW+ VA
Sbjct: 529 VEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/514 (34%), Positives = 291/514 (56%), Gaps = 11/514 (2%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           +DS+ +++  +   + E   +R++LK RH                     L  AGP+   
Sbjct: 67  EDSEKQDDYMDDGKD-EHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMF 125

Query: 67  IAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
           IAY F+  L +    +LGEMA++IP+   FT ++ R+  PA G A GY Y   + I    
Sbjct: 126 IAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPN 184

Query: 127 ELSVVGQVIQFW--TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           +L+    VIQ+W     V    WI+IF V++  MN   VK++GEFEFW++  KV+ ++G 
Sbjct: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244

Query: 185 LIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
           +I  F ++ G G T   +GFR++ HPGAF P   + D ++ +F+ +V+ L+ A F + G 
Sbjct: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGI 304

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD---WKLTSTDSYV 300
           EL GI A EAANPRK++P+AIK  +                 V YDD    K  ++ +  
Sbjct: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGA 364

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           +ASP+++AI NSG   LPHIFNA ++  + SA NS++YV SR +YGL+    AP I + T
Sbjct: 365 AASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + GVP+ ++L++S F  LAYM  S+G  K FN+ +N+  + G  +W+ I ++++ F +A
Sbjct: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFM 478
           ++ + + R    ++A + P  +Y+ + F  LI  I+ FT F    ++  +F+T YI + +
Sbjct: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPV 544

Query: 479 FIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEE 512
           F+  +  ++ + +   IW+ E+VD+ T + A++E
Sbjct: 545 FVISYFGYK-FVKKTKIWKPEEVDLYTFKAAIDE 577

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  307 bits (787), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 180/530 (33%), Positives = 292/530 (55%), Gaps = 17/530 (3%)

Query: 6   NQDSKMKEEIREISVEVEAETVR--RELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPV 63
           NQD    +E   ++++ + + +R  +EL+ RH                   T L  AGPV
Sbjct: 33  NQDDISSQE-SHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPV 91

Query: 64  GALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
             LIAY F+  L Y V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I 
Sbjct: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLII 150

Query: 124 FALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
              +L+    V+Q+W     V    WI+IF V++  +N+  VK++GEFEFW++  KV+ +
Sbjct: 151 TPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVM 210

Query: 182 MGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           +  ++  F ++ G G +   +GFR+++ PGAF P   A   ++ +F+ +V+  + A F +
Sbjct: 211 LCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY 270

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD---WKLTSTD 297
            GTEL GI A E  NPR+ VPRAIK  +                 V Y+D    +     
Sbjct: 271 LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKS 330

Query: 298 SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 357
           +  +ASPF++AI+N+G  VLPHIFNA ++  + SA NS++YV SR +YGL+    AP I 
Sbjct: 331 TSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIF 390

Query: 358 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 417
           ++T + GVP+ ++++  LF  LAYM  S+G  + FN+ +N+  + G  +W+ I +++I F
Sbjct: 391 AKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYF 450

Query: 418 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYIS 475
            +AL  +G+ +  L + A      AY+ +FF  LI +I+ FT F    ++  +F+T YI 
Sbjct: 451 DRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIG 510

Query: 476 VFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWD 525
           + +FI  +  ++ + R     + E+ D+ T     +E + +E+E    WD
Sbjct: 511 IPVFIICFFGYK-YIRGTKFVKPEEADLYT----FKELIDLEEEEGKLWD 555

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  303 bits (775), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 182/509 (35%), Positives = 277/509 (54%), Gaps = 14/509 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   +R++LK RH                   T L+  GPV  LIAY F+  L +     
Sbjct: 78  ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMAC 137

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA- 141
           LGEMA++IP+   FT ++ R+V PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196

Query: 142 -VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKV-VAIMGFLIYCFCMVCGAGVTG 199
            V    WI+IF V++  +N+  VK++GEFEFW++  KV V +   L+    M+ G     
Sbjct: 197 RVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHD 256

Query: 200 PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
            +GFRYWR PGAF     A    + +F+ +V+  + + F++ G EL GI   EA NPRK+
Sbjct: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY---VSASPFIIAIENSGTHV 316
           VP+AIK  V                 V Y+D +L ST       +ASPF++AI+NSG  V
Sbjct: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376

Query: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376
           LPHIFNA ++  + SA NS++YV SR +Y L+    AP I ++T++ GVP+ A++++ LF
Sbjct: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436

Query: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436
             LAYM  S+G  K FN+ +N+  + G  +W+ I + +I F +A   +GI +    + A 
Sbjct: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496

Query: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494
                AY+ +FF  LI +I+ FT F    ++   F+T YI + ++I  W  ++  ++ ++
Sbjct: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556

Query: 495 IWRVEDVDIDTDR----RAVEEAVWIEQE 519
           I +  DVD+ T +    R  EE    +QE
Sbjct: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQE 584

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  303 bits (776), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 179/555 (32%), Positives = 300/555 (54%), Gaps = 38/555 (6%)

Query: 2   LGGHNQDSKMKEEIREISVEVE----------------------AETVRRELKQRHXXXX 39
           +G +++D   K + ++ ++++E                       + +++ L+ RH    
Sbjct: 52  MGDYSKDYYEKSQYQQQNLDIESNISSLSSTTSITSTGGSSPKHTDGLKKNLQARHVSMI 111

Query: 40  XXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVF 99
                          T L  AGP    IAY F+  L +    ++GEMA++IP+   FT +
Sbjct: 112 AIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEMASYIPM-DGFTSY 170

Query: 100 SQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTG 157
           + R+V PA G A GY Y F + I    +L+    VIQ+W     V    WI+IF V++  
Sbjct: 171 ASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVI 230

Query: 158 MNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGI 216
           +N+  VK++GEFEFW++  KV+ ++G ++  F ++ G G     +GFRYW+HPGAF P  
Sbjct: 231 INVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFRYWQHPGAFKPYS 290

Query: 217 IAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXX 276
            A D +  +F+ +VS  + A F + G EL GI A EA NPRK+VPRA+K  V        
Sbjct: 291 DAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYL 350

Query: 277 XXXXXXXXXVPYDDWKLTSTD---SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAG 333
                    V Y+D +L +     +  +ASPF++AI+NSG  VLPHIFNA ++  + SA 
Sbjct: 351 VTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIFNACVLIFVFSAC 410

Query: 334 NSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFN 393
           NS++YVGSR +Y L+    AP I  RTT  G+P  ++ V  LF  LAYM  S+G  + FN
Sbjct: 411 NSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFN 470

Query: 394 WLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLII 453
           + +N+  + G  +W+ I +++I FM+A++++G+ R    + A + P   Y+ + +   I 
Sbjct: 471 YFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIA 530

Query: 454 IIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDT-----D 506
            I+ FT F    ++  +F+T YI + +F+  +  ++   + +++ +  +VD+ T     D
Sbjct: 531 FIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KSHEVDLFTGKEVFD 589

Query: 507 RRAVEEAVWIEQEPR 521
           ++ +E  + ++QE +
Sbjct: 590 QQEIEGKI-LDQEKQ 603

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  301 bits (770), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/532 (34%), Positives = 283/532 (53%), Gaps = 15/532 (2%)

Query: 4   GHNQDSK-MKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           GH  D K +     E   + +   +++ L+ RH                   + L  AGP
Sbjct: 55  GHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGP 114

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
              LIAY F+  L + V   LGEMA +IP+   FT +S R+  PA G A GY Y F + I
Sbjct: 115 AAILIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWI 173

Query: 123 TFALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
               +L+    VIQ+W     V    WI+I  V +  +N   V+++GE E++++ VK+  
Sbjct: 174 IVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITV 233

Query: 181 IMGFLIYCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 239
           ++G +I    + CG G    V GF+YW++PGAF     A    + RF+ + S  + A F 
Sbjct: 234 MLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFA 293

Query: 240 FQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDS- 298
           + GTEL GI   E  NPRK VP+AIK  +                 VP++D  L S  S 
Sbjct: 294 YLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSA 353

Query: 299 --YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356
               SASPF++AI N+G  VLPHI NA I+  + SA NS++YV SR +YGL+    AP I
Sbjct: 354 KTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRI 413

Query: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416
            ++T + GVP+ ++LV  LF  LAYM  S+G  + F + +N   + G  +W+ I +++IR
Sbjct: 414 FAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIR 473

Query: 417 FMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYI 474
           F +A  ++GI +  L +++   P  A++ +FF  LI +I+ F +F    ++   F+T YI
Sbjct: 474 FDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYI 533

Query: 475 SVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDK 526
            +  +I  +I ++ W++ ++I   E+VD+     + +EAV +E+E     D+
Sbjct: 534 GIPTYIISYIGYKLWYKTKIIPS-EEVDL----VSFKEAVDLEEEEGKMLDE 580

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  299 bits (765), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 177/510 (34%), Positives = 286/510 (56%), Gaps = 14/510 (2%)

Query: 14  EIREISVEVEAE----TVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAY 69
           ++R +S  V+ +     +++EL+ RH                   + L +AGPV  LI+Y
Sbjct: 33  QVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISY 92

Query: 70  LFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129
            F+  L Y+V   LGEMA FIP+   FT ++ R+V PA G A GY Y F + I    +L+
Sbjct: 93  SFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151

Query: 130 VVGQVIQFWTFA--VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
               V+QFW     V    WI+IF  L+  +N   V+++GEFEFW++ VKV+ ++G ++ 
Sbjct: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILL 211

Query: 188 CFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELV 246
            F ++ G G      GFR+WR PGAF P   A   ++ +F+ + S    A F + GTEL 
Sbjct: 212 LFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELC 271

Query: 247 GITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD---SYVSAS 303
           GI A EA NPR++VPRAIK  +                 V Y+D +L       +  +AS
Sbjct: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAAS 331

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           PF++AIEN+   VLPHIFN  ++  + SA NS++YV SR +YGL+    AP I + T + 
Sbjct: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           GVP+ ++ ++ LF  LAYM  S+G  + FN+ +N+  + G  +W+ I +++IRF +A+ +
Sbjct: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIA 481
           +   +  L + A + P   Y  +FF  LI +I+ +T F    ++   F++ YI + +++ 
Sbjct: 452 QFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLI 511

Query: 482 IWIAFQAWFRCRLIWRVEDVDIDTDRRAVE 511
            ++ ++  +R +LI + EDVD+ T + A++
Sbjct: 512 CYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  300 bits (767), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 281/514 (54%), Gaps = 18/514 (3%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++++LK RH                   T L  AGP   LIAY F+ TL +    +
Sbjct: 78  DGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAA 137

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF-- 140
           LGEMA +IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 138 LGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRD 196

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            V    WI+IF V++  +N   VKY+GEFEFW++  K++ ++G +I+ F ++ G G    
Sbjct: 197 TVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHD 256

Query: 201 -VGFRYWRHPGAFGP---GIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANP 256
            +GFRYW+ PGAF P    ++  + +  +F+ +V+  + A F + G EL GI A EA NP
Sbjct: 257 RLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENP 316

Query: 257 RKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL---TSTDSYVSASPFIIAIENSG 313
           R+ +PRAIK  V                 V YDD  L    +  +  +ASPF++AI+NSG
Sbjct: 317 RRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSG 376

Query: 314 THVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVT 373
             VLPHIFN  ++  + SA NS++YVG+R +Y L+    AP I ++T + GVP+ A+   
Sbjct: 377 VDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGC 436

Query: 374 SLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPF 433
            LF  LAYM  S+G  + FN+ +N+  + G  +W  I ++ I F +A+  +GI R    +
Sbjct: 437 VLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAY 496

Query: 434 KAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID---FLTAYISVFMFIAIWIAFQAWF 490
            A + P  +Y+ +FF  L+ +I+ F+ F   N  D   F+T YI + ++   +I ++ ++
Sbjct: 497 VAPFQPYGSYFALFFCVLLALIKNFSVFLG-NEFDYKTFITGYIGLPVYAFSFIGYKLYY 555

Query: 491 RCRLIWRVEDVDIDTDRRAV---EEAVWIEQEPR 521
           + + + +  + D+++ + AV   EE   I++  R
Sbjct: 556 KTKTV-KPHEADLNSYKAAVDREEEEGKIKEAER 588

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  297 bits (761), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 169/515 (32%), Positives = 278/515 (53%), Gaps = 14/515 (2%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
              DS    + +E  V +     ++ELK RH                   T L   GP  
Sbjct: 33  QEDDSNKISDGKEDGVRL-----KKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPAS 87

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            LIAY F+  L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I  
Sbjct: 88  ILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIIT 146

Query: 125 ALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
             +L+    VIQ+W     V    WI+IF V++  +N   V+Y+GEFEFW++  K++ + 
Sbjct: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206

Query: 183 GFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           G +++ F ++ G G     +GFRYW++PGAF P   +   ++ +F+ +V+  + A F + 
Sbjct: 207 GVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYL 266

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL---TSTDS 298
           G EL GI A EA NPR+ +PRAIK  +                 V Y+D +L       +
Sbjct: 267 GIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHAST 326

Query: 299 YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358
             +ASPF++AI+NSG   LPHIFN  ++  + SA NS++YVG+R +Y L+    AP + +
Sbjct: 327 SAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFA 386

Query: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418
           +T + GVP+ A+    LF  LAYM  S+G  + FN+ +N+  + G  +W+ I +++I F 
Sbjct: 387 KTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFY 446

Query: 419 QALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC-PWNGIDFLTAYISVF 477
           +A   + + R+   ++A + P  AY  +FF  LI  I+ FT F   ++   F+T YI + 
Sbjct: 447 RACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLP 506

Query: 478 MFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEE 512
           +++  +  ++  ++ +L+ + E+ D+ + + A++ 
Sbjct: 507 LYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  298 bits (762), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 170/515 (33%), Positives = 276/515 (53%), Gaps = 16/515 (3%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           + E   +++ LK RH                   T L  AGP    I Y F+  L +   
Sbjct: 58  KTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTM 117

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
             LGEMA FIP+   FT ++ R+V PA G A GY Y   + I  A +L+    V+Q+W  
Sbjct: 118 SCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVD 176

Query: 141 AVPL--AAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT 198
              L    +I+IF +L+  +N+F VK +GEFEFW++  KV+ ++G ++  F ++ G G  
Sbjct: 177 RDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPN 236

Query: 199 GP-VGFRYWRHPGAFGP---GIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAA 254
              +GFRYWR PG+F P    II+   +  +F+ + S  + A F + G EL GI A EA 
Sbjct: 237 HDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQ 296

Query: 255 NPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD---WKLTSTDSYVSASPFIIAIEN 311
           NPRK +P+AIK  +                 V Y+D    K T   +  +ASPF++AIEN
Sbjct: 297 NPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIEN 356

Query: 312 SGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVL 371
           SG ++LPHIFN  ++A ++SA NS++YV SR +Y L+    AP    +T + G+P+ ++ 
Sbjct: 357 SGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLA 416

Query: 372 VTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDL 431
            ++ F  LAYM  S+     FN+ +N   + G  +W+ I +++I F +A + +G+ + + 
Sbjct: 417 FSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNF 476

Query: 432 PFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAW 489
            + A W P  AY+ +FF  ++ +++ FT F    ++  +F+T YI + +F   ++ ++  
Sbjct: 477 TYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIV 536

Query: 490 FRCRLIWRVEDVDIDTDRRAV---EEAVWIEQEPR 521
           ++ +   R E+VD+ T +  +   EE   IE   R
Sbjct: 537 YKTK-THRPEEVDLVTLKALIDQEEEDGKIEDAER 570

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  297 bits (760), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 170/530 (32%), Positives = 282/530 (53%), Gaps = 22/530 (4%)

Query: 19  SVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYS 78
           S + E  T+++ L+ RH                  S+ L   GP G L +Y+ ++ + Y 
Sbjct: 41  SQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYP 100

Query: 79  VTQSLGEMATFIPVTS-----SFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           V  +LGEM  ++P +      S +    R+  P+ G A G+ Y++ + I  A E +    
Sbjct: 101 VMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASG 160

Query: 134 VIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC 193
           V+ +WT  VP AAWI+IF  ++T +N  PVK+YGE EFW A++K++ I+G L   F +  
Sbjct: 161 VVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 194 GAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITAG 251
           G G +   +GFRYW+ PGAF   I     N  RFL   + +I   F F  G ELV +T+ 
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYHI--TTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSS 278

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDW----KLTSTDSYVSASPFII 307
           EA + R+ + +A ++                   V  +D      L S  +  ++SPF+I
Sbjct: 279 EAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVI 338

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367
           AI+N+   +LPHI NA I+++  S+GNS ++  SR +  ++   +AP +  +  + GVP+
Sbjct: 339 AIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPY 398

Query: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427
            AV V++ F  LAY+  S+G  KAF W  NI+ ++GF  W+ I ++++RF +A+  RG+ 
Sbjct: 399 NAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL- 457

Query: 428 RDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIA 485
            D +PFK+ + P   Y+ +  +++I +  G+ +F P  W G DF+ AYI++ +F+ +W+ 
Sbjct: 458 YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVG 517

Query: 486 FQAWFRCRLIW--RVEDVDIDTDRRAVEEAVW----IEQEPRGFWDKFWN 529
            + + R    W   V +VD+ T    +EE       +   P   W+KF +
Sbjct: 518 HKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  297 bits (761), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 181/509 (35%), Positives = 275/509 (54%), Gaps = 14/509 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   +++ELK RH                   T L+  GPV  LIAY F+  L +     
Sbjct: 76  ENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMAC 135

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA- 141
           LGEMA++IP+   FT ++ R+V PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194

Query: 142 -VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKV-VAIMGFLIYCFCMVCGAGVTG 199
            V    WI+IF V++  +N+  VK++GEFEFW++  KV V +   L+    M+ G     
Sbjct: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHD 254

Query: 200 PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
            +GFRYWR PGAF     A   +  +F  +V+  + + F++ G EL GI   EA NPRK+
Sbjct: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY---VSASPFIIAIENSGTHV 316
           VP+AIK  V                 V Y+D +L ST       +ASPF++AI+NSG  V
Sbjct: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374

Query: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376
           LPHIFNA ++  + SA NS++YV SR +Y L+    AP I ++T++ GVP+ A++++ LF
Sbjct: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434

Query: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436
             LAYM  S+G  K FN+ +N+  + G  +W+ I + +I F +A   +GI +    + A 
Sbjct: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494

Query: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494
                AY+ + F  LI +I+ FT F    ++   F+T YI + ++I  W  ++  ++ ++
Sbjct: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554

Query: 495 IWRVEDVDIDTDR----RAVEEAVWIEQE 519
           I +  DVD+ T +    R  EE    +QE
Sbjct: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQE 582

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  297 bits (760), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 176/509 (34%), Positives = 275/509 (54%), Gaps = 14/509 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   +R++LK RH                   T L+  GPV  LIAY F+  L +     
Sbjct: 76  ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMAC 135

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA- 141
           LGEMA++IP+   FT ++ R+V PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRD 194

Query: 142 -VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKV-VAIMGFLIYCFCMVCGAGVTG 199
            V    WI+IF V++  +N+  V+++GEFEFW++  KV V +   L+    M+ G     
Sbjct: 195 RVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHD 254

Query: 200 PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
            +GFRYWR PGAF     A   ++ +F+ + S  + + F++ G EL GI   EA NPRK+
Sbjct: 255 RLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKS 314

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV---SASPFIIAIENSGTHV 316
           VP+AIK  V                 V Y+D +L ST       +ASPF++AI+NSG  V
Sbjct: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKV 374

Query: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376
           LPHIFN  ++  + SA NS++YV SR +Y L+    AP I ++T++ GVP+ A++V+ LF
Sbjct: 375 LPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLF 434

Query: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436
             LAYM  S G  K FN+ +N+  + G  +W+ I + +I F +A   +G+ +    + A 
Sbjct: 435 CCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAP 494

Query: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494
                AY+ +FF  LI +I+ FT F    ++   F+T YI + +++  W+ ++  ++ ++
Sbjct: 495 GQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKV 554

Query: 495 IWRVEDVDIDTDR----RAVEEAVWIEQE 519
           + +  D D+ T +    R  E+    +QE
Sbjct: 555 V-KPADADLYTLKEIYDREEEQGKLQDQE 582

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  296 bits (759), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 278/512 (54%), Gaps = 17/512 (3%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   +R++LK RH                   T LM  GPV  LIAY F+  L +     
Sbjct: 77  ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMAC 136

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA- 141
           LGEMA++IP+   FT ++ R+V PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 137 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRD 195

Query: 142 -VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            V    WI+IF V++  +N+  VK++GEFEFW++  KV+ ++G ++  F ++ G G    
Sbjct: 196 RVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHD 255

Query: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
            +GFRYWR PGAF     A    + +F+ +++  + + F++ G EL GI   EA NPRK+
Sbjct: 256 RLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKS 315

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV---SASPFIIAIENSGTHV 316
           VP+AIK  V                 V Y+D +L ST       +ASPF++AI+NSG  V
Sbjct: 316 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKV 375

Query: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376
           LPHIFNA ++  + SA NS++YV SR +Y L+    AP I S+T + GVP+ A++ + LF
Sbjct: 376 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLF 435

Query: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436
             LAYM  S G  K FN+ +N+  + G  +W+ I + +I F +A   +GI +    + A 
Sbjct: 436 CCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 495

Query: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494
                AY+ + F   I +I+ FT F    ++   F+T YI + +++  W+ ++  ++ ++
Sbjct: 496 GQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKV 555

Query: 495 IWRVEDVDIDT-----DRRAVEEAVWIEQEPR 521
           I +  DVD+ T     DR   EE   IE + +
Sbjct: 556 I-KSTDVDLYTFKEIYDRE--EEQGKIEDQEK 584

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  294 bits (753), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 173/478 (36%), Positives = 270/478 (56%), Gaps = 16/478 (3%)

Query: 57  LMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMY 116
           L  AGPV  LIAY F+  L +    SLGEMA++IP+   FT ++ R+  PA G A GY Y
Sbjct: 101 LATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCY 159

Query: 117 WFSWCITFALELSVVGQVIQFWT--FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
            F + I    +L+    VIQ+W     V    WI+IF V++  +N   V+++GEFEFW++
Sbjct: 160 LFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLS 219

Query: 175 LVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSL 233
             KV+ +   +I  F ++ G G     +GFR+W+HPGAF     A   +  +F+ +VS  
Sbjct: 220 SFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVF 279

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD--- 290
           + A F + GTELVGI  GEA NPRK+VP+AIK  +                 V YDD   
Sbjct: 280 VYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLL 339

Query: 291 WKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTS 350
            +  +  +  +ASPF++AI NSG  VLPHIFNA ++  + SA NS++YV SR +Y L+  
Sbjct: 340 LEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAID 399

Query: 351 RLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFI 410
             AP I +RT + G+P+ ++ ++ LF  LAYM  S+G  K FN+ +N+  + G  +W+ I
Sbjct: 400 NKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICI 459

Query: 411 SLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGID 468
            ++++ F +A+  +GI +    + A      AY+ +FF +LI +I+ FT F    ++   
Sbjct: 460 LVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKT 519

Query: 469 FLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVD-IDTDRRAVEEAVWIEQEPRGFWD 525
           F+T YI + +F      F ++F  +LI++ + +D ++ D    + A+  E+E     D
Sbjct: 520 FITGYIGIPVF------FISYFGYKLIYKTKIIDPLEVDLYTFKAAIDQEEEDGKLED 571

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  295 bits (755), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 173/518 (33%), Positives = 273/518 (52%), Gaps = 20/518 (3%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           +++ L+ RH                  S+ L   GP G L +Y+ ++ + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 87  ATFIPVTS-----SFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
             F+P ++     S +    R+  P+ G A G+ Y++ + I  A E +    V+ +WT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP- 200
           VP  AWI+IF  ++T +N  PVK YGE EFW A++K++ I+G L   F +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKT 259
           +GFRYW+HPGAF   I     N  RFL   + +I   F F  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHI--TTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST----DSYVSASPFIIAIENSGTH 315
           + +A ++                   V   D  L +      +   +SPF+IAI+N+   
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 316 VLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSL 375
           VLPHI NA I+++  S+GNS ++  SR +  ++    AP IL R  + GVP+ AV +++ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 376 FGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKA 435
           F  LA++  S+G  KAF W  NI+ ++GF  W+ I +++++F +A+  RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 436 KWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLI 495
              P   Y+ +  ++LI +  G+ SF  WN  DF+ AYI++ +F+ +W+  + + R    
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFVNWNASDFVAAYITLPIFVVLWVGHKIYTRTWST 581

Query: 496 W--RVEDVDIDTDRRAVEEAVWIEQ----EPRGFWDKF 527
           W   V +VD+ T    +EE   I       P   W KF
Sbjct: 582 WLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  292 bits (748), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 174/497 (35%), Positives = 276/497 (55%), Gaps = 10/497 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   +++ L+ RH                   + L +AGP   LI+Y F+  L Y+V   
Sbjct: 47  EGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMAC 106

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF-- 140
           LGEMA FIP+   FT ++ R+V PA G A GY Y F + I    +L+    V+Q+W    
Sbjct: 107 LGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSRE 165

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            V    WI+IF VL+  +N   V+++GEFEFW++ VKV+ ++G ++  F ++ G G    
Sbjct: 166 KVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHD 225

Query: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
             GFRYWR PGAF P   A   ++ +F+ + S    A F + GTEL GI A EA NPR++
Sbjct: 226 RTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRS 285

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD---WKLTSTDSYVSASPFIIAIENSGTHV 316
           VPRAIK  +                 V Y+D    K     +  +ASPF++AI+N+G  V
Sbjct: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPV 345

Query: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376
           LPHIFNA ++  + SA NS++YV SR +YGL+  R AP I ++T   GVP+ ++ V+ LF
Sbjct: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405

Query: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436
             LAYM  S+G  + FN+ +N+  + G  +W+ I ++++RF +A+  +   +    + A 
Sbjct: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465

Query: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494
           + P   +  +FF  LI +I+ +T F    ++   F++ YI + ++   ++ ++   R +L
Sbjct: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKL 525

Query: 495 IWRVEDVDIDTDRRAVE 511
           I + EDVD+ T + A++
Sbjct: 526 I-KPEDVDLYTFKAAID 541

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  292 bits (747), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 259/506 (51%), Gaps = 13/506 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E   I+++     ++  LK RH                   T L  AGP G LI +    
Sbjct: 66  EAERIAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTG 125

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ YS+  ++GE+A   PV   FT ++ RFV  +FG A  ++Y   W +   LE+     
Sbjct: 126 TMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASI 185

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T       ++++F+V++  +NMF VK YGE EF  + +KV+ ++GF+I    ++
Sbjct: 186 TVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLI 245

Query: 193 CGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G     +G +YW +PGAF       D    +F G+ +  + AAF+F G+ELVG+   
Sbjct: 246 CGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGS 300

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           EA  PRK+VP A K+V                  VP D  +L    S   +ASPF+IAI 
Sbjct: 301 EAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIV 360

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           N G   LP + N VI+  ++S GNS IY  SR +  L+     P I     + G P V +
Sbjct: 361 NHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGI 420

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
            +++ FG +A++  S      FNWL+ ++G++  FTW  I L HIR+  AL  +G S D+
Sbjct: 421 AISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDE 480

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP----WNGIDFLTAYISVFMFIAIWIAF 486
           LPF+A      +Y+G F   L+ I Q +    P     N  DF  AY+S  +FIA++   
Sbjct: 481 LPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFH 540

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVE 511
           + W R  +L   ++D+DIDT RR V+
Sbjct: 541 KIWKRNWKLFIPLKDLDIDTGRREVD 566

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  291 bits (744), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/549 (30%), Positives = 289/549 (52%), Gaps = 28/549 (5%)

Query: 4   GHNQDSKMKEEIREISVEVE-AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           G N+   +  +    S+E +   T+++ LK RH                  S+ L   GP
Sbjct: 51  GLNKVLTVSSDTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGP 110

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIP-----VTSSFTVFSQRFVSPAFGAANGYMYW 117
            G  IAY  ++++ Y +  ++GEM  ++P        S T   +R+V  +   A G+ Y+
Sbjct: 111 AGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYF 170

Query: 118 FSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVK 177
           + + I  A E +    V+++WT AVP AAWI+IF  ++  +NM  VKY+GE EFW A +K
Sbjct: 171 YCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIK 230

Query: 178 VVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236
           ++ IMG +I  F +  G G +   +GFRYW++PGAF   +   D +   FL   S +I  
Sbjct: 231 ILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKG 288

Query: 237 AFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTS 295
           AF F  G ELV +T+ E ++ R+ + +A K+ +                 V ++D  L S
Sbjct: 289 AFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLAS 348

Query: 296 TDSY----VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSR 351
             S       +SPF+I I+N+G  VLPHI NA I+ +  S+GN+ ++  SR ++ ++ + 
Sbjct: 349 ALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNG 408

Query: 352 LAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFIS 411
            AP I  R  ++GVP++AV++++L   LAY+  S+   + F WL NI+ ++GF  W+   
Sbjct: 409 TAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICAC 468

Query: 412 LSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDF 469
           ++++RF +A+    +  D +PFK    P L  + +  +++I I  G+ +F P  WN  DF
Sbjct: 469 IAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDF 527

Query: 470 LTAYISVFMFIAIWIAFQAWFR-------CRLIWRVEDVDIDTDRRAVEEAVWIEQE--- 519
           + AYI++ +F+A+++  + +          +L + VED+D+ T    +E       E   
Sbjct: 528 IAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRI 587

Query: 520 -PRGFWDKF 527
            P   W++F
Sbjct: 588 LPTNRWERF 596

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  290 bits (741), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 180/542 (33%), Positives = 293/542 (54%), Gaps = 25/542 (4%)

Query: 9   SKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIA 68
           S+ + +   I  + E   +++ LK RH                   T L  AGPV  LIA
Sbjct: 50  SQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIA 109

Query: 69  YLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALEL 128
           Y F+  L +     LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I    +L
Sbjct: 110 YAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQL 168

Query: 129 SVVGQVIQFWTFA--VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           +    VIQ+W     V    W++IF V++  +N+F V+++GEFEFW++  KV+ ++G ++
Sbjct: 169 TAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLML 228

Query: 187 YCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
             F ++ G G     +GFRYWRHPG+F         +  RF+ +VS  + A + + G EL
Sbjct: 229 LLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIEL 288

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD---WKLTSTDSYVSA 302
            GI A EA NPRK++P+AIK  +                 V YDD    K  ++ +  +A
Sbjct: 289 TGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAA 348

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SPF++AI NSG + LPHI NA ++  + SA NS++YV SR +Y L+    AP I ++T +
Sbjct: 349 SPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNR 408

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G+P+ A+ V+ LF  LAYM  S+   K FN+ +N+  + G  +W+ I +++I F +A+ 
Sbjct: 409 WGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVR 468

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFI 480
            +G+ +    + A + P  A++ +FF  LI +I+ FT F    ++  +F+T YI + +F 
Sbjct: 469 AQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFF 528

Query: 481 AIWIAFQAWFRCRLIWRVEDVDIDTDRRAV------------EEAVWIEQEPRG---FWD 525
             +  ++  ++ ++I  ++ VD+ T + A+            E+A  I+Q  +    F+D
Sbjct: 529 FCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYD 587

Query: 526 KF 527
           KF
Sbjct: 588 KF 589

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  289 bits (740), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 169/513 (32%), Positives = 268/513 (52%), Gaps = 13/513 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E  +I++      ++ +LK RH                   T L  AGP G LI ++   
Sbjct: 71  EAEKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAG 130

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           ++ Y +  S+ E+A   PV   FT ++ RF+  ++G AN + Y   W +T  LE+     
Sbjct: 131 SMIYCMVMSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASI 190

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T       ++++FWV++  +NMF V+ YGE EF  ++ K++ I+GF+I    ++
Sbjct: 191 TVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILI 250

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G        RYW HPGAF     A D +  +F G+ S  + AAF+F G+ELVG+ A 
Sbjct: 251 CGGGPGTGYIGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAA 305

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           EA+NPRK VP A K+V                  VPY D +L    S   +ASPF+IAI+
Sbjct: 306 EASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIK 365

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           N G   LP + N VI+  ++S GNS +Y  SR +  L+     P   S   + G P V +
Sbjct: 366 NQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGI 425

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
            VTS FG +A++  S    + F+WL+ ++G++  FTW  I L HIRF +AL  +G S ++
Sbjct: 426 AVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNE 485

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF----CPWNGIDFLTAYISVFMFIAIWIAF 486
           L F +      A +G+F   +++  Q + +      P +  DF   Y+S+ + +A+W+  
Sbjct: 486 LAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGH 545

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQ 518
           + W +  +L  + ED+DIDT RR ++  +  +Q
Sbjct: 546 KIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQ 578

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  290 bits (742), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 175/511 (34%), Positives = 277/511 (54%), Gaps = 13/511 (2%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           + E   ++++LK RH                     L  AGPV  LIAY F+  + +   
Sbjct: 59  KYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTM 118

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT- 139
             LGEMATFIP+   FT ++ R+  PA G A GY Y   + I    +L+    V+Q+W  
Sbjct: 119 ACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVP 177

Query: 140 -FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC-MVCGAGV 197
              V    W+++ + ++T +N+F V+++GEFEFW++ +KV+ ++G +I  F  M+ GAG 
Sbjct: 178 RDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGS 237

Query: 198 TGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 257
              +GFRYW+HPGAF         +  +F+ +V+ L+   F + G EL GI A EA+NPR
Sbjct: 238 HDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPR 297

Query: 258 KTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-TSTDSYVSASPFIIAIENSGTHV 316
           ++VP+AIK                    VPY+D KL T+ ++ ++ASPF IAI N+G  V
Sbjct: 298 RSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITV 357

Query: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376
           LP IFN  ++  + SA NS++YV SR +Y L+    AP I + T + G+P+ ++ V+ LF
Sbjct: 358 LPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLF 417

Query: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436
             LAYM  S+   + F + +N+  +AG  TW+ I +++I F +A+  + + +    + A 
Sbjct: 418 CLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAP 477

Query: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC-PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLI 495
           + P  AY  +FF  LI II+ FT F   ++   F+T YI + +F+  +  ++   +   I
Sbjct: 478 FQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSE-I 536

Query: 496 WRVEDVDIDT-----DRRAVEEAVWIEQEPR 521
                VD+ +     DR  VE  + IEQ  R
Sbjct: 537 RSARYVDLVSQKSLVDREQVEYEL-IEQLKR 566

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  285 bits (729), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 264/506 (52%), Gaps = 13/506 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E  +I++      ++R LK RH                     L   GP G LI +  + 
Sbjct: 64  EAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIG 123

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
            + Y V  S+GE+A   PV+  FT ++ RFV  +FG A  Y Y   W +   LE+     
Sbjct: 124 LMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASI 183

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + FW T       ++++F++++  +N F V+ YGE EF  + +KV+ ++GF+I    +V
Sbjct: 184 TVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLV 243

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     +YW +PGAF     + D   +RF G  S  + AAF+F GTELVG+ + 
Sbjct: 244 CGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASA 298

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E ANPRK +PRA K+V                  VP+   +L  T S   +ASPF++AI+
Sbjct: 299 ETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQ 358

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G   LP + N VI+ +++S GNS +Y  SR M  L+     P I +   + G P VA+
Sbjct: 359 THGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAI 418

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           + T +FG L+++  S      FNWLL ++G++  F+W  I + HIRF +AL  +G S D+
Sbjct: 419 ITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDE 478

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIAF 486
           L F +      +Y+GV  + L++I Q + +  P     N  DF +AY+S  + +A +I  
Sbjct: 479 LAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFH 538

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVE 511
           + W R  +L  R +D+DIDT RR ++
Sbjct: 539 KIWKRNWKLFTRAKDIDIDTGRREMD 564

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  284 bits (726), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 176/544 (32%), Positives = 285/544 (52%), Gaps = 32/544 (5%)

Query: 5   HNQDSKMKEEIREISVEVEA-------------------ETVRRELKQRHXXXXXXXXXX 45
           H+ +   K+E  +I +E E+                   + ++++LK RH          
Sbjct: 21  HSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSL 80

Query: 46  XXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVS 105
                      L  AGPV  LI+Y F+  L + V   +GEMA +IP+   FT ++ R+  
Sbjct: 81  GTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYCD 139

Query: 106 PAFGAANGYMYWFSWCITFALELSVVGQVIQFW--TFAVPLAAWISIFWVLLTGMNMFPV 163
           PA G A GY Y   + I    +L+    VIQ+W     V    WI+I  V++  +N F V
Sbjct: 140 PALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGV 199

Query: 164 KYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKN 222
           K++GEFEFW++  KV+ ++G +I  F ++ G   T   +GFRYW+HPGAF     +   +
Sbjct: 200 KFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGD 259

Query: 223 QARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXX 282
             RF+ +VS  +   F + G EL GI A EA NPRK +P+AIK  +              
Sbjct: 260 IGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLL 319

Query: 283 XXXVPYDDWKL---TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYV 339
              V  +D  L    +  +  +ASPF++AI NSG   LPHIFNA ++  + SA NS++YV
Sbjct: 320 GMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYV 379

Query: 340 GSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNIT 399
            SR +Y L+    AP I ++T + G+P+ ++ V  LF  LAYM  S+G  K FN+ +N+ 
Sbjct: 380 ASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVV 439

Query: 400 GVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFT 459
            + G  TW+ I +++I F +A+  +GI +    + A   P  AY+ +FF  L+ +I+ FT
Sbjct: 440 SITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFT 499

Query: 460 SFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIE 517
            F    ++  +F+T YI + +F   +  ++ + +   I + E+VD+ + + A+++    E
Sbjct: 500 VFLNHKFDYRNFITGYIGLPLFFICYFGYK-FVKKTKIRKPEEVDLFSFKAAIDQE---E 555

Query: 518 QEPR 521
           ++ R
Sbjct: 556 EDGR 559

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  283 bits (724), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 163/526 (30%), Positives = 289/526 (54%), Gaps = 23/526 (4%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           ++++L+ RH                   + L  AGP+  LIAY  M  + ++V   LGEM
Sbjct: 58  LKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGEM 117

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF--AVPL 144
           A +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W     V  
Sbjct: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176

Query: 145 AAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT-GPVGF 203
             WI++F  ++  +N+  VK++GEFEFW++  KV+ ++  +     +V G G +   +GF
Sbjct: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLGF 236

Query: 204 RYWRHPGAFGP--GIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           RYW+ PG F P  G ++    + +F+ + S  + A F + GTEL GI A E  NPR+ VP
Sbjct: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD---SYVSASPFIIAIENSGTHVLP 318
           RAIK  +                 V Y+D  L  T    +  +ASP+++AI+N+G  VLP
Sbjct: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVLP 356

Query: 319 HIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGA 378
           HIFNA ++  + SA NS++YVGSR +YGL+  + AP I ++T   GVP+ ++ + +LF  
Sbjct: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           LAYM  S+  +  F++ +N+T + G  +W+ I +++I F +A  ++GI ++ L ++A + 
Sbjct: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIW 496
           P  A+  + F  ++ +++ FT F    ++   F+T YI + ++I  ++ ++   + + I 
Sbjct: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI- 535

Query: 497 RVEDVDIDTDRRAVE--------EAVWIEQEPRGF---WDKFWNVV 531
           +  +VD+ T + A++        E + +++E +     W +F++ +
Sbjct: 536 KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  284 bits (726), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 167/521 (32%), Positives = 273/521 (52%), Gaps = 22/521 (4%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           + ++L  RH                     L   GP   ++A++ ++T  +++  +LGE+
Sbjct: 88  LNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGEL 147

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
           A   PV   F V+  RFV P+FG A    Y   W +   LEL      I++W   +   A
Sbjct: 148 AAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTINSDA 207

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRY 205
           W++IF+  +   NM  VK +GE EF ++++K++AI+GF I    + CG G +G  +G RY
Sbjct: 208 WVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRY 267

Query: 206 WRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 265
           W  PGAF       D    RF G  +  + AAF++ GTELV ++A E+ NPR T+P+A K
Sbjct: 268 WNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASK 322

Query: 266 KVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV--SASPFIIAIENSGTHVLPHIFNA 323
           +                   VPY+D +L + +S V  +ASP +IAIEN G   LP + NA
Sbjct: 323 RTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNA 382

Query: 324 VIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYME 383
           +I+  I+S  NS +Y  SR M  ++     P  L+   + G P  A+  T +FG L+++ 
Sbjct: 383 IILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIA 442

Query: 384 TSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAY 443
            S   ++ F WL  ++G++  F W  I+LSHIRF QA++ +  S ++LPF +      ++
Sbjct: 443 ASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSW 502

Query: 444 YGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRC-RLIWR 497
           YG   + L++I   +TS  P   +G D   F   Y+S+ +FI  ++  + + +  RL  +
Sbjct: 503 YGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVK 562

Query: 498 VEDVDIDTDRRAVE-----EAVWIEQE---PRGFWDKFWNV 530
            +D+D+DT RR ++     + + +E+E    + F+ +F NV
Sbjct: 563 TKDMDLDTGRREIDLDILKQEIRLEREQMAQKPFYIRFLNV 603

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  281 bits (719), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 265/512 (51%), Gaps = 18/512 (3%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
            T+++ LK RH                  S+ L   GP G   +Y  ++ + Y V  +LG
Sbjct: 49  HTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALG 108

Query: 85  EMATFIPVTSSFTV-----FSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 139
           EM  ++P   S +         R+V P+ G A G+ Y++ + I  A E +    V+Q+WT
Sbjct: 109 EMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWT 168

Query: 140 FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTG 199
            AVP  AWI+IF  ++  +N   VK+YGE EFW A +K++ I+G L   F +  G G   
Sbjct: 169 TAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHH 228

Query: 200 P-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITAGEAANPR 257
             +GFRYW+ PGAF   I +   N  RFL   + +I   F F  G ELV +T+ EA + R
Sbjct: 229 DRLGFRYWQKPGAFAYHITSG--NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDAR 286

Query: 258 KTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST----DSYVSASPFIIAIENSG 313
           + + +A ++ V                 V Y+D  L++          +SPF+I I+N+G
Sbjct: 287 RNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAG 346

Query: 314 THVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVT 373
             VLPHI N  I+++  S+GNS ++  SR +  +S    AP IL R  + GVP+ AV +T
Sbjct: 347 IKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALT 406

Query: 374 SLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPF 433
           SL   +AY+  S+     F W  NI+ ++GF  W+ I ++++RF +A+  + +  + +PF
Sbjct: 407 SLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPF 465

Query: 434 KAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQAWFR 491
           K  + P   ++ +  +++I +  G+  F P  WN  DF+ AY+++ +F+ +WI  + W R
Sbjct: 466 KTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTR 525

Query: 492 CRLIWR--VEDVDIDTDRRAVEEAVWIEQEPR 521
               W   V ++D+ T  + +EE      E R
Sbjct: 526 TWKTWAIPVPEIDVTTGLKEIEEESKECDEKR 557

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  282 bits (721), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 175/506 (34%), Positives = 273/506 (53%), Gaps = 13/506 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           +I +I+++     ++ +LK RH                     L  AGP G LI +    
Sbjct: 75  DIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITG 134

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ +++  +LGE+A   PV+  F  ++ RF+  +FG AN + Y F W +   LE+     
Sbjct: 135 TMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASI 194

Query: 134 VIQFWTFAVPLA-AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W   V     ++++FW+++  +NMF V+ YGE EF  +L+KV+A++GF+I    +V
Sbjct: 195 TVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILV 254

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     RYW  PGAF     A      RF G+ S  + AAF+F G+ELVGI + 
Sbjct: 255 CGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASA 309

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIAIE 310
           E+ NPRK+VP+A K+V                  VPY D +L  S+    SASPF+IAI 
Sbjct: 310 ESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIV 369

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G   LP + N VI+ +++S GNS+IY  SR +  LS     P  ++   + G P V +
Sbjct: 370 THGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGI 429

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
            + S FG +A++  S   ++ FNWLL I+G++ F TW  I   HIRF  AL++ G S D+
Sbjct: 430 AICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDE 489

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIAF 486
           LPFK+      +Y+G+    L+++ Q + +  P     N  DF +AY++  + +A +IA 
Sbjct: 490 LPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAH 549

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVE 511
           + W R  +L+  ++D+DIDT RR  +
Sbjct: 550 KLWKRNWKLLIPLKDIDIDTGRRETD 575

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  280 bits (717), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 168/545 (30%), Positives = 279/545 (51%), Gaps = 34/545 (6%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N+D+K++ ++++             L  RH                  S+ L   GP G 
Sbjct: 47  NKDAKLEGKLQQ------------GLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGL 94

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIP-----VTSSFTVFSQRFVSPAFGAANGYMYWFSW 120
            I+Y+ ++T+ Y +  + GEM  ++P        S +    R+V P+   A G+ Y++ +
Sbjct: 95  FISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCY 154

Query: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
            I  A E +    V+++WT AVP AAWI+IF  ++  +N+  VKYYGE EFW A +KV+ 
Sbjct: 155 VILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLC 214

Query: 181 IMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 239
           I+G +I  F +  G G     +GFRYW++PG F   I     N   FL   S +I  AF 
Sbjct: 215 IVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGG--NLGNFLDVYSGIIKGAFA 272

Query: 240 F-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST-- 296
           F  G EL+ + + E  + R+ + +A K+ V                 V  +D  LTS   
Sbjct: 273 FILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALA 332

Query: 297 --DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAP 354
                  +SPF+I I+N+G  +LPHI NA I+ +  SAGN+ ++  SR +  ++++  AP
Sbjct: 333 SGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAP 392

Query: 355 GILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSH 414
            I  +  + GVPWVAV  ++L   LAY+  S+     F W  NI+ ++GF  W    +++
Sbjct: 393 KIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAY 452

Query: 415 IRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTA 472
           +RF +A++  G+  + LP+  ++   + ++ +  +TL+I   G+  F P  WN  DF+ A
Sbjct: 453 LRFRKAIKYNGL-ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAA 511

Query: 473 YISVFMFIAIWIAFQAWFRCRLIW--RVEDVDIDTDRRAVEEAVWI----EQEPRGFWDK 526
           YI++ +F+ +WI  + + R    W   VE++D+ T    +EE   I      EP+G + K
Sbjct: 512 YITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPKGAFPK 571

Query: 527 FWNVV 531
           F + +
Sbjct: 572 FMDAL 576

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  279 bits (714), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 174/510 (34%), Positives = 263/510 (51%), Gaps = 15/510 (2%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           D  M  E+ +I+       ++  LK RH                   T L  AGP G LI
Sbjct: 63  DPNM-SELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILI 121

Query: 68  AYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALE 127
            +    T+ YS+  +LGE+A   PV+  FT ++ RF+  ++G AN   Y   W +   LE
Sbjct: 122 GWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLE 181

Query: 128 LSVVGQVIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           +      + +W T       ++++FW+ +  +N+F VK YGE EF  +++KV+ ++GF+I
Sbjct: 182 IVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFII 241

Query: 187 YCFCMVCGAG-VTGPVGFRYWRHP-GAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
               + CG G V G +G RYW HP GAF       D   ARF G  S  + AAF+F G+E
Sbjct: 242 LGIILNCGGGPVKGYIGGRYWHHPYGAF-----VGDSAGARFKGVCSVFVTAAFSFAGSE 296

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSAS 303
           LVG+ + E ANPRK+VP+A K+V                  VPY + +L    S   +AS
Sbjct: 297 LVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS 356

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           PF+IAI   G   LP + N VI+  ++S GNS IY  SR +  L+     P       + 
Sbjct: 357 PFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRS 416

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P  ++LVTS FG +A++  S    + FNWLL ++G++  FTW  I L HIRF +AL  
Sbjct: 417 GRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSA 476

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP----WNGIDFLTAYISVFMF 479
           +G   D+L F +      +Y+G+F + L+ I Q + +  P     N   F  AY+S  + 
Sbjct: 477 QGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIV 536

Query: 480 IAIWIAFQAWFRC-RLIWRVEDVDIDTDRR 508
           IA ++  + + +  ++  + ED+DIDT R+
Sbjct: 537 IACYLGHKIYKKNWKIFIKAEDMDIDTGRK 566

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  279 bits (713), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 166/526 (31%), Positives = 268/526 (50%), Gaps = 23/526 (4%)

Query: 26  TVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGE 85
           ++++ LK RH                  S+ L   GP G  I+Y+ ++++ Y +    GE
Sbjct: 76  SLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGE 135

Query: 86  MATFIP-----VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
           M  ++P      + S      R+V  + G A  + Y++ + I  A E +    V+++WT 
Sbjct: 136 MVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTV 195

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
           AVP   WI IF  ++  +N  PVKYYGE EFW A +K++ I+G +I  F +  G G    
Sbjct: 196 AVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHD 255

Query: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 258
            +GFRYW+ PGAF   I+       RFL   S +I   F F  G ELV +T+ E  + R+
Sbjct: 256 RLGFRYWQRPGAFTEHIM--KGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRR 313

Query: 259 TVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST----DSYVSASPFIIAIENSGT 314
            + +A ++ +                 V Y+D  L S          +SPF+I I+N+G 
Sbjct: 314 NIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGI 373

Query: 315 HVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTS 374
            VLPHI NA I+++  SAGN+ ++  +R +  ++ +  AP +  +  + GVP+VA+ ++ 
Sbjct: 374 RVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSG 433

Query: 375 LFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFK 434
               LA++  S+     FNW  NI+ ++GF  W+   +++IRF +A+   G+  D LPFK
Sbjct: 434 GLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFK 492

Query: 435 AKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQAWFRC 492
               P   YY +F ++LI +  G+ +F P  W G DF+ AYI++ +F+ +W+  + W R 
Sbjct: 493 TWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRT 552

Query: 493 ---RLIWRVEDVDIDTDRRAVEEAVWI----EQEPRGFWDKFWNVV 531
              R   RV+ +D+ T    +EE   I      EP   W KF + V
Sbjct: 553 FTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  279 bits (714), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 171/536 (31%), Positives = 280/536 (52%), Gaps = 19/536 (3%)

Query: 3   GGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           G +N D   KE+  +   + + + +++ +K RH                     L N GP
Sbjct: 76  GSNNPD---KEDGSDAGDKGDNK-LKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGP 131

Query: 63  VGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
            G +I Y  M +  Y + Q+ GE+A  +  ++  F  +    + PA G +  ++Y   W 
Sbjct: 132 AGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWL 191

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
               LEL      I++WT +V    +++IF+V++  +N+F  + Y E EF+    KV+ I
Sbjct: 192 CVMPLELVTASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMI 251

Query: 182 MGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
            GFLI    + CG AG  G +G +YW  PG+F     + DK    F G VS+L+ AAF F
Sbjct: 252 SGFLILGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAF 306

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSY 299
             TE + +TA E ANPRK++P A KK++                 VP++  +L  S  S 
Sbjct: 307 GATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSA 366

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
             ASP++IAI + G  V+PH+ NAVI+ ++IS GNS  Y  SR++  L+    AP  L  
Sbjct: 367 THASPYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKY 426

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             + G P +A++++S+FG ++++  S   +  F WLL I+G++  FTW  I LSHIRF +
Sbjct: 427 VDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRR 486

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYI 474
           A++++G S  +L FK++     +YY    M LI+I Q +T+  P      +   F   Y+
Sbjct: 487 AMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYL 546

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++ + IA++  ++ W R   L      +D+ ++RR  +E V ++QE   + +K  N
Sbjct: 547 AMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDV-LKQEDAEYREKLRN 601

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  278 bits (712), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 167/506 (33%), Positives = 257/506 (50%), Gaps = 13/506 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           +  ++++      ++R LK RH                   + L   GP   LI +  + 
Sbjct: 67  QAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIG 126

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
            + YSV  ++GE+A   PV   FT +  RFV  +FG A  Y+Y   W +   LE+     
Sbjct: 127 LMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASI 186

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T A     ++++F+V++  +NMF VK YGE EF  +++KV  ++GF+I    ++
Sbjct: 187 TVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLI 246

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     +YW +PGAF       D    RF    S  + AAF+F GTELVG+ A 
Sbjct: 247 CGGGPVGGYVGGKYWHNPGAFN-----GDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAA 301

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E  NPRK +PRA K+V                  VPY    L  + S   +ASPF++AI+
Sbjct: 302 ETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIK 361

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G   LP + N VI+ +++S GNS++Y  SR +  L+     P I S   + G P V +
Sbjct: 362 THGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGI 421

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           L T  FG L ++  S      FNWL+ ++G++  FTW FI + H+RF +AL  +G S D+
Sbjct: 422 LATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDE 481

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI----DFLTAYISVFMFIAIWIAF 486
           L F +      +Y+GV  + L+ I Q + +  P  G     DF  AY+SV + +  ++A 
Sbjct: 482 LAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAH 541

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVE 511
           + + R      R +D+DIDT RR ++
Sbjct: 542 KLYTRNWTFAKRAKDIDIDTGRRELD 567

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  278 bits (711), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 274/514 (53%), Gaps = 14/514 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           +  +I++      ++  LK RH                     L  AGP G LI +    
Sbjct: 74  DAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTG 133

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ YS+  ++GE+A   PV+  FT ++ RF+  +FG A  + Y   W IT  LE+     
Sbjct: 134 TMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASI 193

Query: 134 VIQFWTF-AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W   A     ++++FWV    +N+F VK YGE EF  A++KVV I+GF+I    ++
Sbjct: 194 TVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILI 253

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     +YW HPGAF       D    +F G+ +  I A+F+F G+E+VG+   
Sbjct: 254 CGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGS 308

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E+ NPRK+VP A K+V                  VPY+D +L    S   +ASPF+IA+ 
Sbjct: 309 ESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVV 368

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           N G   LP + N VI+ +++S GNS+IY+ SR +  L+     P I++   ++G P VA+
Sbjct: 369 NQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAI 428

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
            + S FG +A++  S+   + FNWLL ++G++  F+W  I + HIRF +AL  +G S D+
Sbjct: 429 GIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDE 488

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIAF 486
           LPF +      +Y+G+F   L++I Q +    P     N  DF  AY+S  + +A +I  
Sbjct: 489 LPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFH 548

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           + W +  +L  + ED+DIDT RR V+  + ++QE
Sbjct: 549 KIWKKNWKLYIKAEDMDIDTGRREVDRDL-LKQE 581

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  275 bits (703), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/512 (32%), Positives = 262/512 (51%), Gaps = 15/512 (2%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           +D    EEI E     +   + RELK R                    + L   GP+   
Sbjct: 17  EDECESEEIDE-----KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLF 71

Query: 67  IAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
           IAYLF  +L   V  SL EMA+F P+   F+ +  R+V PAFG A G+ Y+  + I  + 
Sbjct: 72  IAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSA 131

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
            L+  G VI +W   V +  W+++ +V +  +N   VKY+GE E  + + K++ ++   I
Sbjct: 132 NLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYI 191

Query: 187 YCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
            C  + CG        GFRYWR  GA  P ++       +FLGW + ++ + F F G+E+
Sbjct: 192 TCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEM 248

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT---STDSYVSA 302
           +GI  GE ANP+KT+P++   V                  +   + KL    STD+  +A
Sbjct: 249 IGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA--NA 306

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SPF+IAI +SG  VLP+  NA ++  IIS+ N++IY+ SR +YGL+    AP I     +
Sbjct: 307 SPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNR 366

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
             VP V  +  SL G LAYM T       F+++ +   V G   W +I +++I + +A++
Sbjct: 367 FKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIK 426

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF-CPWNGIDFLTAYISVFMFIA 481
            +GIS DD+PF+  + P  AY  +FF+T+I    G+ +F   ++   F+T+YI VF  I 
Sbjct: 427 AKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANIL 486

Query: 482 IWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEA 513
           + I ++ +F+ + +   E      +    EEA
Sbjct: 487 MVIGYKLYFKTKFVKPSEISFRTRNEHEGEEA 518

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  276 bits (705), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/525 (30%), Positives = 263/525 (50%), Gaps = 13/525 (2%)

Query: 13  EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
           EE+   S   E  T+ + L+ RH                  S  L N G    L++++ +
Sbjct: 32  EELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILI 91

Query: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132
           +T+ Y +  SL EM  ++P   S      R+V P+ G A G+ Y +++ I  A ELS   
Sbjct: 92  STIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAA 151

Query: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM- 191
            V+ +W   VP+AAWI+IF V++ G+N   VKYYGE EFW A +K++ I+G L+    + 
Sbjct: 152 SVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIF 211

Query: 192 VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITA 250
             GA      GFRYW++PG F   +     +  RFL    ++I +AF F    EL+GI  
Sbjct: 212 FGGAPNHDRTGFRYWKNPGPFAMSL--APGSTGRFLDVWRAVIKSAFAFILSPELIGIAC 269

Query: 251 GEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY----VSASPFI 306
            EA + R+   +A ++ +                 +   D KL           ++SPF+
Sbjct: 270 VEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFV 329

Query: 307 IAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVP 366
             I N+G  VL H+ N  I+++  SAGNS +Y  +R++  L+    AP  L++  ++GVP
Sbjct: 330 QGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVP 389

Query: 367 WVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGI 426
           + AV+V +L   LAY+   T     F WL NI  ++GF  W  + ++ IRF + +    +
Sbjct: 390 YNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL 449

Query: 427 SRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWI 484
            +  +P++    P +AYY  F   ++ +  GF  F    WN +DF+ AY+++ +++ +++
Sbjct: 450 -QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYL 508

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQE--PRGFWDKF 527
             + WFR R    VE +D+ T     EE   +     P+  W+KF
Sbjct: 509 GHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKF 553

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  277 bits (708), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 172/506 (33%), Positives = 272/506 (53%), Gaps = 13/506 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           ++ +I+++     ++ +LK RH                     L  AGP G LI +    
Sbjct: 75  DLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITG 134

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ +++  +LGE+A   PV+  FT ++ RF+  +FG A  + Y   W +   LE+     
Sbjct: 135 TMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASI 194

Query: 134 VIQFWTFAVPLA-AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W   V     ++++FW+++  +NMF V+ YGE EF  +++KV A++GF+I    +V
Sbjct: 195 TVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLV 254

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     RYW +PGAF    +     Q +F G+ S  + AAF+F G+EL+G+   
Sbjct: 255 CGGGPVGGYVGARYWHNPGAF----VGSTSGQ-KFHGFCSVFVTAAFSFAGSELIGLAGS 309

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-TSTDSYVSASPFIIAIE 310
           EA NPRK VP A K+V                  VPY+D +L +S+    SASPF+IAI 
Sbjct: 310 EAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIV 369

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G   LP + N VI+ +++S GNS IY  SR +  LS     P I+S   + G P V +
Sbjct: 370 THGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGI 429

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
            ++S FG +A++  S    + FNWLL I+G++ FFTW  I + HIRF  AL+ +G   D+
Sbjct: 430 AISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDE 489

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNG----IDFLTAYISVFMFIAIWIAF 486
           LPF +      +Y+G+F   L++I Q + +  P  G     +F +AY++  + +A +IA 
Sbjct: 490 LPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAH 549

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVE 511
           + W +  + +  +EDVDIDT RR  +
Sbjct: 550 KLWKKNWKFLIPLEDVDIDTGRRDTD 575

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  276 bits (707), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 165/513 (32%), Positives = 277/513 (53%), Gaps = 13/513 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           + ++I++      ++R+LK RH                  S  L  AGP G LI +  MA
Sbjct: 71  DAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMA 130

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+   +  SLGEMA   PV+  +T ++ RF+  ++G AN   Y     +   LE+     
Sbjct: 131 TMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASI 190

Query: 134 VIQFWTFAVPL-AAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W       AA++++FW+ +  +NMF VK YGE EF  +L+KVV ++GF+I    +V
Sbjct: 191 TVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILV 250

Query: 193 CGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G T   +G ++W +PGAF       D    +F G  S  + AAF+F  TELVG+ A 
Sbjct: 251 CGGGPTHEYIGSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAA 305

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIAIE 310
           E  +PRK+VP+A K+V                  VPY D +L  S+    +ASPF++A++
Sbjct: 306 ETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALK 365

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           N G   LP + N VI+  ++S GNS+++  SR +  LS     P +     + G P V++
Sbjct: 366 NHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSI 425

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           + +S FG L ++  S   Q+ F+W+L+++G++  F WL ISL HIRF +AL  +  S D+
Sbjct: 426 IFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDE 485

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN----GIDFLTAYISVFMFIAIWIAF 486
           L F +      +YY VF + +++I+Q + +  P +      +F  AY+S+ + +A+++  
Sbjct: 486 LAFASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGH 545

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQ 518
           + + +  +L+   + +DIDT RR ++  ++ ++
Sbjct: 546 KIYTKNWKLLIDPKYMDIDTGRRELDIELFKQE 578

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  277 bits (709), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 172/524 (32%), Positives = 268/524 (51%), Gaps = 15/524 (2%)

Query: 15  IREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMAT 74
           + E+  + + E +++ +K RH                  +  L +AGP G  I Y  M +
Sbjct: 113 VDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGS 172

Query: 75  LAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
             Y + Q+ GEMA T+  +   F  +    VSP  G A  ++YW  W     LEL     
Sbjct: 173 CIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASM 232

Query: 134 VIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC 193
            I++WT  V    ++ IF+ L+  +N+F  + Y E EF+    KV+ I GF I    + C
Sbjct: 233 TIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINC 292

Query: 194 G-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGE 252
           G AG  G +G +YW  PGAF       DK   RF G  ++L+ AAF F G+E + +TA E
Sbjct: 293 GGAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASE 347

Query: 253 AANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDS-YVSASPFIIAIEN 311
            +NPRK +P A KK++                 VP++  +L  +DS    ASP++IAI +
Sbjct: 348 QSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISS 407

Query: 312 SGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVL 371
            G  V+PH  NAVI+ +++S GNS  Y  SRI+  LS    AP   +   + G P  A++
Sbjct: 408 HGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMV 467

Query: 372 VTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDL 431
           + +LF  +A+   S+  +  F WLL I+G++  FTW  I LSHIRF +A+ ++G S  ++
Sbjct: 468 IGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEI 527

Query: 432 PFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAF 486
            FK++     +YY    M L++I Q +    P   N +D   F  +Y+++ M IA ++ +
Sbjct: 528 GFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGY 587

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
             W +   L  R +D+D+D  R+  +E V + QE     +K  N
Sbjct: 588 MFWKKDWTLFIRAKDIDLDHHRQIFDEDV-LRQEDEETKEKLRN 630

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  276 bits (706), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 176/526 (33%), Positives = 268/526 (50%), Gaps = 16/526 (3%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E   I++      ++  LK RH                  ST L  AGP G +I +   +
Sbjct: 82  EAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTS 141

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ Y +  +LGE+A   PV+  FT ++ RF+  +FG A+ + Y   W  T  LE+     
Sbjct: 142 TMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASI 201

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T       ++++FW+++  +N+F V+ +GE EF  + +KV+ ++GF+I    +V
Sbjct: 202 TVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLV 261

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
            G G  G     RYW +PGAF       D    +F G  S  + AAF+F G+ELVGITA 
Sbjct: 262 AGGGPEGGFVGGRYWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAA 316

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           EAANPRK+VPRA K+VV                 VPY D +L    S   SASPF+IAI 
Sbjct: 317 EAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIV 376

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G   LP + N VI+  ++S GNS I+ GSR +  LS     P I     + G P V +
Sbjct: 377 THGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGI 436

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           +V S FG +A++  S    + F WL+ ++G++  FTW  I L HIRF  AL+ +G S ++
Sbjct: 437 IVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNE 496

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID----FLTAYISVFMFIAIWIAF 486
           LPF +      + +G+F + L+ I Q + +  P         F  +Y+S  + +A +   
Sbjct: 497 LPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGH 556

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVEEAVW---IEQEPRGFWDKFW 528
           + + +  +L  + ED+DIDT RR  +  +    IE+E      K W
Sbjct: 557 KIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEKAILATKGW 602

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  276 bits (706), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 166/526 (31%), Positives = 272/526 (51%), Gaps = 17/526 (3%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           EI  +  ++  E +++ ++ RH                   T L +AGP G +I Y  M+
Sbjct: 87  EISAVDNQIN-EKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMS 145

Query: 74  TLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132
           T  Y V Q++GEMA  ++ +   F+ +    + P    A  ++Y   W     LEL    
Sbjct: 146 TCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTAS 205

Query: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGFLIYCFCM 191
             IQ+WT  V    ++ IF++L+ G+N+F   + Y E EF+  + K++ + GF I    +
Sbjct: 206 MTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIIL 265

Query: 192 VCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITA 250
           +CG AG +G +G RYW  PGAF       D    RF G VS+L+ AAF F GTE + ITA
Sbjct: 266 ICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITA 320

Query: 251 GEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIAI 309
            E ANPRK +P A KKV+                 VPY+  +L  S+     ASP++IA+
Sbjct: 321 SEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAV 380

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
            + G  V+PH  NAVI+ ++ S  +S  Y  SR++  L+    AP I +   + G P + 
Sbjct: 381 ASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLG 440

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
            +V ++   +++   S+     FNWLL+I+G++  FTW  ISLSHIRF +A++++G S D
Sbjct: 441 FVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLD 500

Query: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWI 484
           ++ FK++     + Y    M L++I Q +    P      + + F  AY+++ +FI ++ 
Sbjct: 501 EIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYF 560

Query: 485 AFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            ++ W R  RL  R +++D+   R  + +   + QE +   ++  N
Sbjct: 561 GYKIWNRDWRLFIRAKNIDLIAHRH-IYDPELLRQERKEMRERARN 605

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  275 bits (704), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 166/520 (31%), Positives = 266/520 (51%), Gaps = 17/520 (3%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
             + E +++ +K RH                   T L + GP G+ I +L M    Y V 
Sbjct: 84  NAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVI 143

Query: 81  QSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW- 138
           Q+ GE+A  +  +   F  +    + PA G A  ++Y   W   F LEL      I+FW 
Sbjct: 144 QAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWP 203

Query: 139 -TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA-G 196
            + +V    +++IF+VL+  +N F  + Y E EF+    KV+ ++GF I    +  GA G
Sbjct: 204 GSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVG 263

Query: 197 VTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANP 256
            +G +G +YWR PG+ G        +   F G V++L+NAAF+   +E V +TA E ANP
Sbjct: 264 TSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANP 318

Query: 257 RKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIAIENSGTH 315
           RK++P A KK++                 VP D  +L  S DS +  SP++IA+   G +
Sbjct: 319 RKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVN 378

Query: 316 VLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSL 375
           V+P   NAVI+ +++S GNS  Y  SR+++ L+    AP I     + G P +A++++ L
Sbjct: 379 VVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISIL 438

Query: 376 FGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKA 435
           FG + ++  S   ++ F WLL I+G++  FTW  I LSHIRF +AL ++G S D+L FKA
Sbjct: 439 FGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKA 498

Query: 436 KWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID-----FLTAYISVFMFIAIWIAFQAWF 490
           +     +Y     M L +I Q + S  P    +     F T Y+++ MF+  +  ++ W 
Sbjct: 499 QTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWN 558

Query: 491 RC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           +  RL  R + +D+ + RR  +  V ++QE   +  K  N
Sbjct: 559 KDWRLFIRADQIDLVSHRRIFDADV-LKQEDIEYRAKLRN 597

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  275 bits (703), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 183/551 (33%), Positives = 277/551 (50%), Gaps = 35/551 (6%)

Query: 7   QDSKMKEEIREISVEV-EAETV---------RRELKQRHXXXXXXXXXXXXXXXXXVSTP 56
           +DS  + E  E+   + EAE V         +  LK RH                   T 
Sbjct: 56  KDSFRRVEPVEVDPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTA 115

Query: 57  LMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMY 116
           L   GP   LI +    T+ YS+  +LGE+A   P++  FT ++ RF+  +FG AN + Y
Sbjct: 116 LRTGGPASLLIGWGSTGTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNY 175

Query: 117 WFSWCITFALELSVVGQVIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
              W +   LE+      + FW T       ++++FW+++  +NMF VK YGE EF  + 
Sbjct: 176 MLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSF 235

Query: 176 VKVVAIMGFLIYCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLI 234
           +KV+ ++GF+I    + CG G  G     +YW  PGAF     A D   A+F G  S  +
Sbjct: 236 IKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFV 290

Query: 235 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT 294
            +AF+F G+ELVG+ A E+ +PRK+VP+A K+V                  VPY+D  L 
Sbjct: 291 TSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLI 350

Query: 295 STDSY-VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLA 353
              S   +ASPF+IAI+  G   LP + N VI+  ++S GNS IY  SR M  L+  R  
Sbjct: 351 GASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFL 410

Query: 354 PGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLS 413
           P I +   + G P V + VTS FG +A++  S      FNWLL ++G++  FTW  I + 
Sbjct: 411 PQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICIC 470

Query: 414 HIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDF 469
           HIRF +AL  +G   D+L FK+      +Y+G+F + ++ I Q + +  P     +   F
Sbjct: 471 HIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGF 530

Query: 470 LTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAV----------EEAVWIEQ 518
             AY+S  + +A+++  + + R  +L    ED+DIDT RR V          EE   +  
Sbjct: 531 FEAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMAT 590

Query: 519 EPRGFWDKFWN 529
           +P+  W + WN
Sbjct: 591 KPK--WYRIWN 599

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  274 bits (700), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/517 (30%), Positives = 267/517 (51%), Gaps = 13/517 (2%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           + +   + + L  RH                  S+ L N GP+   ++++ ++ + Y V 
Sbjct: 40  KCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVM 99

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
            +L EM  ++P   +    + R+V P+ G A G+ Y +S+ I  A ELS    V+Q+WT 
Sbjct: 100 NTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTD 159

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            V +A WI+IF V++ G+N  PVK+YGE EFW A +K++ I+G LI    +  G   +  
Sbjct: 160 KVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHD 219

Query: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 258
            +GFRYW +PG F   I     N  RFL   +++I + F F    EL+G+   EA + R+
Sbjct: 220 RLGFRYWNNPGPFAYHITG--GNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRR 277

Query: 259 TVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWK----LTSTDSYVSASPFIIAIENSGT 314
            + +A ++ +                 +  DD K    LTS     ++SPF+  I N+G 
Sbjct: 278 NIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGI 337

Query: 315 HVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTS 374
            VL HI NAVI+++  S+ NS +Y  SR +  L+    AP + +R  + GVP+ AV +++
Sbjct: 338 PVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALST 397

Query: 375 LFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFK 434
               L Y+  S+   + F WL NI  ++GF  W  I ++++RF +A+    +  + +PFK
Sbjct: 398 AVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFK 456

Query: 435 AKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQAWFRC 492
           +   P   Y+ V F+ L+ +  G+ +F P  WN  DF+ AYI++ +F  +++  + WF+ 
Sbjct: 457 SALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKT 516

Query: 493 RLIWRVEDVDIDTDRRAVEEAVWIEQ--EPRGFWDKF 527
           R      ++D+ T     EE   + Q   P+  W+KF
Sbjct: 517 RWYIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 173/544 (31%), Positives = 275/544 (50%), Gaps = 28/544 (5%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
            D   KE+ +E S       +++ LK RH                  S+ L N GP G  
Sbjct: 78  DDEAEKEQGKERSSS--NGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLF 135

Query: 67  IAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFVSPAFGAANGYMYWFSWC 121
           I+YL ++T  Y +  +LGEM  F+P   S +  S      ++V P+ G A  + Y++ + 
Sbjct: 136 ISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFV 195

Query: 122 ITFALELSVVGQVIQFWTFA--VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVV 179
           I  A E+S    VI++W +A  VP  AWI+IF  L+  +N  PV  YGE EFW A +K++
Sbjct: 196 ILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKIL 255

Query: 180 AIMGFLIYCFCMVCGAG--VTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAA 237
            I G +I  F +  G G    G +GFRYW++PG+F   I         FL   + +I   
Sbjct: 256 CITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGGGG--GNFLDIYTGIIKGG 313

Query: 238 FT-FQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD----WK 292
           F+   G ELV +T+ E A+ R+ + +A K+ V                 V Y+D      
Sbjct: 314 FSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNA 373

Query: 293 LTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352
           L  + +   +SPF+I I+N+G   +PHI N  I+ +  SAGN+ ++  SR +  ++ +  
Sbjct: 374 LAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGN 433

Query: 353 APGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISL 412
           AP I  R  Q GVP+ AV  + L   LAY+  S+     FNW  NI+ ++GF  W+   +
Sbjct: 434 APKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACV 493

Query: 413 SHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFL 470
           ++IRF +A+    ++   +PF+AK      +Y +F+++LI +  G+  F P  WN  DF+
Sbjct: 494 AYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFI 552

Query: 471 TAYISVFMFIAIWIAFQAWFRCRL---IWRVEDVDIDTDRRAVEEAVWI----EQEPRGF 523
            AYI++ +FI +WI  + + R  L   +  ++ +D+ T    +EE         Q P+  
Sbjct: 553 AAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPKNK 612

Query: 524 WDKF 527
           W+KF
Sbjct: 613 WEKF 616

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  275 bits (703), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 171/543 (31%), Positives = 272/543 (50%), Gaps = 24/543 (4%)

Query: 5   HNQDSKMKE----EIREISVEVEAETVR-RELKQ----RHXXXXXXXXXXXXXXXXXVST 55
            N D   KE    E++E  V  E    + +ELKQ    RH                  + 
Sbjct: 75  ENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAK 134

Query: 56  PLMNAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGY 114
            L NAGP G LI Y  M T  Y + Q+ GE+A ++  ++  F V+    V PAFG +  +
Sbjct: 135 ALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAW 194

Query: 115 MYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
           +Y   W     LEL      I++WT  V    ++ IF+VL+  +N F  + Y E EF+  
Sbjct: 195 VYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFN 254

Query: 175 LVKVVAIMGFLIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSL 233
             K++ ++GF I    +   GAG  G +G RYW  PGAF     A D+    F G ++++
Sbjct: 255 CCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATM 309

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWK 292
           + AAF F  TE + +TA E +NPRK +P A KKV+                 VPYD D  
Sbjct: 310 VTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQL 369

Query: 293 LTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352
           + S  S   ASP+++A+   G  V+PH  NAVI+ +++S GNS  Y  SR++Y L+    
Sbjct: 370 MGSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGN 429

Query: 353 APGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISL 412
           AP       + G P+ A++   +F  +++   S   ++ F WLL I+G++  FTW  I L
Sbjct: 430 APKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICL 489

Query: 413 SHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGI 467
           SHIRF +A+ ++  S  ++ FKA+     +YY  F + +I+I Q + +  P      +  
Sbjct: 490 SHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQ 549

Query: 468 DFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDK 526
            F   Y+++ + I  ++ ++ W +   L  R  ++D+D  R+  +E + ++QE   + +K
Sbjct: 550 GFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEEL-LKQEDEEYREK 608

Query: 527 FWN 529
             N
Sbjct: 609 LKN 611

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  273 bits (698), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 169/521 (32%), Positives = 272/521 (52%), Gaps = 29/521 (5%)

Query: 10  KMKEEIREISVEVEAETVR-----RELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           K  E++ ++   +   T R     R+L  RH                   + L   GP  
Sbjct: 49  KKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPAS 108

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            +IA+  ++T  +++  +LGE+A   PV   F V+  R V P+ G A    Y   W +  
Sbjct: 109 LVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLL 168

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++W  +V   AW+++F+V +   ++  VK +GE EF +++VK++AI GF
Sbjct: 169 PLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGF 228

Query: 185 LIYCFCMVCGAG-VTGPVGFRYWRHPGAF---GPGIIAKDKNQARFLGWVSSLINAAFTF 240
            I    ++CG G   G +G +YW  PG+F    PG        ++F G  S  + AAF++
Sbjct: 229 TILGIVLICGGGPKNGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSY 280

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV 300
            GTELVG++A E+ANPR T+P+A K+                   V +DD KL S  S V
Sbjct: 281 SGTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSV 340

Query: 301 --SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358
             +ASP +IAIEN G   LP + NA+I+  IIS  NS++Y  SR M  ++     P I +
Sbjct: 341 DVAASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFT 400

Query: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418
                G P VA++ T +FG L+++  S   ++ F WL  ++G++  F WL I++SHIRF 
Sbjct: 401 YIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFR 460

Query: 419 QALEMRGISRDDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSFCPW--NGID---FLT 471
           +AL  +G S D+LP+ +  M G+  ++YG   + L++I   +TS  P   +G D   F  
Sbjct: 461 RALNTQGYSLDELPYLS--MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFK 518

Query: 472 AYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE 511
            Y+S+ +F+  ++  + + R    + R   +D++T RR ++
Sbjct: 519 GYLSLPIFLFCFVGHKLYKRNWSWMIRSNKIDVNTGRRMID 559

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  274 bits (701), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 162/516 (31%), Positives = 272/516 (52%), Gaps = 15/516 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +++++++ ++ RH                   T L++AGP G LI Y  M ++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 83  LGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GEMA  +  +T  +  +    V   FG A  ++Y   W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAGVTGP 200
           V    ++ IF+VL+  +N+F  + Y E EF+    K++ + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YW  PGAF  G  A D    RF G  ++L+ AAF F G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAFN-GKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
           P A K+++                 VPY+ D  L ST     ASP++IA+ + G  V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPH 406

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S  NS+ Y  +R+   LS    AP + S   + G P +A+ V++LF  +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVI 466

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           A+   S   ++ F WLL I+G++  FTW  I LSH+RF +A++++G S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC-R 493
             + Y    M LI+I Q + +  P      +   F   Y+++ + IA+++ ++ W +  +
Sbjct: 527 WGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWK 586

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           L  R + +D+D+ R+  +E + I+QE   + ++  N
Sbjct: 587 LFIRADKIDLDSHRQIFDEEL-IKQEDEEYRERLRN 621

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  274 bits (700), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 168/541 (31%), Positives = 273/541 (50%), Gaps = 28/541 (5%)

Query: 13  EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
           E+   +  + E   +++ L+ RH                  S+ L   GP G  I+Y+ +
Sbjct: 92  EKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIII 151

Query: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQ-----RFVSPAFGAANGYMYWFSWCITFALE 127
           + + Y +  +LGEM  F+P   S +  S      R+V P+ G A G+ Y++ + I  A E
Sbjct: 152 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAE 211

Query: 128 LSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
            +    V+++WT AVP   WI+IF  ++  +N   VK YGE EFW A +K++ I+G +I 
Sbjct: 212 CTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIIL 271

Query: 188 CFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTEL 245
            F +  G G     +GFRYW+HPGAF   +     +   F    + +I  AF F  G EL
Sbjct: 272 SFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPEL 329

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY----VS 301
           V +T+ E A+ R+ + +A ++ V                 VPY+D  L +  +       
Sbjct: 330 VCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAG 389

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           +SPF+I I+N+G  VLPHI N  I+ +  SA N+ ++  +R +  ++ +  AP  L R  
Sbjct: 390 SSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRIN 449

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + GVP+VAV V+ L   LAY+  S+     FNW  NI+ ++GF  W+   ++++RF +A+
Sbjct: 450 KWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAI 509

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMF 479
              G+  D LPFK    P   ++ +  + +I I  G+  F P  W   DF+ AYI++ +F
Sbjct: 510 FYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIF 568

Query: 480 IAIWIAFQAWFRCRLIWR-----VEDVDIDTDRRAVEEAVWIEQE----PRGFWDKFWNV 530
           + +W   + + R    WR     V ++D+ T    +EE     +E    P GF DKF + 
Sbjct: 569 LVLWFGHKLYTR---TWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDA 625

Query: 531 V 531
           +
Sbjct: 626 L 626

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  275 bits (702), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 167/529 (31%), Positives = 270/529 (51%), Gaps = 18/529 (3%)

Query: 13  EEIREISVEVE--AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYL 70
           + I++ S E E   E +++ +K RH                  S  L NAGP G +I Y 
Sbjct: 129 DGIKQSSQEQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYA 188

Query: 71  FMATLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129
            M +  Y + Q+ GE+A  +  +   F  +    V PA G +  +++   W     LEL 
Sbjct: 189 IMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELV 248

Query: 130 VVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCF 189
                I++WT  V    ++ IF+VL+  +N+F  K Y E +F+    K++ I GF I   
Sbjct: 249 TASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAI 308

Query: 190 CMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGI 248
            + CG AG  G +G RYWR PGAF       D +  RF G V++ + AAF F  +E + +
Sbjct: 309 IIDCGGAGTDGYIGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAM 363

Query: 249 TAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPY-DDWKLTSTDSYVSASPFII 307
           TA E +NPRK +P A KK++                 VPY  D  L +  S   ASP++I
Sbjct: 364 TASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVI 423

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367
           A+ + G  V+PH  NAVI+ +++S  NS  Y  SRI+  L+    AP       + G P 
Sbjct: 424 AVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPA 483

Query: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427
           VA++V+++FG +A+  +S   +  F WLL I+G++  FTW+ I LSHIRF + ++++G S
Sbjct: 484 VAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRS 543

Query: 428 RDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTA------YISVFMFIA 481
             ++ +K++     + Y V  M L +I Q + +  P  G   L+A      Y+++ + IA
Sbjct: 544 LGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIA 603

Query: 482 IWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++I ++ W R   L    + +D+ + R   +E + ++QE   + D+  N
Sbjct: 604 LYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEEL-LKQEDEEYKDRLRN 651

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  273 bits (698), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 178/535 (33%), Positives = 269/535 (50%), Gaps = 25/535 (4%)

Query: 13  EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
            E  ++++      ++  LK RH                   T L   GP   LI +   
Sbjct: 72  SEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGST 131

Query: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132
            T+ Y++  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE+    
Sbjct: 132 GTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSAS 191

Query: 133 QVIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191
             + FW T       ++++FW+ +  +NMF VK YGE EF  + +KV+ ++GF+I    +
Sbjct: 192 ITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIIL 251

Query: 192 VCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITA 250
            CG G TG     +YW  PGAF     A D   A+F G  S  + AAF+F G+ELVG+ A
Sbjct: 252 NCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAA 306

Query: 251 GEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAI 309
            E+  PRK+VP+A K+V                  VPY+D  L    S   +ASPF+IAI
Sbjct: 307 SESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAI 366

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
           +  G   LP + N VI+  ++S GNS IY  SR M  L+  R  P I S   + G P V 
Sbjct: 367 KTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVG 426

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
           + VTS FG +A++  S    + FNWLL ++G++  FTW  I + HIRF +AL  +G   D
Sbjct: 427 IAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLD 486

Query: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIA 485
           +L FK+      +Y+G+F + ++ I Q + +  P     +   F  AY+S  + + ++I 
Sbjct: 487 ELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIG 546

Query: 486 FQAWFRC-RLIWRVEDVDIDTDRRAV----------EEAVWIEQEPRGFWDKFWN 529
            + + R  +L    E +DIDT RR V          EE   +  +PR  W + WN
Sbjct: 547 HKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPR--WYRIWN 599

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  271 bits (694), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 171/555 (30%), Positives = 282/555 (50%), Gaps = 36/555 (6%)

Query: 5   HNQDSKMKEEIREI----------SVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVS 54
            N+   +KEE ++I             +    + + L  RH                   
Sbjct: 11  KNEKWTLKEESQDIPSITETRQEEEETLNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSG 70

Query: 55  TPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGY 114
           T L + GP   ++ ++ ++T  ++V  SLGE+A   P+   F V+  RFV P+ G A   
Sbjct: 71  TALSDGGPASLVVGWVIISTCLFTVINSLGELAAAFPIVGGFNVYITRFVDPSVGFAVNL 130

Query: 115 MYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
            Y   W +   LEL      I++W   +   AW++IF+V +   NM  VK +GE EF ++
Sbjct: 131 NYLAQWLVLLPLELVAASLTIKYWNDKINSDAWVAIFYVTIVLANMLEVKSFGETEFVLS 190

Query: 175 LVKVVAIMGFLIYCFCMVCGAGVTGPVG-FRYWRHPGAFGPGIIAKDKNQARFLGWVSSL 233
           +VK++AI+GF I    +  G G +G    F+YW +PGAF  G      N ++F G  S  
Sbjct: 191 MVKILAIIGFTILGIVLASGGGPSGGYLGFKYWNNPGAFVGG-----TNASKFKGLCSVF 245

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL 293
           + AAF+F G E++ ++A E+ NPRK +P+A K+                   VPY+D +L
Sbjct: 246 VTAAFSFSGIEMIAVSAAESKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRL 305

Query: 294 ----TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLST 349
               TS D+  +ASP +IAIEN G   LP + NA+I+  I+S  NS +Y  SR M  ++ 
Sbjct: 306 LNAATSVDA--AASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAH 363

Query: 350 SRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLF 409
               P +LS+  + G P  A++VT +FG L+++  S    + F WL  ++G++  F W+ 
Sbjct: 364 IGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMA 423

Query: 410 ISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----- 464
           I+ S IRF +A++++  S D+LP+ ++     A+YGV  + L+I+   +TS  P      
Sbjct: 424 INYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHA 483

Query: 465 NGIDFLTAYISVFMFIAIWIAFQAWF--RCRLIWRVEDVDIDTDRRAV-EEAVWIEQEPR 521
           +   F  +++S+ + +  +   + +F    RL    E++DID+ R+ + EE +  E+E  
Sbjct: 484 DAESFFESFLSLPILLVCYFGHKLYFARNWRLQIGAEEMDIDSGRKIIDEEGLKQEREEE 543

Query: 522 ------GFWDKFWNV 530
                  F  KFW+V
Sbjct: 544 EKAMNSSFLIKFWHV 558

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  274 bits (700), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/532 (31%), Positives = 274/532 (51%), Gaps = 18/532 (3%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           +S +K+  +E   +   E +++ +K RH                  S  L NAGP G +I
Sbjct: 126 ESGIKQPSQE--QDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVI 183

Query: 68  AYLFMATLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
            Y  M +  Y + Q+ GE+A  +  +   F  +    V PA G +  ++Y   W     L
Sbjct: 184 GYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPL 243

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           EL      I++WT  V    ++ IF+VL+  +N+F  K Y E +F+    K++ I+GF I
Sbjct: 244 ELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFI 303

Query: 187 YCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
               + CG AG  G +G RYW +PGAF       +    RF G V++ + AAF F  +E 
Sbjct: 304 LAIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQ 358

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPY-DDWKLTSTDSYVSASP 304
           + +TA E +NPRK +P A KK++                 VPY  D  L ++ S   ASP
Sbjct: 359 LAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASP 418

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           ++IA+ + G  V+PH  NAVI+ +++S  N   Y  SRI+  L+    AP       + G
Sbjct: 419 YVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREG 478

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
            P VA+LV+S+FG +A+  +S   +  F WLL I+G++  FTW+ I LSHIRF +A++++
Sbjct: 479 RPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQ 538

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTA------YISVFM 478
           G S  ++ +K++     + Y +  M L +I Q + +  P  G   L+A      Y+++ +
Sbjct: 539 GRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPI 598

Query: 479 FIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            IA+++ ++ W +   L    + +D+ TDR+  +E + ++QE   + +K  N
Sbjct: 599 LIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEEL-LKQEDEEYQEKLRN 649

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  271 bits (694), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 163/526 (30%), Positives = 275/526 (52%), Gaps = 20/526 (3%)

Query: 7   QDSKMKEEIREISVEVEAETVR--RELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
            ++K  E +   S EVE +  R  ++L  RH                     L   GP  
Sbjct: 50  SETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGS 109

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            +I ++ ++T  +++  +LGE+++  PV   F V+  RFV P+FG A    Y   W +  
Sbjct: 110 LVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLL 169

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++W   +   AW++IF+ ++   N+  VK +GE EF +++VK++AI+GF
Sbjct: 170 PLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGF 229

Query: 185 LIYCFCMVC-GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
            I    + C G    G +G +YW +PGAF  G  A D    RF G  S  + AAF++ GT
Sbjct: 230 TILGIVLTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGT 284

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY--VS 301
           EL+ ++A E+ NPR T+P+A K+                   V  DD +L +  S   V+
Sbjct: 285 ELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVA 344

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASP +IAIEN G   LP + NA+I+  ++S  NS +Y  SR M  ++     P + +   
Sbjct: 345 ASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVD 404

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P  A++ T +FG L+++  S   ++ F WL  ++G++  F W  I++SHIRF + +
Sbjct: 405 RKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTM 464

Query: 422 EMRGISRDDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTAYI 474
           + RG + D+LPF +  M G+  +YYG   + +++++  +TS  P      N   F   Y+
Sbjct: 465 KERGRTLDELPFVS--MTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYL 522

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           S  + +A +   + + R  RL+   +++D+D+ RRAV+  +  +++
Sbjct: 523 SFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKDEK 568

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/519 (31%), Positives = 264/519 (50%), Gaps = 16/519 (3%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           E + E +++ +K RH                  S  L NAGP G +I Y  M +  Y + 
Sbjct: 139 EQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCII 198

Query: 81  QSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 139
           Q+ GE+A  +  +   F  +    V PA G +  +++   W     LEL      I++WT
Sbjct: 199 QACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWT 258

Query: 140 FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVT 198
             V    ++ IF+VL+  +N+F  K Y E +F+    K++ I+GF I    + CG AG  
Sbjct: 259 VKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTD 318

Query: 199 GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 258
           G +G +YWR PGAF       D    RF G V++ + AAF F  +E + +TA E +NPRK
Sbjct: 319 GYIGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRK 373

Query: 259 TVPRAIKKVVXXXXXXXXXXXXXXXXXVPY-DDWKLTSTDSYVSASPFIIAIENSGTHVL 317
            +P A KK++                 VPY  D  L +  S   ASP++IA+ + G  V+
Sbjct: 374 AIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVV 433

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           PH  NAVI+ +++S  NS  Y  SRI+  L+    AP       + G P VA+LV++LFG
Sbjct: 434 PHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFG 493

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            +A+  +S   +  F WLL I+G++  FTW+ I LSHIRF +A++++G S  ++ +K++ 
Sbjct: 494 VIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQV 553

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTA------YISVFMFIAIWIAFQAWFR 491
               + Y V  M L +I Q + +  P  G   L+A      Y+++ + IA++I F+ W  
Sbjct: 554 GVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKN 613

Query: 492 C-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
              L      VD+ + R   +E + ++QE   + ++  N
Sbjct: 614 DWSLFIPANKVDLVSHRNIFDEEL-LKQEDEEYKERLRN 651

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  273 bits (698), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/521 (31%), Positives = 262/521 (50%), Gaps = 16/521 (3%)

Query: 19  SVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYS 78
            ++ E E +++ +K RH                  +  L NAGP G +I Y  M +  Y 
Sbjct: 134 QMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYC 193

Query: 79  VTQSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQF 137
           + Q+ GEMA  +  +   F  +    V P FG A  ++Y   W     LEL      I++
Sbjct: 194 IIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKY 253

Query: 138 WTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAG 196
           WT  V   A++ IF+V++  + +F  + Y E EF+    K++ I+GF I    +   GAG
Sbjct: 254 WTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAG 313

Query: 197 VTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANP 256
             G +G +YW  PGAF            RF G +++ ++AAF F  TE + +TA E +NP
Sbjct: 314 NDGYLGAKYWHDPGAF-----RGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNP 368

Query: 257 RKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTH 315
           RK +P A KKV+                 VP+D D  + +  S   ASP+++AI   G  
Sbjct: 369 RKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVR 428

Query: 316 VLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSL 375
           V+PH  NAVI+ ++ S  NS  Y  SR++ GL+    AP       + G P+ A+   +L
Sbjct: 429 VVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAAL 488

Query: 376 FGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKA 435
           FG +A+   S    + F WLL I+G++  FTW+ I +SHIRF +A+ ++G S  ++ FKA
Sbjct: 489 FGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKA 548

Query: 436 KWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGID-----FLTAYISVFMFIAIWIAFQAW 489
           +     +YY    M L +I Q + +  P  N  D     F   Y+++ + IA +  ++ W
Sbjct: 549 QLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLW 608

Query: 490 FRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            R  RL  R +D+D+D+ R+  +E + ++QE   + +K  N
Sbjct: 609 KRDWRLFIRAKDIDLDSYRQVFDEEL-LKQEDEEYKEKLKN 648

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  271 bits (692), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 162/491 (32%), Positives = 262/491 (53%), Gaps = 22/491 (4%)

Query: 57  LMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMY 116
           L + GP   +I ++ ++T  ++V  +LGEMA   PV   F V+  RFV P+ G A    Y
Sbjct: 100 LASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINY 159

Query: 117 WFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALV 176
              W +   LEL      I++W   +   AW++IF+ ++   NM  VK +GE EF +++V
Sbjct: 160 LAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMV 219

Query: 177 KVVAIMGFLIYCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLIN 235
           K++AI+GF I    + CG G  G     +YW +PG+F         +  +F G  S  + 
Sbjct: 220 KILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVT 274

Query: 236 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTS 295
           AAF++ G E+  ++A E+ +PR+T+P+A K+                   VPYD+ +L S
Sbjct: 275 AAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLS 334

Query: 296 TDSYVSA--SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLA 353
             S V A  SP +IAIEN G   LP + NA+I+ +IIS  NS +Y  SR M  ++     
Sbjct: 335 GSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNL 394

Query: 354 PGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLS 413
           P +L    + G P  A+L T  FG L+++  S    + F WL  ++G++  F W+ I++S
Sbjct: 395 PQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINIS 454

Query: 414 HIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI-----D 468
           HIRF QA++ +  S D+LP+ ++     ++YGV  + L++I+  +TS  P  G       
Sbjct: 455 HIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAES 514

Query: 469 FLTAYISVFMFIAIWIAFQAWFRCR-LIWRVEDVDIDTDRRAVE-----EAVWIEQE--- 519
           F   Y+S  + IA ++  +  +R + ++  +ED+DIDT RR V+     + +  EQE   
Sbjct: 515 FFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEHLA 574

Query: 520 PRGFWDKFWNV 530
              F+ +F +V
Sbjct: 575 KSSFFARFLHV 585

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  271 bits (693), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 167/532 (31%), Positives = 271/532 (50%), Gaps = 25/532 (4%)

Query: 12  KEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
           K EI ++  E+  E +++ ++ RH                   T L +AGP G +I Y  
Sbjct: 85  KVEISQVDDELN-EKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAI 143

Query: 72  MATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 130
           MA+  Y + Q++GEMA  ++ +   F  +    V PA   +  ++Y   W     LEL  
Sbjct: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203

Query: 131 VGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGFLIYCF 189
               IQ+WT  V    ++ IF++L+  +N+F   + Y E EF     K++ ++GF I   
Sbjct: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263

Query: 190 CMVCG-AGVTGPVGFRYWRHPGAF----GPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
            ++CG AG  G +G +YWR PGAF    GP          RF G VS+L+ AAF+F  TE
Sbjct: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RFKGVVSTLVTAAFSFGQTE 314

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSAS 303
            + ITA E +NPRK +P A KKV+                 VPYD  +L  S+ +   AS
Sbjct: 315 FLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS 374

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P+++A+   G  V+PH  NAVI+ ++ S  +S  Y  SR++  L+    AP + +   + 
Sbjct: 375 PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRT 434

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P +  LV ++   +A+   S+   + FNWLL I+G++  FTW  I LSHIRF +A+++
Sbjct: 435 GRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKV 494

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFM 478
           +G S D++ +K++     + Y    M LI+I Q +    P      +   F   Y+++ +
Sbjct: 495 QGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPV 554

Query: 479 FIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           FI +++ ++ W R  RL  R +D+D+    R + +   + QE   + +K  N
Sbjct: 555 FIVLYLGYKIWKRDWRLFIRAKDIDL-ISHRHIHDPEILRQEREEYQEKLRN 605

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  270 bits (691), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 266/526 (50%), Gaps = 18/526 (3%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
            QDS ++E+   I  + +   +++ +K RH                  +  L  AGP   
Sbjct: 57  KQDSDLEEDTDTIVTDTQ---LKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPL 113

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           +IAY  ++ + Y + Q+ GEMA   P +  +F  +   F+S  FG A  ++++  W    
Sbjct: 114 VIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVL 173

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      +Q+W  ++    ++ IF+V L  ++ F VK YGE EF   L K++ + GF
Sbjct: 174 PLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGF 233

Query: 185 LIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
           +I+   + V GAG +G +G +YW  PGAF       D N  RF G    L+ A F++ G 
Sbjct: 234 IIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGM 288

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSA 302
           EL  ++  E  NPR++ P A K+ +                 VP +  +L  S  S   A
Sbjct: 289 ELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHA 348

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP+++A    G  V+PHI NAVI+ ++IS GNS +Y   R+M  L+    AP  +    +
Sbjct: 349 SPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDR 408

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G P  A++V S+FG + ++  S+  ++ FNWL  I G+A  FTW  I +SHIRF QA++
Sbjct: 409 EGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMK 468

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVF 477
           ++  S D++ +K+ +    +Y+GVFF  L+ + Q + +  P      +   F  +Y++  
Sbjct: 469 LQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFP 528

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE-EAVWIEQEPR 521
           +F A +  +  W R   L   +E VD+D  RR  + E V  E E +
Sbjct: 529 IFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEK 574

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  270 bits (691), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 267/512 (52%), Gaps = 14/512 (2%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           D  + E+ R I++      ++  LK RH                   T L  AGP   +I
Sbjct: 71  DPNLTEQER-IAIITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLII 129

Query: 68  AYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALE 127
            +    ++ YS+  ++ EMA   P++  FT ++ RF+  +FG AN + Y   W +   LE
Sbjct: 130 GWSITGSMIYSMVMAVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLE 189

Query: 128 LSVVGQVIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           +      + +W T       ++++FW+++  +N+F VK YGE EF  + +KV+ ++GF+I
Sbjct: 190 IVSASITVNYWGTPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFII 249

Query: 187 YCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
               +VCG G TG     +YW  PGAF           A+F G+ S  + AAF+F G+EL
Sbjct: 250 LGLVLVCGGGPTGGYVGAKYWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSEL 304

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASP 304
           +GI   EA NPRK VP A K+V                  VP +D +L  S++   +ASP
Sbjct: 305 IGIAGSEAENPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASP 364

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+IAI   G   LP + N VI+  ++S GNS IY  SR +  L+     P ++S   + G
Sbjct: 365 FVIAITVHGIRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSG 424

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
            P V + ++S FG +A++  S      FNWLL I+G++ FFTW  I L HIRF  AL+ +
Sbjct: 425 RPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQ 484

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFI 480
             S D+LPF +      +Y+G+F + L++  Q + +  P     +  +F +AY+S+ + +
Sbjct: 485 NRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVL 544

Query: 481 AIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE 511
            ++IA + W +  ++   +  +D+DT R+ ++
Sbjct: 545 VMYIAHKLWTKNWKIFIPLGQLDLDTGRKQLD 576

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 169/543 (31%), Positives = 269/543 (49%), Gaps = 29/543 (5%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+ D   +E+I   ++        +EL  RH                     L   GP  
Sbjct: 71  HSDDDVQQEDINNTNLS-------KELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPAS 123

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            +I ++ ++T  ++V  SLGE++   PV   F V+S RFV P+F  A    Y   W +  
Sbjct: 124 LVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLL 183

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++W   +   AW++IF+  +   NM  VK +GE EF ++++K++AI+GF
Sbjct: 184 PLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGF 243

Query: 185 LIYCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
            I    + CG G  G     +YW  PGAF    +  D    +F G  S  + AAF++ G 
Sbjct: 244 TILGIVLSCGGGPHGGYIGGKYWNDPGAF----VGHDSG-TKFKGLCSVFVTAAFSYSGI 298

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA- 302
           E+  ++A E+ NPR+T+P+A K+                   VP +D +L +  S V A 
Sbjct: 299 EMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAA 358

Query: 303 -SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
            SP +IAIEN     LP + NA+I+  ++S  NS +Y  SR M  ++     P  L R  
Sbjct: 359 SSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVD 418

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P  A+++T  FG L+++  S    + F WL  ++G++  F W+ I+LSHIRF QA+
Sbjct: 419 KRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAM 478

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISV 476
           + +  S D+LPF ++     + YG   + L++I   +TS  P      N   F   Y+S 
Sbjct: 479 KFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSF 538

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE-----EAVWIEQE---PRGFWDKF 527
            + I  +   + + R  RL+ ++ED+D+DT R+ V+     + + IEQE    R F  +F
Sbjct: 539 PILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRF 598

Query: 528 WNV 530
             V
Sbjct: 599 LRV 601

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  270 bits (691), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 173/533 (32%), Positives = 273/533 (51%), Gaps = 17/533 (3%)

Query: 8   DSKMKEEIR-EISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           DS ++ + R E   + +A  +++ +K RH                   T L N+GP G +
Sbjct: 89  DSDIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLV 148

Query: 67  IAYLFMATLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y  M +  Y + Q+ GE+A  +  +T  F  +    + PAFG A  ++Y   W     
Sbjct: 149 IGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCP 208

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGF 184
           LEL      I++WT  V    ++ IF+ L+  +N+      Y E EF+    K++ + GF
Sbjct: 209 LELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGF 268

Query: 185 LIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
            I    ++CG AG  G +G R W +PG+F       DK   RF G VS+L+NAAF F  +
Sbjct: 269 FILGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMS 323

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSA 302
           E +G+TA E +NPRK +P A KK++                 VPYD D  L S+ +   A
Sbjct: 324 EFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKA 383

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP+++AI   G  V+PH  NAVI+ +++S GNS  Y  SR +  LS    AP  L+   +
Sbjct: 384 SPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDR 443

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
           +G P  A  V++L G +A+  TS    + F WLL I+G++  FTW  I LSH+RF +A+ 
Sbjct: 444 NGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMR 503

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTAYISVF 477
           ++G S  ++ FK++     + Y    M LI+I Q +T+  P      +   F   Y+++ 
Sbjct: 504 VQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMP 563

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           +FI ++  F+ W +  RL  R ED+D+ + R   +E + ++QE   +  K  +
Sbjct: 564 IFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEEL-LKQEDEEYRRKLRD 615

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  268 bits (686), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 160/535 (29%), Positives = 267/535 (49%), Gaps = 14/535 (2%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
               S ++ +  ++  + E   +++ L  RH                  S+ L   GP  
Sbjct: 30  RTSHSNLESQNSDVVSDYE-HNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAP 88

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
             ++++ ++T+ Y +  +L EM  ++P   S      R+V P+ G A G+ Y +S+ +  
Sbjct: 89  LFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLV 148

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
           A EL+    ++++WT  VP   WI+IF +++  +N   V++YGE EFW A +K++ I+  
Sbjct: 149 ATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILAL 208

Query: 185 LIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QG 242
           L+    +   GA     VGFRYWR+PGAFG  I     N  RFL   +++I +AF F   
Sbjct: 209 LVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITG--GNLGRFLDLWTAIIKSAFAFILS 266

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWK----LTSTDS 298
            ELVG+   EA + R+ + +A ++ +                 V  +D      L     
Sbjct: 267 PELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRP 326

Query: 299 YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358
             ++SPF+  I NSG  VL H+ N  I+ +  SAGNS  Y  SR +  LS    AP I S
Sbjct: 327 GAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFS 386

Query: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418
           +  + GVP+ AV + SL   LAY+  S+   K F WL NI  ++GF  W  I +++IRF 
Sbjct: 387 KINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFR 446

Query: 419 QALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISV 476
           +A+    +  D +P+++   P  AY+    + +I +  G+  F    W+  DFLT+YIS+
Sbjct: 447 KAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISL 505

Query: 477 FMFIAIWIAFQAWFRCRLIWRVEDVDIDTD--RRAVEEAVWIEQEPRGFWDKFWN 529
            +F+A ++  +  ++ R    V+ +D+ T       E  + + + P+  W+KF N
Sbjct: 506 PIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEEAEEEAKLSVVRVPKNAWEKFIN 560

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  269 bits (687), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/543 (30%), Positives = 272/543 (50%), Gaps = 22/543 (4%)

Query: 4   GHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPV 63
              +D     ++ +     +   + ++L  RH                     L   GP 
Sbjct: 41  AEEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPA 100

Query: 64  GALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
             +IA+  ++T  +++  SLGE++   PV   F V+  RFV P+FG A  + Y   W I 
Sbjct: 101 SLVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAIL 160

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMG 183
             LEL      I++W  ++   AW+SIF+V +   NM  VK +GE EF +++VK++AI+G
Sbjct: 161 LPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIG 220

Query: 184 FLIYCFCMVC-GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           F I    ++C G    G +G +YW  PGAF       D    RF G  +  I AAF++ G
Sbjct: 221 FTILGIVLICGGGPSGGFIGGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSG 275

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV-- 300
            ELVG++A E+ NPR T+P+A K+                   VP +D  L +  S V  
Sbjct: 276 LELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDA 335

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           +ASP +IAI+N G   LP + NA+I+  ++S  NS +Y  SR +  ++     P  L+  
Sbjct: 336 AASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHV 395

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P  A+ +T L G L+++  S    + F WL  ++G++  F W  I+L+H+RF  A
Sbjct: 396 DKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHA 455

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYIS 475
           ++ +  S ++LP+ +      ++YG   + L++I   +TS  P   NG D   F  +Y+S
Sbjct: 456 MKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLS 515

Query: 476 VFMFIAIWIAFQAWFR-CRLIWRVEDVDIDTDRRAVEEAVWIEQEP--------RGFWDK 526
           + +FIA ++  + W R  RL  ++ +VD+D+ R   + A   +++         + F+ +
Sbjct: 516 LPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIR 575

Query: 527 FWN 529
            WN
Sbjct: 576 LWN 578

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  269 bits (687), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/553 (30%), Positives = 285/553 (51%), Gaps = 32/553 (5%)

Query: 6   NQDSKMKEEI--REISVEVEAE---TVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           + +S  +E+I   + S EVEAE    +++ L  RH                  S  L   
Sbjct: 32  DLESLTREKITRSDSSSEVEAEGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTV 91

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIP-----VTSSFTVFSQRFVSPAFGAANGYM 115
           GP G +I+Y+ ++T+ Y +  +LGEM  ++P        S      R+V  +   A G+ 
Sbjct: 92  GPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWN 151

Query: 116 YWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
           Y++ + I  A E +    V+ +WT +VP A WI+IF  ++T +N   VKY+GE EFW A 
Sbjct: 152 YYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFAS 211

Query: 176 VKVVAIMGFLIYCFCMVCGAGVTG-PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLI 234
           +K++ I+G ++  F +  G G +   +GF YW+ PG F   I     +   FL   + +I
Sbjct: 212 IKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHITGG--SWGSFLDIYTGII 269

Query: 235 NAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD--- 290
             AF F  G ELV +T+ E  + R+ + +A K+ +                 V Y+D   
Sbjct: 270 KGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVL 329

Query: 291 -WKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLST 349
              L       ++SPF+I I+N+G  VLPHI NA I+++  SAGNS ++  SR +  ++ 
Sbjct: 330 LNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAH 389

Query: 350 SRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLF 409
           +  AP I  +  + GVP+ +V ++++   LA++  S+   + F+W  NI+ ++GF  W+ 
Sbjct: 390 NGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWIC 449

Query: 410 ISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGI 467
             ++++RF +A+    +  D LPFK    P L +Y +  +++I +  G+ +F P  W+G 
Sbjct: 450 AIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGS 508

Query: 468 DFLTAYISVFMFIAIWIAFQAWFR-------CRLIWRVEDVDIDTDRRAVEE-AVWIEQE 519
           DF+ AYI++ +F+ +W+  + W R        +L + V+++D+ T     EE A  ++  
Sbjct: 509 DFVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMN 568

Query: 520 ---PRGFWDKFWN 529
              P  +W KF N
Sbjct: 569 RIPPSTYWGKFIN 581

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  270 bits (690), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/536 (30%), Positives = 278/536 (51%), Gaps = 17/536 (3%)

Query: 5   HNQDSKMKEEIREISVEV--EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
             Q+ +  E    I      +++++++ ++ RH                   T L++AGP
Sbjct: 92  QRQELEKNESSDNIGARTGNKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGP 151

Query: 63  VGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
            G LI Y  M ++ Y + Q+ GEMA  +  +T  +  +    V   FG A  ++Y   W 
Sbjct: 152 AGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWL 211

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
               LEL      I++WT +V    ++ IF+VL+  +N+F  + Y E EF+    K++ +
Sbjct: 212 CVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMM 271

Query: 182 MGFLIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
            GF I    + V GAG  G +G +YW  PGAF  G  + D    RF G V++L+ AAF F
Sbjct: 272 TGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAF 326

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSY 299
            G+E + IT  E ANPRK VP A K+++                 VPY+  +L  S+   
Sbjct: 327 GGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGG 386

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
             ASP++IA+ + G  V+PH  NAVI+ +++S  NS+ Y  +RI+  LS    AP + + 
Sbjct: 387 TKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTY 446

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             + G P +A+ V++LFG +A+   S    + F WLL I+G++  FTW  I LSHIRF +
Sbjct: 447 IDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRR 506

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYI 474
           A++++G S  +L F+++     + Y    M LI+I Q + +  P      +   F   Y+
Sbjct: 507 AMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYL 566

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++ + IA+++ ++ W +  +L  R + +D+ + R+  +E + I+QE   F ++  N
Sbjct: 567 AMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIFDEEL-IKQEDEEFRERLKN 621

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  269 bits (687), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/524 (30%), Positives = 264/524 (50%), Gaps = 22/524 (4%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           ++    + ++L  RH                     L   GP   +I ++ ++T  ++V 
Sbjct: 80  DINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVI 139

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
            SLGE++   PV   F V+S RFV P+F  A    Y   W +   LEL      I++W  
Sbjct: 140 NSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWND 199

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            +   AW++IF+  +   NM  VK +GE EF ++++K+++I+GF I    + CG G  G 
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 201 VGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
               +YW  PGAF         +  +F G  S  + AAF++ G E+  ++A E+ NPR+T
Sbjct: 260 YIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA--SPFIIAIENSGTHVL 317
           +P+A K+                   VP +D +L +  S V A  SP +IAIEN G   L
Sbjct: 315 IPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGL 374

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           P + NA+I+  ++S  NS +Y  SR M  ++     P  L+R  + G P  A+L+T  FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            L+++  S    + F WL  ++G++  F W+ I+LSHIRF QA++++  S D+LPF ++ 
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTAYISVFMFIAIWIAFQAWFRC 492
               ++YG   + L++I   +TS  P      N   F   Y+S  + I  +   + + R 
Sbjct: 495 GVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRN 554

Query: 493 -RLIWRVEDVDIDTDRRAVE-----EAVWIEQE---PRGFWDKF 527
             L+ ++ED+D+DT R+ V+     E + +E+E    R F  +F
Sbjct: 555 WTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRF 598

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  269 bits (688), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 171/536 (31%), Positives = 276/536 (51%), Gaps = 19/536 (3%)

Query: 3   GGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           G +N D   KE+  +   + +   +++ +K RH                     L N GP
Sbjct: 76  GSNNPD---KEDGSDAGDKGD-NKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGP 131

Query: 63  VGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
            G +I Y  M +  Y + Q+ GE+A  +  ++  F  +    + PA G +  ++Y   W 
Sbjct: 132 AGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWL 191

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
               LEL      I++WT +V    +++IF+VL   +N+F  + Y E EF+    KV+ I
Sbjct: 192 CVMPLELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMI 251

Query: 182 MGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
            GF I    + CG AG  G +G +YW  PG+F     + DK    F G VS+L+ AAF F
Sbjct: 252 TGFFILGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAF 306

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSY 299
             TE + +TA E ANPRK++P A KKV+                 VP++  +L  S  S 
Sbjct: 307 GATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSA 366

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
             ASP++IAI + G  V+PH  NAVI+ +++S GNS  Y  SR++  L+    AP  L  
Sbjct: 367 THASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKY 426

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             + G P +A++++++FG ++++  S   +  F WLL I+G++  FTW  I LSHIRF +
Sbjct: 427 VDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRR 486

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYI 474
           A++++G S  +L FK++     +YY    M LI+I Q +T+  P      +   F   Y+
Sbjct: 487 AMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYL 546

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++ + IA++  ++ W R   L      +D+ ++RR  +E V ++QE   F +K  N
Sbjct: 547 AMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDV-LKQEDAEFREKLRN 601

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  270 bits (689), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 269/514 (52%), Gaps = 15/514 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +++++++ ++ RH                   T L++AGP G LI Y  M ++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 83  LGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GEMA  +  +T  +  +    V   FG A  ++Y   W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAGVTGP 200
           V    ++ IF+VL+  +N+F  + Y E EF+    K++ + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGY 291

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YW  PGAF  G+ A D    RF G V++L+ AAF F G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
           P A K+++                 VPY+ D  L S+     ASP++IAI + G  V PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPH 406

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S  NS+ Y  +R+   LS    AP I S   + G P +A+ V++LF  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVI 466

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           A+   S    + F WLL I+G++  FTW  I LSHIRF +A++++G S  +L FK++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC-R 493
             + Y    M LI+I Q + +  P      +   F   Y+++ + I +++ ++ W +  +
Sbjct: 527 WGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWK 586

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKF 527
           L  R + +D+ + R+  +E + I+QE   + ++ 
Sbjct: 587 LFIRADKIDLTSHRQIFDEEL-IKQEDDEYRERL 619

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  268 bits (685), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 157/500 (31%), Positives = 251/500 (50%), Gaps = 14/500 (2%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           ++    + + L  RH                     L + GP   +I ++ ++T  ++V 
Sbjct: 69  DINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVI 128

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
            +LGEMA   PV   F V+  RF+ P+ G A    Y   W +   LEL      I++W  
Sbjct: 129 NALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNE 188

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            +   AW++IF+ ++   NM  VK +GE EF ++++K++AI+GF I    + CG G  G 
Sbjct: 189 TINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGG 248

Query: 201 VGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
               +YW HPG+F         +  +F G  S  + AAF++ G E+  ++A E+ +PR T
Sbjct: 249 FIGGKYWNHPGSF-----VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTT 303

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA--SPFIIAIENSGTHVL 317
           +P+A K+                   VPYDD +L S  S V A  SP +IAIEN G   L
Sbjct: 304 IPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGL 363

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           P + NA+I+ +IIS  NS +Y  SR M  ++     P IL+R    G P  A++ T  FG
Sbjct: 364 PSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFG 423

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            L+++  S      F WL  ++G++  F W+ I+LSHIRF Q++  +  S D+LPF ++ 
Sbjct: 424 LLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQT 483

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCPWNGI-----DFLTAYISVFMFIAIWIAFQAWFRC 492
               ++YG   + L+++   +TS  P  G       F   Y+S  + +A +   + + R 
Sbjct: 484 GVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRK 543

Query: 493 R-LIWRVEDVDIDTDRRAVE 511
           R  +  + D+D+DT RR V+
Sbjct: 544 REFMVGLADMDLDTGRRQVD 563

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  268 bits (685), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 168/543 (30%), Positives = 272/543 (50%), Gaps = 26/543 (4%)

Query: 4   GHNQDSKMKEEIREISVEVEAETVRRELKQ----RHXXXXXXXXXXXXXXXXXVSTPLMN 59
            +NQ    K EI  I  +   + +  +L++    RH                     L N
Sbjct: 53  NNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHN 112

Query: 60  AGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWF 118
           AGP G LI Y+ MA+  Y + Q+ GEMA  ++ +   F  +    V  A+  A  ++Y  
Sbjct: 113 AGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCI 172

Query: 119 SWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVK 177
            W     LEL      I++W   V    +++IF++L+  +N+F   + Y E EF+  L K
Sbjct: 173 QWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCK 232

Query: 178 VVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAF---GPGIIAKDKNQARFLGWVSSL 233
           ++ I GF I    ++CG AG +G +G  YW +PGAF    PG         RF G VS+L
Sbjct: 233 ILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAFRGHTPG--------TRFKGIVSTL 284

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL 293
           + AAF+F  TE + ITA E +NPRK +P A KKV+                 VPY+  +L
Sbjct: 285 VTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPEL 344

Query: 294 T-STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352
             S  S   ASP++IA+ + G  + PH  NAVI+ +++S  NS+ Y  SR++  L+    
Sbjct: 345 LGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGY 404

Query: 353 APGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISL 412
           AP I +   + G P   ++  SL   +A+  +S    + F+WLL I+G++  FTW  I L
Sbjct: 405 APKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICL 464

Query: 413 SHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNG-----I 467
           SHIRF +A++++G S ++L +K++     + Y    M LI+I Q + +  P N       
Sbjct: 465 SHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANIT 524

Query: 468 DFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDK 526
           +F   Y+++ + +  +  ++ W +   L  R +D+D+ + R   +E V ++QE   + + 
Sbjct: 525 NFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDV-LKQEKNQYKEN 583

Query: 527 FWN 529
             N
Sbjct: 584 LKN 586

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  268 bits (686), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 162/540 (30%), Positives = 278/540 (51%), Gaps = 27/540 (5%)

Query: 2   LGGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
           +G +  ++ + EE+  I+ +     +++ L  RH                     L   G
Sbjct: 79  IGYNGNETIISEEL--INEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCG 136

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFVSPAFGAANGYMY 116
           P G + +YL ++T+ Y +   LGEM  ++P   S +  S     +R++  +   A G+ Y
Sbjct: 137 PAGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNY 196

Query: 117 WFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALV 176
           ++ + +  A E +    V+++WT  VP  AWI +F +++ G+NM PV+ YGE EFW A+ 
Sbjct: 197 YYCFVMLVAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAIS 256

Query: 177 KVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLIN 235
           K++ I+G +I  F +  G G     +GFRYW  PG+F   I   + +   FL     +I 
Sbjct: 257 KILCIVGLIILSFILFWGGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGIIL 314

Query: 236 AAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT 294
            AF+F  G ELV + + E ++PR+ + +A K+ +                 V Y+D  L+
Sbjct: 315 GAFSFILGPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILS 374

Query: 295 ST----DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTS 350
           +          +SPF+I I+N+G  VLPHI N  I+ +  S+GN+ ++  SR +  ++ +
Sbjct: 375 TALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAIN 434

Query: 351 RLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFI 410
             AP  L +  + GVP+VAV+V+ +   +AY+  S      F W  N++ ++GF  W+ +
Sbjct: 435 SQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIV 494

Query: 411 SLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGID 468
           S++++RF +A+E  G+ +D LP+     P L  Y +    +I I  GF    P  WN  D
Sbjct: 495 SVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSD 553

Query: 469 FLTAYISVFMFIAIWIA-------FQAWFR-CRLIWRVEDVDIDTDRRAVE-EAVWIEQE 519
           F+ AY+++ +F+ IWI        F+ + R CR  ++VED+D+ T    +E E+   E E
Sbjct: 554 FIAAYLTLPIFLMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFESE 613

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  270 bits (689), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 163/519 (31%), Positives = 266/519 (51%), Gaps = 16/519 (3%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           E + E +++ +K RH                  S  L NAGP G +I Y  M +  Y + 
Sbjct: 139 EQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCII 198

Query: 81  QSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 139
           Q+ GE+A  +  +   F  +    V PA G +  +++   W     LEL      I++WT
Sbjct: 199 QACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWT 258

Query: 140 FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVT 198
            +V    ++ IF+VL+  +N+F  K Y E +F+    K++ I+GF I    + CG AG  
Sbjct: 259 TSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTD 318

Query: 199 GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 258
           G +G +YWR PGAF       D    RF G V++ + AAF F  +E + +TA E +NPRK
Sbjct: 319 GYIGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRK 373

Query: 259 TVPRAIKKVVXXXXXXXXXXXXXXXXXVPY-DDWKLTSTDSYVSASPFIIAIENSGTHVL 317
            +P A KK++                 VPY  D  L +  S   ASP++IA+ + G  V+
Sbjct: 374 AIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVV 433

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           PH  NAVI+ +++S  N   Y  SRI+  L+    AP       + G P  A+LV++LFG
Sbjct: 434 PHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFG 493

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            +A+  +S   +  F WLL I+G++  FTW+ I LSHIRF +A++++G S  ++ +K++ 
Sbjct: 494 VIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQV 553

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTA------YISVFMFIAIWIAFQAWFR 491
               + Y V  M L +I Q + +  P  G   L+A      Y+++ ++IA++I ++ W +
Sbjct: 554 GVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKK 613

Query: 492 C-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
              L    + VD+ + R   +E + ++QE   + ++  N
Sbjct: 614 DWSLFIPADKVDLVSHRNIFDEEL-LKQEDEEYKERLRN 651

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  267 bits (682), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/522 (31%), Positives = 269/522 (51%), Gaps = 21/522 (4%)

Query: 13  EEIREISVEVEAETVR--RELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYL 70
           E +   S   +AE  R  ++L  RH                   + L   GP   +I ++
Sbjct: 54  ENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWV 113

Query: 71  FMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 130
            ++T  +++  +LGE+++  PV   F V+  RFV P+FG A    Y   W +   LEL  
Sbjct: 114 IISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVA 173

Query: 131 VGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC 190
               I++W   +   AW++IF+ ++   N+  VK +GE EF +++VK++AI+GF I    
Sbjct: 174 ASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 191 MVC-GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGIT 249
           + C G    G +G +YW +PGAF       + +  RF G  S  + AAF++ GTEL+ ++
Sbjct: 234 LTCGGGPEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVS 288

Query: 250 AGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT--STDSYVSASPFII 307
           A E+ NPR T+P+A K+                   VP DD +L   S+   V+ASP +I
Sbjct: 289 AAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVI 348

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367
           AIEN G   LP + NA+I+  ++S  NS +Y  SR M  ++     P   S   + G P 
Sbjct: 349 AIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPL 408

Query: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427
            A+L T +FG L+++  S   +  F WL  ++G++  F W  I++SHIRF   ++ RG S
Sbjct: 409 YAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRS 468

Query: 428 RDDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFI 480
            D+LPF +  M G+  +YYG   + +++++  +T+  P      +   F   Y+S  + +
Sbjct: 469 LDELPFVS--MTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILL 526

Query: 481 AIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPR 521
             +I  + + +  RL+    ++DID+ RRAV+  V ++ E R
Sbjct: 527 VCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEV-LKDEKR 567

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  265 bits (676), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 146/458 (31%), Positives = 249/458 (54%), Gaps = 11/458 (2%)

Query: 55  TPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGY 114
           T L   GP+   +AYLF  ++   V  SL EMA F P+   F+ +  ++V PAFG A G+
Sbjct: 61  TALARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGW 120

Query: 115 MYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
            Y+  + I  +  L+  G VI +W   + +A W+++ +     +N   V+Y+G+ E ++ 
Sbjct: 121 NYFLKYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMT 180

Query: 175 LVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSL 233
           + K+  ++   I C  + CG G     +GFRYWR  G F P ++    N  +FLGW + +
Sbjct: 181 VAKLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPYLV--KGNTGKFLGWWACV 237

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL 293
           I + F F G+E++GI  GE ANPRKT+P+A + V+                 V   + KL
Sbjct: 238 IQSIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKL 297

Query: 294 T---STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTS 350
               STD+  +ASPF+IAI  SG  VLP   NA ++  I S+  ++IY+ SR +YGL+  
Sbjct: 298 VHAHSTDA--NASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKD 355

Query: 351 RLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFI 410
             AP I  R  +H +P V  +V SL G LAYM T       F ++ +   V G   W +I
Sbjct: 356 GAAPKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYI 415

Query: 411 SLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF-CPWNGIDF 469
            +++I + + ++  G+  D++PF+  + P  AY  +FF+++I    G+++F   +N   F
Sbjct: 416 LVAYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLF 475

Query: 470 LTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDR 507
           +T+YI +F  + + + ++ +++ + + + E++  +  +
Sbjct: 476 ITSYIGIFANVLLVLGYKLYYKTKWV-KPEEITFEKKQ 512

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  267 bits (683), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/516 (31%), Positives = 264/516 (51%), Gaps = 29/516 (5%)

Query: 24  AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSL 83
           +  ++R LK RH                     L   GP   +IA++   ++ YSV Q+L
Sbjct: 86  SSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQAL 145

Query: 84  GEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 143
           GE+A  +PV+ S+  +  RF+ P+FG A  Y Y     IT  LEL      + +W     
Sbjct: 146 GELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSK 205

Query: 144 LA-AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT--GP 200
            A A++++F++++ G+N+F VK YGE EF  +++KV AI+GF+I    +VCG G +  G 
Sbjct: 206 YADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGY 265

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G RYW +PG F  G          F G+ +  + +AF+F G+E+  + A E  NPRK +
Sbjct: 266 IGARYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDL 315

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-TSTDSYVSASPFIIAIENSGTHVLPH 319
           PRA K+V                  VPY D  L  ++    SASPF+IAI  +G   LP 
Sbjct: 316 PRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPS 375

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
           + N VI+  ++S GN  +Y  SR +  L+     P       + G P V +L+ ++FG L
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           +++  S+   + F+W+L I+G+  FF W  I + H+RF +AL ++G S D+L +KA+   
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGI 495

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIAFQAWFRC-RL 494
             + YG+  + +++  Q + +  P     N   F +AY+S+ + I  +   + + R    
Sbjct: 496 WGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTF 555

Query: 495 IWRVEDVDIDTDRRAV----------EEAVWIEQEP 520
           + +  D+DIDT RR +          EE  +I  +P
Sbjct: 556 LIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSKP 591

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/529 (31%), Positives = 270/529 (51%), Gaps = 22/529 (4%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+ +    ++I+E   ++    + ++L  RH                     L   GP  
Sbjct: 67  HSYNPGSPDDIKE---DIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPAS 123

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            +I +  ++T  ++V  SLGE+A   PV   F V+  RFV P+F  +    Y   W +  
Sbjct: 124 LVIGWTIVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLL 183

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++W   +   AW++IF+ L+   N+  VK +GE EF ++LVK++AI+GF
Sbjct: 184 PLELVAASLTIRYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGF 243

Query: 185 LIYCFCMVC-GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
            I    + C G    G +G +YW  PGAF       D    +F G  S  + AAF++ G 
Sbjct: 244 FILGIVLTCGGGPKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGI 298

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY--VS 301
           E++ ++A E+ NPRKT+P A K+                   V Y+D +L +  S   V+
Sbjct: 299 EMIAVSAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVA 358

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASP +IAIEN G   LP + NA+I+  I+S  NS +Y  SR M  ++     P  LS   
Sbjct: 359 ASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVD 418

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P  A+  T  FG L+++  S   ++ F WL  ++G++  F W+ I+++HIRF QA+
Sbjct: 419 KRGRPLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAM 478

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW--NGID---FLTAYISV 476
            ++  S D++P+ ++     +YYG   + L++I   +TS  P   +G D   F   Y+S 
Sbjct: 479 TVQNRSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSF 538

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE-----EAVWIEQE 519
            + IA +I  + +F+  R++  +E++D+ T R+ V+     E + IE+E
Sbjct: 539 PILIACYIGHKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIERE 587

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  267 bits (683), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/530 (31%), Positives = 269/530 (50%), Gaps = 23/530 (4%)

Query: 8   DSKMKEEIREISVEV-----EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           D K  +E+ ++   V      +  + + L  RH                     L   GP
Sbjct: 85  DGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGP 144

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
              LIA+  ++T  +++  SLGE+A+  PV   F V+  RFV P+FG A    Y   W +
Sbjct: 145 GSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAV 204

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
              LEL+     I++W   +   AW++IF+V +   NM  VK +GE EF +++VK++AI 
Sbjct: 205 LLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIF 264

Query: 183 GFLIYCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           GF I    ++CG G  G     +YW  PGAF       D   A+F G  S  + AAF++ 
Sbjct: 265 GFAILGTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFSYS 319

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL----TSTD 297
           GTELVG++A E+ NPR T+PRA K+                   VP +D +L    +S D
Sbjct: 320 GTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVD 379

Query: 298 SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 357
             V+ASP +IAIEN G   +P + NA+I+  IIS  NS++Y  SR M  ++     P + 
Sbjct: 380 --VAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVF 437

Query: 358 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 417
           +   + G P VA+L T +FG L+++  S   +  F WL  ++G++  F W  I++SHIRF
Sbjct: 438 NYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRF 497

Query: 418 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTA 472
            +A+  +  S D+LP+ +      ++YG   +  ++++  +TS  P      +   F   
Sbjct: 498 RRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEG 557

Query: 473 YISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPR 521
           Y+S  +F+  +I+ + + R  RL      +D+D+ RRA++     EQ+ R
Sbjct: 558 YLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLR 607

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  266 bits (681), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 261/516 (50%), Gaps = 22/516 (4%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
            N+D++ ++        +    + ++L  RH                     L   GP  
Sbjct: 72  RNEDTEQED--------INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPAS 123

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            +I ++ ++T  ++V  SLGE++   PV   F V+S RF+ P+F  A    Y   W +  
Sbjct: 124 LVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLL 183

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++W   +   AW++IF+  +   NM  VK +GE EF ++++K+++I+GF
Sbjct: 184 PLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGF 243

Query: 185 LIYCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
            I    + CG G  G     +YW  PGAF         +  +F G  S  + AAF++ G 
Sbjct: 244 TILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGI 298

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA- 302
           E+  ++A E+ NPR+T+P+A K+                   VP +D +L +  S V A 
Sbjct: 299 EMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAA 358

Query: 303 -SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
            SP +IAIEN G   LP + NA+I+  ++S  NS +Y  SR M  ++     P  L+R  
Sbjct: 359 SSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVD 418

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P  A+L+T  FG L+++  S    + F WL  ++G++  F W+ I+LSHIRF QA+
Sbjct: 419 KRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAM 478

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI-----DFLTAYISV 476
           +++  S D+LPF ++     ++YG   + L++I   +TS  P  G       F   Y+S 
Sbjct: 479 KVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSF 538

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE 511
            + I  ++  + + R   L+ ++ED+D+DT R+ V+
Sbjct: 539 PILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  266 bits (681), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 159/528 (30%), Positives = 270/528 (51%), Gaps = 21/528 (3%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           ++ S+  +++ +  V++    + ++L  RH                   T L   GP   
Sbjct: 67  SERSRDNDDVEQ--VDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASL 124

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           +I ++ + T  ++V  SLGE++   PV   F V+  RFV P+F  A    Y   W +   
Sbjct: 125 VIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLP 184

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++W   +   AW++IF+  +   NM  VK +GE EF ++++K+++I+GF 
Sbjct: 185 LELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFS 244

Query: 186 IYCFCMVC-GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + C G    G +G +YWR+PGAF         +  +F G  S  + AAF++ G E
Sbjct: 245 ILGIVLSCGGGPHGGYIGGKYWRNPGAF-----VGHNSGTKFKGLCSVFVTAAFSYSGIE 299

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA-- 302
           +  ++A E+ NPR+T+P+A K+                   VP +D +L +  S V A  
Sbjct: 300 MTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAAS 359

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP +IAIEN     LP + NA+I+  ++S  NS +Y  SR M  ++     P  L+R  +
Sbjct: 360 SPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDK 419

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G P  A+L+T  FG L+++  S    + F WL  ++G++  F W+ I+LSHIRF +A++
Sbjct: 420 RGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMK 479

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVF 477
           ++  S D+LPF ++     ++YG   + L++I   +TS  P      +   F   Y+S  
Sbjct: 480 VQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFP 539

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE-----EAVWIEQE 519
           + I  +   + + R   L+ ++ED+D+DT R+ V+     E + IE+E
Sbjct: 540 ILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERE 587

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  267 bits (682), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 181/532 (34%), Positives = 274/532 (51%), Gaps = 26/532 (4%)

Query: 7   QDSKMKEEIREISVEV-EAETV---------RRELKQRHXXXXXXXXXXXXXXXXXVSTP 56
           +DS  K E  E+   + EAE +         +  LK R                   ST 
Sbjct: 73  KDSFKKAEDVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTA 132

Query: 57  LMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMY 116
           L   GP G +I +   +T+ YS+  +LGE+A   PV   FT ++ RFV  +FG AN + Y
Sbjct: 133 LRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNY 192

Query: 117 WFSWCITFALELSVVGQVIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
              W +   LE+      + +W T       ++++FW+++  +NMF VK +GE EF  ++
Sbjct: 193 ALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSI 252

Query: 176 VKVVAIMGFLIYCFCMVCGAGVTGPVGF-RYWRHPGAF-GPGIIAKDKNQARFLGWVSSL 233
           +KV  ++GF+I    +VCG G  G     +YW  PGAF G G      + A+F G  S  
Sbjct: 253 IKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHG------SGAQFKGVCSVF 306

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL 293
           + AAF+F G+EL+GITA EAANPRK++P A K+VV                 VPY+D +L
Sbjct: 307 VTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRL 366

Query: 294 TSTDSY-VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352
               S   +ASPF+IAI   G   LP + N VI+  ++S GNS I+  SR +  LS    
Sbjct: 367 IGASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGF 426

Query: 353 APGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISL 412
            P +     + G P V + +TS FG LA++  S    + FNWLL ++G++  FTW  I L
Sbjct: 427 LPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICL 486

Query: 413 SHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID---- 468
            HIRF  AL+ +G   ++L F +      +Y+G+F + L+ I Q + +  P  G      
Sbjct: 487 CHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEV 546

Query: 469 FLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           F  +Y+S  + +A +   + + R  +L   +ED+DIDT RR  +  + ++QE
Sbjct: 547 FFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMEL-LKQE 597

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  266 bits (680), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 164/554 (29%), Positives = 278/554 (50%), Gaps = 38/554 (6%)

Query: 8   DSKMKEEIREISVEVEA------------ETVRRELKQRHXXXXXXXXXXXXXXXXXVST 55
           DSK KE   E ++E               E + ++L  RH                    
Sbjct: 61  DSKTKEGGSEKNIETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGA 120

Query: 56  PLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYM 115
            L + GP   +I ++ ++T  ++V  +LGE+A   PV   F V+  RFV P+   A    
Sbjct: 121 ALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLN 180

Query: 116 YWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
           Y   W +   LEL      I++W   +   AW++IF+ ++   NM  VK +GE EF +++
Sbjct: 181 YLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSM 240

Query: 176 VKVVAIMGFLIYCFCMVC-GAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLI 234
           VK++AI+GF I    + C G    G +G  YW  PG+F       DK   +F G  S  +
Sbjct: 241 VKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFV 295

Query: 235 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT 294
            AAF++ G EL  ++A E+ +PRKT+P+A K+                   VP+DD +L 
Sbjct: 296 TAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLL 355

Query: 295 STDSYV--SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352
           +  S V  +ASP +I+I+N+G   L  + NA+I+ +I+S  NS +Y  SR M  ++    
Sbjct: 356 NGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGN 415

Query: 353 APGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISL 412
            P +LSR  + G P  A+L T  FG L+++  S    + F WL  ++G++  F W+ I+ 
Sbjct: 416 LPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINY 475

Query: 413 SHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNG-----I 467
           SHIRF  A++++  + D+LP+ ++     ++YGV  + L+++   +TS  P         
Sbjct: 476 SHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVT 535

Query: 468 DFLTAYISVFMFIAIWIAFQAWFR-CRLIWRVEDVDIDTDRRAVE----------EAVWI 516
            F   Y+S+ + IA ++  + + R  +++ ++ED+D++T R+ ++          E   +
Sbjct: 536 SFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAAL 595

Query: 517 EQEPRGFWDKFWNV 530
            Q  + F  +FW+V
Sbjct: 596 SQ--KSFIKRFWHV 607

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  267 bits (683), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 163/527 (30%), Positives = 267/527 (50%), Gaps = 28/527 (5%)

Query: 24  AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSL 83
           A  + ++L  RH                   + L   GP   +I ++ ++T  ++V  SL
Sbjct: 138 ATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSL 197

Query: 84  GEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 143
           GE+A   PV   F+V+  +FV P+F  A    Y   W +   LEL      I++W  ++ 
Sbjct: 198 GELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSIN 257

Query: 144 LAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-VG 202
             AW+SIF+V +   NM  VK +GE EF ++LVK++AI+GF I    + CG G +   +G
Sbjct: 258 SDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIG 317

Query: 203 FRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 262
            +YW  PGAF         + ++F G  S  + AAF+F G E+  ++A E+ NPR+T+P+
Sbjct: 318 GKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPK 372

Query: 263 AIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA--SPFIIAIENSGTHVLPHI 320
           A K+                   VPY+D +L +  S V A  SP +IAIEN   H LP +
Sbjct: 373 AAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSL 432

Query: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380
            NA+I+  I+S  NS++Y  SR M  +S     P + ++  + G P  A+     FG L+
Sbjct: 433 MNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLS 492

Query: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440
           ++  S    + F WL  ++G++  F W+ I+L HIRF Q + ++ IS D+LPF ++    
Sbjct: 493 FVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIW 552

Query: 441 LAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLI 495
            + YG+  + L+++   +TS  P      N   F   Y+S  + +  +IA + +F+    
Sbjct: 553 GSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKN--- 609

Query: 496 WR----VEDVDIDTDRRAVE-----EAVWIEQE---PRGFWDKFWNV 530
           WR       +D+ + R+ V+     E + +E+E    R F+ +F +V
Sbjct: 610 WRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQRSFFYRFLHV 656

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  266 bits (680), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 158/514 (30%), Positives = 262/514 (50%), Gaps = 14/514 (2%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           +D K   E      ++    + ++L  RH                     L   GP   +
Sbjct: 68  RDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLV 127

Query: 67  IAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
           I ++ ++T  ++V  SLGE+A   PV   F V+  RF+ P+F  A    Y   W +   L
Sbjct: 128 IGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPL 187

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           EL      I++W   +   AW++IF+  +   NM  VK +GE EF +++VK++AI+GF I
Sbjct: 188 ELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGI 247

Query: 187 YCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
               + CG G  G     +YW +PGAF           ++F G  S  + AAF++ G E+
Sbjct: 248 LGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEM 302

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV--SAS 303
             ++A E+ NP++T+P+A K+                   VPY+D +L +  S V  +AS
Sbjct: 303 TAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS 362

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P +IAIEN G   LP + NA+I+  I+S  NS +Y  SR M  ++     P  LS+  + 
Sbjct: 363 PLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKR 422

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P  A+L+T  FG L+++  S   ++ F WL  ++G++  F W+ I+LS IRF  A++ 
Sbjct: 423 GRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKA 482

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFM 478
           +G S D++PF ++     A+YGV  + L+++   +TS  P      +   F   Y+S+ +
Sbjct: 483 QGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPI 542

Query: 479 FIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE 511
            IA ++  + W R  RL+  + ++D+D+ RR ++
Sbjct: 543 LIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD 576

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  266 bits (679), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 170/527 (32%), Positives = 271/527 (51%), Gaps = 22/527 (4%)

Query: 19  SVEVEAETVRR---ELKQ----RHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
            VE  AE  R+   +LKQ    RH                     L N GP G +I Y  
Sbjct: 75  DVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAI 134

Query: 72  MATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 130
           M +  Y + Q+ GE+A ++  ++ +F  +    +  AFG +  ++Y   W     LEL  
Sbjct: 135 MGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVT 194

Query: 131 VGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC 190
               I++WT +V    +++IF+VL+  +NMF  + Y E EF+    KV+ I+GF I    
Sbjct: 195 ASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGII 254

Query: 191 MVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGIT 249
           + CG AG  G +G RYW +PGAF        K    F G +S+++ AAF F  TE + +T
Sbjct: 255 VNCGGAGNDGYIGGRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAFGATEFIALT 309

Query: 250 AGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIA 308
           A E ANPR+ +P A KKVV                 VP++  +L  S  S   ASP++IA
Sbjct: 310 AAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIA 369

Query: 309 IENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWV 368
           + + G  V+PH  NAVI+ +++S GNS  Y  SR++  L+    AP  L    + G P  
Sbjct: 370 VASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMR 429

Query: 369 AVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISR 428
           A+LV+ +FG ++++  S   +  F WLL I+G++  FTW+ I +SHIRF +AL ++G   
Sbjct: 430 AMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPI 489

Query: 429 DDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTAYISVFMFIAIW 483
            +L +K++     +YY  F M  I+I Q + +  P      +   F   Y+++ +F+ ++
Sbjct: 490 GELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLY 549

Query: 484 IAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
             F+ W R  RL   +E +D+D+ R+  +E + ++QE   + +   N
Sbjct: 550 FGFKIWKRDWRLYIPLEQIDLDSHRKTFDEEL-LKQEDAEYEENIRN 595

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  264 bits (674), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 165/516 (31%), Positives = 267/516 (51%), Gaps = 15/516 (2%)

Query: 6   NQDSKMKEEIREI----SVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
           N D++   E+ E+    ++   ++T++R  KQRH                   T L   G
Sbjct: 21  NSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGG 80

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
           P   LIA++F  +L   V  SL EMA+F P+  SF+ ++ R+V PA G A G+ Y+  + 
Sbjct: 81  PGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYA 140

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
           I  A ELS +G ++Q+W   + +A +I +F V+L  +N   +K+YGE EFW AL+K + +
Sbjct: 141 IALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVL 200

Query: 182 MGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           +   +    + CG G +   +GFRYWR   AF P ++       RFLGW + +I + + +
Sbjct: 201 IICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPYLV--KGTTGRFLGWWACVIQSCYAY 257

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXV-PYDDWKLTSTDSY 299
            G+E +G+  GEA NP+KT+P A + V+                 + P+D     +  S 
Sbjct: 258 IGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSD 317

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
            S SPF+IA  N+G   LP   NA+++  I SA N+ +YV SR  YGL+   +AP I   
Sbjct: 318 ASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLA 377

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             ++GVP+   L+  L   L++M  S      F +L +   V G   WL + +S+I + +
Sbjct: 378 QNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYER 437

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFM 478
           A     + RD +PF+  + P  AY  +FF++LII   G+++F   +    F+ +YI + +
Sbjct: 438 ARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAV 497

Query: 479 FIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAV 514
           FI   + ++ W +     R ED+        VEEA+
Sbjct: 498 FIGNTLFWKFWKKSAAT-RPEDL----RSIMVEEAI 528

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  266 bits (680), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 271/538 (50%), Gaps = 22/538 (4%)

Query: 13  EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
           E+   +  + E   +++ L+ RH                  S+ L   GP G  I+Y+ +
Sbjct: 96  EKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIII 155

Query: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQ-----RFVSPAFGAANGYMYWFSWCITFALE 127
           + + Y +  +LGEM  F+P   S +  S      R+V  + G A G+ Y++ + I  A E
Sbjct: 156 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAE 215

Query: 128 LSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
            +    V+++WT AVP   WI+IF  ++  +N+  VK YGE EFW A +K++ I+G +I 
Sbjct: 216 CTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIIL 275

Query: 188 CFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTEL 245
            F +  G G     +GFRYW+HPGAF   +     +   F    + +I  AF F  G EL
Sbjct: 276 SFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPEL 333

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY----VS 301
           V +T+ E A+ R+ + +A ++ V                 VPY+D  L +  +       
Sbjct: 334 VCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAG 393

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           +SPF+I I+N+G  VLPHI N  I+++  SA N+ ++  +R +  ++ +  AP  L R  
Sbjct: 394 SSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRIN 453

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + GVP+VAV V+ L   LAY+  S+     FNW  NI+ ++GF  W+   ++++RF +A+
Sbjct: 454 RWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAI 513

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMF 479
              G+  D LPFK    P   +  +  + +I +  G+  F P  W   DF+ AYI++ +F
Sbjct: 514 FYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIF 572

Query: 480 IAIWIAFQAWFRCRLIW--RVEDVDIDTDRRAVEEAVWIEQE----PRGFWDKFWNVV 531
           + +W   + + R    W   V ++D+ T    +EE     +E    P  F DKF + +
Sbjct: 573 LVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMDAL 630

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  265 bits (676), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 168/537 (31%), Positives = 265/537 (49%), Gaps = 23/537 (4%)

Query: 3   GGHNQDSKMKEEIREISVEVEAET----VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLM 58
           G      ++ E   ++  +V + T    +++ +K RH                  +  L 
Sbjct: 63  GSTTHTKQINENTSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLH 122

Query: 59  NAGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYW 117
             GP   +I Y  ++ + Y + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y 
Sbjct: 123 YGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYC 182

Query: 118 FSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVK 177
           F W     LEL      I+FW   +    +I IF+V L  ++ F VK YGE EF     K
Sbjct: 183 FQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCK 242

Query: 178 VVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236
           ++ I GF+I    + CG AG  G +G +YWR+PGAF     A D +  RF      L+ A
Sbjct: 243 ILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTA 297

Query: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST 296
            F+F G EL  ++  E ANPRKT P A K+ +                 VPY+D +L   
Sbjct: 298 YFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGA 357

Query: 297 D-SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPG 355
             S   ASP+++A    G  V+PHI NAVI+ ++IS  NS++Y G R+M  L+     P 
Sbjct: 358 GGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPK 417

Query: 356 ILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHI 415
            L    + G P +A++V S+FG + ++  S+  +  F WL  I G++  FTW  I LSH+
Sbjct: 418 FLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHL 477

Query: 416 RFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNG------IDF 469
           RF QA++++G S D+L +KA      + YGVFF  L+ I Q + +  P N         F
Sbjct: 478 RFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESF 537

Query: 470 LTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVW----IEQEPR 521
             +Y++  ++IA ++ +  + R    +  ++ +D+D  R   +  +     +E E R
Sbjct: 538 FQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEER 594

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  264 bits (675), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/526 (29%), Positives = 273/526 (51%), Gaps = 20/526 (3%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           ++    +++ LK RH                  S+ L   GP G  I+Y  ++++ Y + 
Sbjct: 69  DMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIM 128

Query: 81  QSLGEMATFIPVTSS----FTVF-SQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVI 135
           Q +GEM  ++P + S    F  +   ++V  + G A+ + Y++ + I  A E +    V+
Sbjct: 129 QGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVV 188

Query: 136 QFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA 195
           ++WT +VP AAWI+IF   +  +N   VK+YGE EFW A +K++ I+G +I  F +  G 
Sbjct: 189 EYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGG 248

Query: 196 GVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTELVGITAGEA 253
           G     +GFRYW++PG F   I  +  +   FL   + +I   F F  G E++ +T+ E 
Sbjct: 249 GPNHDRLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEV 306

Query: 254 ANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTS----TDSYVSASPFIIAI 309
            + R+ + +A ++ V                 V Y+D  L +          +SPF+I I
Sbjct: 307 EDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGI 366

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
           +N+G  VLPHI NA I+++  SAGN+ ++  SR +  ++ +  AP I ++  + GVP+ A
Sbjct: 367 QNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYA 426

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
           V ++S    LAY+  S+     FNW  NI+ ++GF  W+ + +++IRF +A+   G+ + 
Sbjct: 427 VGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QS 485

Query: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQ 487
            LP+ A+ MP L Y+ +  +++I +  G+  F P  W+  +F+ AYI++ +F  +WI  +
Sbjct: 486 RLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHR 545

Query: 488 AWFRC--RLIW--RVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            + R    L W   +E++D+ T    +EE        R    K+W 
Sbjct: 546 VYRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWE 591

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  265 bits (676), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 262/526 (49%), Gaps = 21/526 (3%)

Query: 3   GGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           G  N    +++  +        E +++ ++ RH                     L N GP
Sbjct: 72  GRENDQESLQDNNKH-------EKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGP 124

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSS-FTVFSQRFVSPAFGAANGYMYWFSWC 121
            G  + +  M T  Y V Q+ GEMA   P  S  F  +    V P FG A  ++Y   W 
Sbjct: 125 GGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWL 184

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
             F LEL      I++WT A+    ++++F++L+  +N F  + Y E EF+    KV+ I
Sbjct: 185 CVFPLELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMI 244

Query: 182 MGFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           +GF I    +  GA G  G +G +YWR PG+FG G  A D     F G VS+L+NAAF+ 
Sbjct: 245 IGFFIVGILVNTGAAGNDGYIGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSL 299

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSY 299
             +E V +TA E ANPRK+VP A KK++                 VP +  +L  STDS 
Sbjct: 300 GCSEFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSS 359

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
           V  SP++IA+ + G  V+PH  NAVI+ +++S GNS  Y  SR++  L+    AP +   
Sbjct: 360 VHVSPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKY 419

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             + G P +A++V+   G L ++  S   +  F WLL I+G++  FTW  I +SHIRF +
Sbjct: 420 IDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRK 479

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTAYI 474
           AL ++G   D L FKA+     +YY    M L  I Q +T   P      N   F   Y+
Sbjct: 480 ALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYL 539

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           +  +F+A++  ++ + +  +L    E +D+D  R+  +  V  +++
Sbjct: 540 AFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQED 585

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  265 bits (676), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 160/516 (31%), Positives = 269/516 (52%), Gaps = 15/516 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           ++ ++++ ++ RH                   T L++AGP G LI Y  M ++ Y + Q+
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 83  LGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GE+A  +  +T  +  +    V   FG A  ++Y   W     LEL      I++WT +
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAGVTGP 200
           V    ++ IF+VL+  +N+F  + Y E EF+    K++ + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YW  PGAF  G  + D    RF G V++L+ AAF F G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
           P A K+++                 VPY+ D  L S      ASP++IAI + G  V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPH 406

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S  NS+ Y  +R+   LS    AP   S   + G P +A+ V++LF  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           A+   S   ++ F WLL I+G++  FTW  I  SHIRF +A++++G S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC-R 493
             + Y    M LI+I Q + +  P      +   F   Y+++ + IA+++ ++ W +  +
Sbjct: 527 WGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWK 586

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           L  R + +D+++ R+  +E + I+QE   + ++  N
Sbjct: 587 LFIRADKIDLESHRQIFDEEL-IKQEDEEYRERLRN 621

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  265 bits (677), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 166/550 (30%), Positives = 277/550 (50%), Gaps = 27/550 (4%)

Query: 6   NQDSKMKEEIR-EISVEVEAETVRRELKQ----RHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           + +  ++EE+  E S   + +     LKQ    RH                  S+ L   
Sbjct: 136 SSNGTVREELDLEKSPSADGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTC 195

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQ-----RFVSPAFGAANGYM 115
           GP G  I+Y+ ++ + Y +  +LGEM  F+P   S +  S      R+V  + G A G+ 
Sbjct: 196 GPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWN 255

Query: 116 YWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
           Y++ + I  A E +    V+++WT AVP   WI+IF  ++  +N   VK YGE EFW A 
Sbjct: 256 YYYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFAS 315

Query: 176 VKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLI 234
           +K++ I+G +I  F +  G G     +GFRYW+HPG+F   +     +   F    + +I
Sbjct: 316 IKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHHLAGG--SLGNFTDIYTGII 373

Query: 235 NAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL 293
             AF F  G ELV +T+ E A+ R+ + +A ++ V                 VPY+D  L
Sbjct: 374 KGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSL 433

Query: 294 TSTDSY----VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLST 349
            +  +       +SP++I I+N+G  VLPHI N  I+ +  SA N+ ++  +R +  ++ 
Sbjct: 434 VNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQ 493

Query: 350 SRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLF 409
           +  AP  L +  + GVP+VAV V+ L   LAY+  S+     FNW  NI+ ++GF  W+ 
Sbjct: 494 TGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWIC 553

Query: 410 ISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGI 467
             ++++RF +A+   G+  D LPFK    P   ++ +  +++I I  G+  F P  WN  
Sbjct: 554 GCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVA 612

Query: 468 DFLTAYISVFMFIAIWIAFQAWFRCRLIW--RVEDVDIDTDRRAVEEAVWIEQE----PR 521
           DF+ AYI++ +F+ +W+  + + R    W   V ++D+ T    +EE     +E    P 
Sbjct: 613 DFIAAYITLPIFLVLWLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPA 672

Query: 522 GFWDKFWNVV 531
            F +KF + +
Sbjct: 673 TFKEKFMDAL 682

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/516 (31%), Positives = 263/516 (50%), Gaps = 15/516 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           ++E +++ +K RH                     L  AGP   +I Y  M T  Y + Q+
Sbjct: 116 KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQA 175

Query: 83  LGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GE+A  +  +   F  +    V PA G +  ++Y   W     LEL      I++WT  
Sbjct: 176 AGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK 235

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200
           V    ++ IF+VL+  +N F  + Y E EF+    KV+ + GF I    +  G AG  G 
Sbjct: 236 VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGY 295

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YW  PGAF       DK+  RF G + + + AAF F  TE + +TA E +NPRK +
Sbjct: 296 LGAKYWHDPGAFN-----GDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAI 350

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
           P A KKV+                 VPY+ D  L S  S + ASP++IA+ + G  V+PH
Sbjct: 351 PSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPH 410

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S GNS  Y  SR++  L+    AP       + G P+ A+L+++LFG +
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           A+  TS    + F+WLL I+G++  FTW+ I +SHIRF +A++++G S  ++ + ++   
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC-R 493
             + Y    + L +I Q + +  P      +  +F   Y+++ + IA +  ++ W R  +
Sbjct: 531 YGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWK 590

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           L  R +D+D+DT R+  +E + + QE   + +K  N
Sbjct: 591 LFIRAKDIDLDTHRQIFDENI-LRQEDEEYKEKLRN 625

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 168/521 (32%), Positives = 268/521 (51%), Gaps = 22/521 (4%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           + ++L  RH                     L + GP   +I ++ ++T  ++V  SLGE+
Sbjct: 96  MNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGEL 155

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
           A   PV   F V+  RF+ P+FG A    Y   W +   LEL      I++W   +   A
Sbjct: 156 AAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSDA 215

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGF-RY 205
           W++IF+  +   NM  VK +GE EF ++++K++AI+GF I    + CG G  G     +Y
Sbjct: 216 WVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKY 275

Query: 206 WRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 265
           W  PGAF       + +  +F G  S  + AAF++ G EL  ++A E+ NPR+T+P+A K
Sbjct: 276 WHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAK 330

Query: 266 KVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA--SPFIIAIENSGTHVLPHIFNA 323
           +                   VPY++ KL +  S V A  SP +IAIEN G   LP + NA
Sbjct: 331 RTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNA 390

Query: 324 VIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYME 383
           +I+  I+S  NS +Y  SR M  ++  R  P  L R  + G P  A L+T  FG L+++ 
Sbjct: 391 IILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIA 450

Query: 384 TSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAY 443
            S   ++ F WL  ++G++  F W+ I+LSHIRF QA+  +GIS D+LP+ +      ++
Sbjct: 451 ASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSW 510

Query: 444 YGVFFMTLIIIIQGFTSFCPWNG-----IDFLTAYISVFMFIAIWIAFQAWFR-CRLIWR 497
           YGV  + L+++   +TS  P  G       F   Y+S  + I  ++  + + R  RL+  
Sbjct: 511 YGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLID 570

Query: 498 VEDVDIDTDRRAVE-----EAVWIEQE---PRGFWDKFWNV 530
           V D+D+ +DR+ V+     E + IE+E    R F+ +F ++
Sbjct: 571 VADMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLHL 611

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  264 bits (674), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 167/538 (31%), Positives = 257/538 (47%), Gaps = 18/538 (3%)

Query: 1   MLGGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           ++G   QD ++    ++     E   +R+ +K RH                  + PL  A
Sbjct: 136 LIGTTIQDEELLPGQKKEDSNAE---LRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAA 192

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFS 119
           GP   +I Y  M T  Y + Q+ GEMA  +  +T SF  F    V P F  A  ++Y   
Sbjct: 193 GPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQ 252

Query: 120 WCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVV 179
           W     LEL      IQ+WT  V    ++ IF+VL+  +N F  K Y E EF     KV+
Sbjct: 253 WLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVL 312

Query: 180 AIMGFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAF 238
            I GF I   C+  GA G  G +G +YW  PGAF            RF G + + + AAF
Sbjct: 313 MICGFFILAICIDTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAF 367

Query: 239 TFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTD 297
            F  TE + +TA E +NPRK +P A KK++                 VPYD D  L S  
Sbjct: 368 AFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGG 427

Query: 298 SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 357
           S   ASP+++AI   G  V  H  NAVI+ ++IS GNS  Y  SR++  L+    AP I 
Sbjct: 428 SATKASPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIF 487

Query: 358 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 417
               + G P +A+  +++   +A+  TS    + F WL+ I G++  FTW  I LSH+RF
Sbjct: 488 DYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRF 547

Query: 418 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTA 472
            +A++++G S  ++ + ++     + Y    M L +I Q + +  P      +   F + 
Sbjct: 548 RRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSN 607

Query: 473 YISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           Y+++ + I  +  ++ W R  RL  R +D+D+ + R   +E + + QE   + +K  N
Sbjct: 608 YLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYDEEL-LRQEDEEYREKLRN 664

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 165/542 (30%), Positives = 269/542 (49%), Gaps = 20/542 (3%)

Query: 3   GGHNQDSKMKEEIREISVEVEAET----VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLM 58
           G   +  ++ E   ++   VE+ T    +++ +K RH                  +  L 
Sbjct: 63  GSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLH 122

Query: 59  NAGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYW 117
             GP   +I Y+ ++ + Y + Q+ GEMA   P + ++F  +S  F+S +FG A  ++Y 
Sbjct: 123 YGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYC 182

Query: 118 FSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVK 177
           F W     LEL      IQFW   +    +I IF+V L  ++ F VK YGE EF     K
Sbjct: 183 FQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCK 242

Query: 178 VVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236
           ++ I GF+I    + CG AG  G +G  YW +PGAF     A D +  RF      L+ A
Sbjct: 243 ILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTA 297

Query: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST 296
            F+F G EL  ++  E +NPRK+ P A K+ +                 VPY+D +L   
Sbjct: 298 YFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA 357

Query: 297 D-SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPG 355
             S   ASP+++A    G  ++PHI NAVI+ +++S  NS++Y G R++  L+    AP 
Sbjct: 358 GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPK 417

Query: 356 ILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHI 415
            L    + G P  A++V  +FG +A++  S+  +  F WL  I G++  FTW  I LSH+
Sbjct: 418 FLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHL 477

Query: 416 RFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW------NGIDF 469
           RF QA++++G S D+L +KA      + YGVFF  L+ + Q + +  P       +   F
Sbjct: 478 RFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESF 537

Query: 470 LTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFW 528
              Y++  +++A +  +  + R   L+  ++ +D+D  RR + +   + QE     +K  
Sbjct: 538 FQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRR-IYDPELMRQEDEENKEKLR 596

Query: 529 NV 530
           N+
Sbjct: 597 NM 598

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  261 bits (668), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 170/542 (31%), Positives = 274/542 (50%), Gaps = 30/542 (5%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           +Q S  KE+I +        ++ ++L  RH                     L + GP   
Sbjct: 65  SQSSVTKEDINK--------SLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASL 116

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           +I ++ ++T  ++V  SLGE+A   PV   F V+  RFV P+F  A    Y   W +   
Sbjct: 117 VIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLP 176

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++W   +   AW++IF+ ++T  NM  VK +GE EF +++VK++AI+GF 
Sbjct: 177 LELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFT 236

Query: 186 IYCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG G  G     +YW +PGAF         +  +F G  S  + AAF++ G E
Sbjct: 237 ILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIE 291

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV--SA 302
           +  ++A E+ +PRKT+P+A K+                   VPYDD +L S  S V  +A
Sbjct: 292 MTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAA 351

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP +IAIEN G   L  + NA+I+ +IIS  NS +Y  SR M  ++     P  L +  +
Sbjct: 352 SPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDK 411

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G P  A LVT  FG L+++  S    + F WL  ++G++  F W+ I++SHIRF QA+ 
Sbjct: 412 RGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMI 471

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI-----DFLTAYISVF 477
            +  S D++P+ ++     + YGV  + L+++   +TS  P  G       F   Y+S+ 
Sbjct: 472 KQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLP 531

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE----EAVWIEQE----PRGFWDKFW 528
           + I  +I  + +F+    +  +E++D+DT R+A++     A  I +E       F  +FW
Sbjct: 532 ILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFW 591

Query: 529 NV 530
           +V
Sbjct: 592 HV 593

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 263/530 (49%), Gaps = 25/530 (4%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           +I   + E  +  ++  L+ RH                  S+ L N GP   +I+Y+ ++
Sbjct: 43  DIESGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVIS 102

Query: 74  TLAYSVTQSLGEMATFIPVTSS-------FTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
           T+ Y +    GEM  ++P                 ++V  + G A  + Y++ + +  A 
Sbjct: 103 TIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVAT 162

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           E +    ++++WT  +P A  I +F  ++  +N  PVK+YGE EFW A++K+  I G +I
Sbjct: 163 ECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLII 222

Query: 187 YCFCMVCGAGVTGP----VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-Q 241
             F + CG          VGF YW++P +F   +   + +   FL   ++LI  AF F  
Sbjct: 223 VAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYV--TNGSLGNFLDVYNALIKGAFAFIL 280

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTS----TD 297
           G ELV +T+ E  + R+ + +A ++ V                 VPY+D  L +      
Sbjct: 281 GPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNK 340

Query: 298 SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 357
               +SPF+I I+N+G  +LPHI N  I+ + +SAGN+ ++  +R +  +  +  AP I 
Sbjct: 341 PGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIF 400

Query: 358 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 417
           SR  +HGVP+VA+ ++ +   LA++  S    K F W  NI+ ++GF  W    ++++RF
Sbjct: 401 SRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRF 460

Query: 418 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYIS 475
            + ++  G+  D LPFK K    L +Y   F+ ++I+  G+    P  WN  DF+ AYI+
Sbjct: 461 RRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYIT 519

Query: 476 VFMFIAIW---IAFQAWFRCRLIWR-VEDVDIDTDRRAVEEAVWIEQEPR 521
           + +F+ ++   I +   +R R  W+ V+++D+ T    +E    I  E R
Sbjct: 520 LPVFLVLYFGHIIYSGRWRQRKWWKPVDEIDVVTGLEEIELKTKIADEER 569

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  261 bits (666), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/526 (30%), Positives = 268/526 (50%), Gaps = 24/526 (4%)

Query: 2   LGGHNQDSKMK---------EEIREISVEVE-AETVRRELKQRHXXXXXXXXXXXXXXXX 51
           LG  ++DS  K         + +   +V  E  E + ++L  RH                
Sbjct: 43  LGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGLFV 102

Query: 52  XVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAA 111
              T L   GP   +I ++ +++  ++V  +LGE+A   P+   F V+  RFV P+F  A
Sbjct: 103 NSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFA 162

Query: 112 NGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEF 171
               Y   W ++  LEL      I++W   +   AW++IF+V +  +NM  VK++ E EF
Sbjct: 163 VNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAEF 222

Query: 172 WVALVKVVAIMGFLIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWV 230
            ++++K++AI+GF I    + V G    G +G +YW  PGAF       D   +RF G  
Sbjct: 223 VMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFKGLC 277

Query: 231 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD 290
           S  + AAF++ G E+  ++A E+ NPRKT+P+A K+                   VPY+D
Sbjct: 278 SVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYND 337

Query: 291 WKLTSTDSYV--SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLS 348
            +L S  S V  SASP +IAIEN+G   LP + NA+I+  ++S  NS +YV SR+M  ++
Sbjct: 338 KRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSMA 397

Query: 349 TSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWL 408
            +   P + S+  + G P  ++  T   G L+++  S   ++ F WL  I G++  F W+
Sbjct: 398 LTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCWI 457

Query: 409 FISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP----- 463
            I+L+HIRF  AL+ +  S D+L + ++     ++YGV  + L++I   + S  P     
Sbjct: 458 GINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVGESS 517

Query: 464 WNGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRR 508
            +   F   Y+S  + IA +I  + + +  + +  +E++DID  ++
Sbjct: 518 ADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDIDLGKK 563

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 173/523 (33%), Positives = 273/523 (52%), Gaps = 23/523 (4%)

Query: 7   QDSKMKEEIREISVEV-EAETV---------RRELKQRHXXXXXXXXXXXXXXXXXVSTP 56
           +DS  + E  E+   + EAE V         + +LK RH                     
Sbjct: 55  RDSFKRVEPVEVDPNLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKA 114

Query: 57  LMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMY 116
           L   GP   LI +  M T+ Y++  +LGE+A   P++  FT ++ RF+  +FG A  + Y
Sbjct: 115 LRTGGPASLLIGWGSMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNY 174

Query: 117 WFSWCITFALELSVVGQVIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175
              W +T  LE+      + +W T       ++++FW+++  +NMF VK YGE EF  ++
Sbjct: 175 MLQWLVTLPLEIVSASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSI 234

Query: 176 VKVVAIMGFLIYCFCMVCGAG-VTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLI 234
           +KV+ I+GF+I    + CG G   G +G +Y+  PGAF     A D   A+F G  S  +
Sbjct: 235 IKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFV 289

Query: 235 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT 294
            AAF+F G+ELVG+ A E+ +PRK+VP+A K+V                  VPY+D +L 
Sbjct: 290 TAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLI 349

Query: 295 STDSY-VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLA 353
              S   +ASPF+IAI   G   LP + N VI+  ++S GNS I+  SR    L+     
Sbjct: 350 GASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFL 409

Query: 354 PGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLS 413
           P I +   + G P V +++TS  G +A++  S   +  FNWLL ++G++  FTW  I + 
Sbjct: 410 PQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICIC 469

Query: 414 HIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI----DF 469
           HIRF +AL  +G S D+L FK+      +Y+G+F + ++ I Q + +  P NG      F
Sbjct: 470 HIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGF 529

Query: 470 LTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVE 511
             AY+S  + +A++I  + + R  +L+    ++DID+ RR V+
Sbjct: 530 FEAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVD 572

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  259 bits (663), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 162/485 (33%), Positives = 248/485 (51%), Gaps = 12/485 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E  ++++      ++  LK RH                   T L   GP   LI +    
Sbjct: 73  EAEKVAIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTG 132

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ Y++  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE+     
Sbjct: 133 TMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASI 192

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + FW T       ++++FWV++  +NMF VK YGE EF  + +KV+ ++GF+I    + 
Sbjct: 193 TVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILN 252

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     +YW  PGAF     A D   A+F G  S  + +AF+F G+ELVG+ A 
Sbjct: 253 CGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAAS 307

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E+  PRK+VP+A K+V                  VPY+D  L    S   +ASPF+IAI+
Sbjct: 308 ESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIK 367

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G   LP + N VI+  ++S GNS IY  SR M  L+  R  P I +   + G P V +
Sbjct: 368 THGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGI 427

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
            VTS FG +A++  S      FNWLL ++G++  FTW  I + HIRF +AL  +G   D+
Sbjct: 428 GVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDE 487

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI----DFLTAYISVFMFIAIWIAF 486
           L FK+      +Y+G+F + ++ I Q + +  P  G      F  AY+S  + +A++I  
Sbjct: 488 LSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGH 547

Query: 487 QAWFR 491
           + + R
Sbjct: 548 KIYKR 552

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  261 bits (667), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 160/495 (32%), Positives = 256/495 (51%), Gaps = 15/495 (3%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           ++E ++  +K RH                   T L N+GP G +I Y  M +  Y + Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 83  LGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GEMA  +  +   F  +    + PA G +  ++Y   W     LEL      I++WT  
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 142 VPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTG 199
           V    ++ IF+VL+  +N+      Y E EF+    K++ ++GF I    ++CG AG  G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 200 PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
            +G RYW  PGAF  G  A D    RF G VS+L+NAAF F  +E++G+TA E +NPRK 
Sbjct: 299 YIGGRYWHDPGAF-RGEHAID----RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKA 353

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLP 318
           +P A KK++                 VP++ D  L S+   V ASP+++A+   G  V+P
Sbjct: 354 IPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVP 413

Query: 319 HIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGA 378
           H  NAVI+ +++S  NS  Y  SR++ GL+    AP I     + G P + + V +L   
Sbjct: 414 HFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNV 473

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           +++  TS    + F WLL I+G++  FTW  I LSHIRF +A+ ++G S  ++ FK++  
Sbjct: 474 ISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCG 533

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRC- 492
              ++Y    M LI+I Q + +  P     +D   F   Y++  + IA++  ++ + +  
Sbjct: 534 VWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDW 593

Query: 493 RLIWRVEDVDIDTDR 507
           RL  R +D+D+D +R
Sbjct: 594 RLFIRAKDIDLDINR 608

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  259 bits (662), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/513 (32%), Positives = 266/513 (51%), Gaps = 14/513 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E  +I++      ++R LK RH                     L  AGP G LI +    
Sbjct: 64  EAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTG 123

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ Y +  ++GE+A   PV+  FT ++ RF+  +FG AN + Y   W +   LE+     
Sbjct: 124 TMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASI 183

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T       ++++F+V++  +NMF VK YGE EF  + +KV+ ++GF+I    +V
Sbjct: 184 TVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILV 243

Query: 193 CGAGVTGPVGFR-YWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G       W +PGAF      K     RF G  S  + AAF+F G+ELVG+ + 
Sbjct: 244 CGGGPVGGYIGGANWHNPGAFVGNTAGK-----RFKGVCSVFVTAAFSFAGSELVGLASA 298

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E ANPRK++PRA K+V                  VPY+D +L    S   +ASPF++AI+
Sbjct: 299 ETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIK 358

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           N G   LP + N VI+  ++S GNS ++  SR +  L+     P I     + G P V +
Sbjct: 359 NHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGI 418

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
             TS FG L+++  S    + F+WLL ++G++  FTW+ I + H+RF +AL  +G S D+
Sbjct: 419 GFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDE 478

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF----CPWNGIDFLTAYISVFMFIAIWIAF 486
           L F +      + YG   + LI+  Q + +      P +  DF  +Y+S+ + + ++I  
Sbjct: 479 LSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGH 538

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVE-EAVWIE 517
           + + R  +L  R E++DIDT RR V+ EA+ +E
Sbjct: 539 KCYKRNWKLFIRAENIDIDTGRREVDIEALKVE 571

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  259 bits (662), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 263/508 (51%), Gaps = 14/508 (2%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           +++   + ++L  RH                     L   GP   +I ++ ++T  ++V 
Sbjct: 83  DIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVI 142

Query: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140
            SLGE+A   PV   F+V+  RF+ P+   +    Y   W +   LEL      I++W  
Sbjct: 143 NSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWND 202

Query: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTG 199
            +   AW+SIF+ ++  +NM  VK +GE EF ++ +K++AI+GF I    + C G  V G
Sbjct: 203 KINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGG 262

Query: 200 PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
            +G +YW  PGAF           ++F G  S  + AAF++ G E++ ++A E+ +PRKT
Sbjct: 263 YIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKT 317

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY--VSASPFIIAIENSGTHVL 317
           +P A K+                   VPYDD +L +  S   V++SP +IAIEN G   L
Sbjct: 318 IPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGL 377

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           P + NA+I+  ++S  NS +Y  SR M  ++     P  L R  + G P  A LVT  FG
Sbjct: 378 PSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFG 437

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            ++++  S    + F WL  ++G++  F W+ I++SHIRF +A++++G S +++P+ ++ 
Sbjct: 438 LISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQV 497

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC 492
               ++YG   + L++I   +TS  P      N   F   Y+S+ + +A ++  + +F+ 
Sbjct: 498 GVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKN 557

Query: 493 -RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
            RL     ++D+D+ +R ++  +  E++
Sbjct: 558 WRLFTPYNEIDLDSGKRDIDLELLREEK 585

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 264/516 (51%), Gaps = 14/516 (2%)

Query: 13  EEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
            ++R  +   + + +++ ++ RH                   T L NAGP G +I Y  M
Sbjct: 116 NQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIM 175

Query: 73  ATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131
            ++ Y + Q+ GEMA  +  +   + V+    V   FG A  ++Y   W     LEL   
Sbjct: 176 GSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTA 235

Query: 132 GQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191
              I++WT +V    +++IF+ L+  +N+F  K Y E EF+    KV+ ++GF I    +
Sbjct: 236 SLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITI 295

Query: 192 VCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITA 250
             G AG  G +G  YW  PGAF       D +   F G   +L+ AAF + GTE + +TA
Sbjct: 296 TAGGAGNDGYLGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTA 350

Query: 251 GEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD-SYVSASPFIIAI 309
            E +NPR  +P A KKV+                 VP+D  +L  +D S  SASP+++A 
Sbjct: 351 AEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAA 410

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
              G  V+PH  NAVI+ +++S GNS  Y  SR++  L+    AP       + G P  A
Sbjct: 411 SLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARA 470

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
           +L+++LFG +A+   S    + F WLL I+G++  FTW  I LSHIRF  A++++G S  
Sbjct: 471 MLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLG 530

Query: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWI 484
           ++ + A+     ++Y +F M LI I Q + +  P      +  +F   Y+++ + I +++
Sbjct: 531 EVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYL 590

Query: 485 AFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
            ++ +++   L+ + ED+D+ + R+  +E +  E++
Sbjct: 591 GYKIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEED 626

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  258 bits (659), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 169/548 (30%), Positives = 274/548 (50%), Gaps = 26/548 (4%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           +++ S + EE ++     E   +++ LK RH                  S  L   GP G
Sbjct: 50  YSETSSLDEEKQQ--QPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAG 107

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFVSPAFGAANGYMYWFS 119
              +YL + T  Y +  + GEM  ++P   S +  S     +++V  + G A+ + Y++ 
Sbjct: 108 LFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYC 167

Query: 120 WCITFALELSVVGQVIQFWTFA--VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVK 177
           + I  A E +    V+++W +A  VP  AWI+IF   +  +NM PV +YGE EFW A +K
Sbjct: 168 FVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIK 227

Query: 178 VVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236
           ++ I+G +I  F +  G G +   +GFRYW+ PGAF   I   D     FL   + +I  
Sbjct: 228 ILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKG 285

Query: 237 AFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTS 295
            F F  G ELV +T+ E  + R+ + +A ++ V                 V Y+D  L +
Sbjct: 286 GFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQN 345

Query: 296 ----TDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSR 351
               +     +SPF+I I+N+G  VLPHI N  I+ +  SAGN+ ++  SR +  +++  
Sbjct: 346 ALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHG 405

Query: 352 LAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFIS 411
            AP   S+  + GVP+VAV  + LF  LAY+  S+     FNW  NI+ ++GF  W+   
Sbjct: 406 HAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICAC 465

Query: 412 LSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDF 469
           +++IRF +A+    +  D LP+K      L +Y +F ++LI +  G+  F P  W+  DF
Sbjct: 466 VAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDF 524

Query: 470 LTAYISVFMFIAIWIAFQAWFRCRLIWR--VEDVDIDTDRRAVEEAVWIEQE----PRGF 523
           + AYI++ +FI +WI  +   R    W   V+ +D+ T    +EE      E    P   
Sbjct: 525 IAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNA 584

Query: 524 WDKFWNVV 531
           WDKF + +
Sbjct: 585 WDKFLDAL 592

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  259 bits (663), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 157/518 (30%), Positives = 263/518 (50%), Gaps = 15/518 (2%)

Query: 21  EVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVT 80
           E + + +++ +K RH                   + L  AGP G +I Y  M +  Y + 
Sbjct: 125 EEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCII 184

Query: 81  QSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 139
           Q+ GEMA  +  +  +F  +    V  AFG +  ++Y   W     LEL      IQ+WT
Sbjct: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244

Query: 140 FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAGVT 198
             V    ++ IF+VL+  +N+F  K Y E EF+    KV+ + GF I    +   GAG  
Sbjct: 245 TTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304

Query: 199 GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 258
           G +G +YW +PGAF       DK+  RF   +S+   AAF F  +E + I A E +NPR+
Sbjct: 305 GYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRR 359

Query: 259 TVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS-ASPFIIAIENSGTHVL 317
            +P A K ++                 VPY+  +L  + S  + ASP++IA+ + G  V+
Sbjct: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVV 419

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           PH  NAVI+ +++S  NS  Y   RI+Y LS    AP   +   + G P  A+++++LF 
Sbjct: 420 PHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFS 479

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            +A+   S+  +  F WLL I+G++  FTW+ I +SHIRF +A++++G S D++ FK++ 
Sbjct: 480 VIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQV 539

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC 492
               + Y    MTL +I + + S  P      +  +F   Y+++ + I ++  ++   R 
Sbjct: 540 GVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRD 599

Query: 493 -RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            +L  R +D+D+ + R+ + +   I+QE   F ++  N
Sbjct: 600 WKLFIRAKDIDLVSHRK-IYDGELIKQEEEEFKERLRN 636

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  256 bits (655), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 262/522 (50%), Gaps = 23/522 (4%)

Query: 10  KMKEEIREISVEVEAET---VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           K K++   +  + E  T   +++ +K RH                   T L  AGP G +
Sbjct: 44  KKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLI 103

Query: 67  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y   + + Y + Q+ GE+   +  +T ++T +S   V PA G +  ++Y   W   F 
Sbjct: 104 IGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFP 163

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           L+L      I++WT   P   +++I + L+  +N+F  K Y E EF     KV+ ++GF+
Sbjct: 164 LQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFV 222

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG AG  G +G RYW  PGAF  G          F G       AAF + G E
Sbjct: 223 ILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIE 272

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
           ++ +TA E  NPRK++P A KKV+                 VPYD  +LTST S   ASP
Sbjct: 273 VMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASP 332

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F+IAI + G  V+PHI NAVI+  ++S GNS++Y   R++  LS    AP + +   + G
Sbjct: 333 FVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQG 392

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
            P +  LV    G LA++  S   +  F+WLL I+G++  F W+ I LSH+RF  A++ +
Sbjct: 393 RPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQ 452

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYISVFM 478
           G S  ++ +K++     +++ +     +++ Q + +  P       +  DF  +Y++  +
Sbjct: 453 GRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPV 512

Query: 479 FIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
            I I+  ++ +++  RL     +VD+++ R+  +E    +++
Sbjct: 513 LIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQED 554

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  256 bits (654), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 164/537 (30%), Positives = 268/537 (49%), Gaps = 21/537 (3%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           +   S +++ I  I+ +     +++ +K RH                  +  L   GP  
Sbjct: 72  NENTSDLEDGIESITSD---SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
            +I Y+ ++ + Y + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W   
Sbjct: 129 LVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTV 188

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMG 183
             LEL      IQ+W   +    +I IF++ L  +++F VK YGE EF     K++ I G
Sbjct: 189 LPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAG 248

Query: 184 FLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           F+I    + CG AG  G +G  YW +PGAF     A D + ARF      L+   F+F G
Sbjct: 249 FIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGG 303

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD-SYVS 301
            EL  ++  E +NPRK+ P A K+ +                 VPY+D +L     S   
Sbjct: 304 MELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATH 363

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASP+++A    G  ++PHI NAVI+ +++S  NS++Y G R++  LS    AP  L    
Sbjct: 364 ASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVD 423

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P  A++V  +FG +A++  S+  +  F WL  I G++  FTW  I LSH+RF QA+
Sbjct: 424 REGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAM 483

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID-------FLTAYI 474
           +++G S D+L +KA      + YG FF  L+ I Q + +  P  G D       F  +Y+
Sbjct: 484 KVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPL-GNDGRCSVESFFESYL 542

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNV 530
           +  +++  +  +  + R   L+  ++ +D+D  RR + +   I QE +   +K  N+
Sbjct: 543 AAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRR-IYDPELIRQEDQENEEKTKNM 598

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  257 bits (657), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 165/533 (30%), Positives = 260/533 (48%), Gaps = 21/533 (3%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N DS+  E+      + E   +++ +K RH                   TPL  AGP   
Sbjct: 135 NVDSQPVEQ------QDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPL 188

Query: 66  LIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           +I Y  M T  Y + Q+ GE+A  +  V  SF  F    V P F  A  ++Y   W    
Sbjct: 189 VIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVC 248

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++WT  V    ++ IF+VL+  +N F  K Y E EF+    KV+ ++GF
Sbjct: 249 PLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGF 308

Query: 185 LIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
            I   C+  GA G  G +G +YW  PGAF            RF G + + + AAF F  T
Sbjct: 309 FIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGAT 363

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSA 302
           E + +TA E +NPRK +P A KKV                  VPY+ D  + S+    SA
Sbjct: 364 EFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSA 423

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP+++A    G HV+ H  NAVI+ +++S  NS  Y  SR++ GL+    AP       +
Sbjct: 424 SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDR 483

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
           +G P  ++L  ++   +A+  TS      F WLL I+G++  FTW  I +SHIRF + ++
Sbjct: 484 NGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQ 543

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN-----GIDFLTAYISVF 477
           ++G S  +L F+A+     +YY    + L ++ Q + +  P N       +F   Y+++ 
Sbjct: 544 VQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMP 603

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           + +A+++ F+ W R  RL  R +++D+ + R   +E + + QE   + +K  N
Sbjct: 604 ILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEEL-LRQEDEEYKEKLRN 655

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  255 bits (651), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 168/532 (31%), Positives = 275/532 (51%), Gaps = 26/532 (4%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   ++++L+ RH                   + LM AGP   LIAY  M  + ++V   
Sbjct: 55  EGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSC 114

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA- 141
           LGEMA +IP+   FT ++ R+  PA G A G+ Y F + +    +L+    VIQFW  A 
Sbjct: 115 LGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAA 173

Query: 142 -VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200
            V    WI++   ++  +N   V+++GEFEFW++  KV+ ++  +I    +  G G T  
Sbjct: 174 RVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHD 233

Query: 201 -VGFRYWRHPGAFGPGIIAKDKN----QARFLGWVSSLINAAFTFQGTELVGITAGEAAN 255
            +GFRYW  PGAF      KD +      +F+ ++S  + A F + GTEL GI A E  +
Sbjct: 234 RLGFRYWSDPGAFKE-YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKD 292

Query: 256 PRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD---WKLTSTDSYVSASPFIIAIENS 312
           PR+ VPRAIK  +                 V Y+D    + +S +   +ASP+++AIEN+
Sbjct: 293 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENA 352

Query: 313 GTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLV 372
              VLP++FNA ++  + SA NS++YVGSR +YGL+    AP + +RT + GVP+ A+  
Sbjct: 353 VIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALAC 412

Query: 373 TSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLP 432
            +LF  LAYM  S   + AF + +N+T + G  +W+ I +++I F +A   +GI +  L 
Sbjct: 413 CTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLS 472

Query: 433 FKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID---FLTAYISVFMFIAIWIAFQAW 489
           + A   P   +  + F   + +I+ F +F     +D   F+T YI + ++I  +I ++  
Sbjct: 473 YVAPCQPYAGWVALIFCIFVALIKNFDAFIG-KEVDVPTFITGYIGLPIYIFCFIGYKIV 531

Query: 490 FRCR--------LIWRVEDVDIDTDRRAVEEAVWIEQEPRG--FWDKFWNVV 531
            + +        L    E +D++ +    E A+  EQ  +G   W K ++ V
Sbjct: 532 HKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNV 583

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  255 bits (651), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 168/540 (31%), Positives = 269/540 (49%), Gaps = 22/540 (4%)

Query: 6   NQDSKMKEEIREISVEVEAETV---RRELKQ----RHXXXXXXXXXXXXXXXXXVSTPLM 58
           N   +  E  R   V+ E + V     +LKQ    RH                     L 
Sbjct: 51  NSFKRAGEHGRGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALH 110

Query: 59  NAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYW 117
           N GP G  I Y  M +  Y + Q+ GEMA ++  ++ +F  +    + PA G +  ++Y 
Sbjct: 111 NGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYC 170

Query: 118 FSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVK 177
             W     LEL      I++WT AV    ++ IF+VL   +N+F  + Y E EF+    K
Sbjct: 171 LQWLCVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCK 230

Query: 178 VVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236
           V+ I GF I    + CG AG  G +G +YW  PGA     +   K    F G +++++ A
Sbjct: 231 VLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTA 285

Query: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTS 295
           AF F  TE + +TA E ANPR+ +P A KK+V                 VPY+ D  + S
Sbjct: 286 AFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGS 345

Query: 296 TDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPG 355
             S   ASP++IAI + G  V+PH  NAVI+ +++S GNS  Y  SR++  LS    AP 
Sbjct: 346 GGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPS 405

Query: 356 ILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHI 415
            L+   + G P  A+LV+ +FG +A++  S   +  F WLL I+G++  FTW+ I +SHI
Sbjct: 406 WLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHI 465

Query: 416 RFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFL 470
           RF +AL ++G S  +L +K++     +YY    M  ++  Q + +  P      +  +F 
Sbjct: 466 RFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFF 525

Query: 471 TAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
             Y+++ + IA++  ++ W R  +L   +E +D+ + R+  +E + ++QE   + +   N
Sbjct: 526 ENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDL-LKQEDAEYEESIRN 584

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  254 bits (648), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 161/503 (32%), Positives = 262/503 (52%), Gaps = 21/503 (4%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           E++ R L  RH                  +  L   GP    I Y  M  + Y     LG
Sbjct: 55  ESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLG 114

Query: 85  EMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA--- 141
           EM+TF+P++ SF  ++++F   +F  A    YWF+  ++ A +L+ +  V+ +W  +   
Sbjct: 115 EMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHN 174

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP- 200
            P  A   +FWV L G+N+  V+ YGE E+W+AL+KV+AI+ F I    +  G       
Sbjct: 175 FPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEY 234

Query: 201 VGFRYWRHPGA-FGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
           +GF+YW +  A F  G          F G+V+  +++AF++ GTE + +TAGEA NP + 
Sbjct: 235 IGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGGTESITLTAGEARNPIRN 284

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
            PR +K V                  +PYD   L++    V  SPF I  + +GT     
Sbjct: 285 TPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMTSPFTIIFQMAGTKAAGS 342

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLA-PGILSRTTQHGVPWVAVLVTSLFGA 378
             NAVI+ +I+SAGN  ++ GSR++Y +       P ++++T ++  P+VAV++T   G 
Sbjct: 343 FMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGG 402

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           L +  +  G    + WL NI GV+    WL I+++ IRF + L  +G ++ +L FK    
Sbjct: 403 LCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTY 461

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRV 498
           P   Y+ V F+TLII++QG+++F PW+  DF + Y+ +F+F   W+ +  + R R + + 
Sbjct: 462 PYGPYFLVIFVTLIILVQGWSAFDPWSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV-KP 520

Query: 499 EDVDIDTDRRAVEEAVWIEQEPR 521
           ED+D  TDR  ++    IE+  R
Sbjct: 521 EDMDFITDRY-IQSPQEIEENER 542

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  254 bits (650), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 166/514 (32%), Positives = 259/514 (50%), Gaps = 14/514 (2%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           +I +I+       ++  LK RH                   T L  AGP G LI +    
Sbjct: 68  DIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTG 127

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ Y +  ++GE++   P++  FT ++ RF+  +FG AN + Y   W     LE+     
Sbjct: 128 TMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASI 187

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T       ++++FWV++  +N+F VK YGE EF  +++KV+ ++GF+I    + 
Sbjct: 188 TVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLN 247

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     +Y+  PGAF       D   ARF G  S  + AAF+F G+EL+GI A 
Sbjct: 248 CGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAA 302

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E+A PRK+VP+A K+V                  VPY D +L    S   +ASPF+IAI 
Sbjct: 303 ESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAIT 362

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           + G   LP + N VI+  ++S GNS +Y  SR +  L+     P I     + G P   +
Sbjct: 363 SHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGI 422

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
             TS FG +A++  S    + F WLL ++G++  FTW  I   HIRF  AL  +G S D+
Sbjct: 423 AFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDE 482

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID----FLTAYISVFMFIAIWIAF 486
           LPFKA      + +G+F + L+ + Q + +  P  G      F  +Y+S  + +A +   
Sbjct: 483 LPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGH 542

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           + + R  +L+  +  +DIDT RR ++  V + QE
Sbjct: 543 KLYARNWKLLIPLSKLDIDTGRREMDLDV-LRQE 575

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  255 bits (652), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 154/509 (30%), Positives = 256/509 (50%), Gaps = 15/509 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +  +++R++K RH                     L   GP G  I Y  M +  YS+ Q+
Sbjct: 98  KGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQA 157

Query: 83  LGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GE+A   P +T +F  +    V PA   A   +Y   W   F LE+      I++W  +
Sbjct: 158 AGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTS 217

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200
           +    W  IF+V++ G+NM     Y E +F+    K++   GF I    + CG AG +  
Sbjct: 218 INPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVY 277

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YW  PGAF       D   +RF   VS+L+ AAF F  +E V +TA E ANPRK +
Sbjct: 278 IGGKYWNDPGAFN-----GDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAI 332

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-TSTDSYVSASPFIIAIENSGTHVLPH 319
           P A K+V+                 VPY+  +L  S  S V +SP++IA+ + G  V+P 
Sbjct: 333 PSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPS 392

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S GN + Y  SRI+  LS    AP       + G P  A++V +L G +
Sbjct: 393 FINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCI 452

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
            ++  S+  +  F WL+ ++G++  FTW  I +SH+RF +A++++  S  +L F+++   
Sbjct: 453 CFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGV 512

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCPWNGID------FLTAYISVFMFIAIWIAFQAWFRC- 492
             +YYG+F M L+ I Q + +  P  G D      F   Y+++ +F+A++  F+ W +  
Sbjct: 513 WGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDW 572

Query: 493 RLIWRVEDVDIDTDRRAVEEAVWIEQEPR 521
           RL     ++D+ + R+  +E +  +++  
Sbjct: 573 RLYIPASEIDLISHRKIFDEEILKQEDEE 601

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 161/522 (30%), Positives = 263/522 (50%), Gaps = 24/522 (4%)

Query: 17  EISVEVEAETVRRELKQ----RHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFM 72
           E S   + +   R+LKQ    RH                  S+ L   GP G  I+Y+ +
Sbjct: 91  EKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIII 150

Query: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQ-----RFVSPAFGAANGYMYWFSWCITFALE 127
           + + Y +  +LGEM  F+P   S +  S      R+V  + G A G+ Y++ + I  A E
Sbjct: 151 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAE 210

Query: 128 LSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
            +    V+++WT AVP   WI++F +++  +N   VK YGE EFW A +K++ I+G +I 
Sbjct: 211 CTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIIL 270

Query: 188 CFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF-QGTEL 245
            F +  G G     +GFRYW+HPGAF   +     +   F    + +I  AF F  G EL
Sbjct: 271 SFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPEL 328

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDD----WKLTSTDSYVS 301
           V +T+ E A+ R+ + +A ++ V                 VPY+D      L        
Sbjct: 329 VCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAG 388

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           +SPF+I I+N+G  VLPHI N  I+ +  SA N+ ++  +R +  ++ +  AP  L +  
Sbjct: 389 SSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKIN 448

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + GVP+VAV  + L   LAY+  S+     FNW  NI+ ++GF  W+   ++++RF +A+
Sbjct: 449 RWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAI 508

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMF 479
              G+  D LPFK    P   ++ +  +++I I  G+  F P  W   DF+ AY+++ +F
Sbjct: 509 FYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIF 567

Query: 480 IAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPR 521
           + +W+  + + R    W +   +ID  R  VE    IE++ R
Sbjct: 568 LVLWLGHKLYTRTWHQWWLPVSEIDVTRGLVE----IEEKSR 605

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  253 bits (646), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 161/530 (30%), Positives = 267/530 (50%), Gaps = 21/530 (3%)

Query: 18  ISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAY 77
           + +E +   + R LK RH                     L   GP   LIAY  M+   +
Sbjct: 42  LDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVW 101

Query: 78  SVTQSLGEMATFIPVTSSFTVFS--QRFVSPAFGAANGYMYWFSWCITFALELSVVGQVI 135
           SV   + EM T IP+    T++S  + +V+       G+  +++  +    E++    ++
Sbjct: 102 SVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLV 161

Query: 136 QFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA 195
           Q+WT A P A +ISIF VL   + M PVK +GE EFWV+ +K++ I+G +I    +  G 
Sbjct: 162 QYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGG 220

Query: 196 GVTGP--VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT-ELVGITAGE 252
           G      +GF YW+ PGAF P ++  +    +FL + +++I + F+F    E+V   A E
Sbjct: 221 GPAQEHVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAE 278

Query: 253 AANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSAS----PFIIA 308
           A  PR+ +PRA K+ +                 V YD+ +L +  +   +S    PF+I 
Sbjct: 279 AVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIG 338

Query: 309 IENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWV 368
           I+ +G  VLPHI NA I+ +  S G   +Y  SR ++ ++    AP IL+   ++GVP+ 
Sbjct: 339 IKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYY 398

Query: 369 AVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISR 428
              +TSLF  LAY+  S      FNWL NI  ++GF +W+ +S+++IRF   +++  ++ 
Sbjct: 399 CTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN- 457

Query: 429 DDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYIS----VFMFIAI 482
           D +PF+  +   LAY  + F +++ +  GF  F    W+  +F  AYI+    + +F+  
Sbjct: 458 DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGS 517

Query: 483 WIAFQAWFRCRLIWRVE-DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVV 531
            I ++ W RCR I  +E D+         EE  +    PR + +K W V+
Sbjct: 518 TIYYKEW-RCRDIAEIEQDILPKITLAEAEEYEYDIPVPRNWLEKIWMVI 566

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  253 bits (645), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 160/535 (29%), Positives = 271/535 (50%), Gaps = 16/535 (2%)

Query: 5   HNQDSKMKEEIREISVE-VEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPV 63
             +D+    ++ +  +   +   +++ ++ RH                  +  L   GP 
Sbjct: 40  RREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPA 99

Query: 64  GALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
           G LI YL ++ ++Y +  + GEMA   P +  +F  +S  F+S  FG A  +++   W  
Sbjct: 100 GLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLT 159

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
            F LEL     VI++W  +V    ++ IF++ +  ++ F  + YGE EF   + KV+ I+
Sbjct: 160 VFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIV 219

Query: 183 GFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           GF+I    +  GA G TG +G RYWR+PG+F  G    DK +    G    L+ A F+F 
Sbjct: 220 GFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLK----GTAYVLVTAYFSFG 274

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-V 300
           G EL  ++  E  NP+  +P A KK V                 VP+D  +L  + S  V
Sbjct: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDV 334

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
             SP+++AIE  G  VLPHI NAVI+ ++IS GNS +Y   R++  L+    AP  L   
Sbjct: 335 HPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYI 394

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P +++++ ++FG +A+   S   +K F WL  I G++  FTW  I LSH RF QA
Sbjct: 395 DREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQA 454

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW-----NGIDFLTAYIS 475
           ++++G S + L ++A      + Y VFF  L+ I Q + +  P      + + F   Y++
Sbjct: 455 MKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMA 514

Query: 476 VFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
             +++ +++ +  + R   L+  ++ +D+DT RR  +  V ++QE   F ++  N
Sbjct: 515 FPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEV-LKQEEYEFKERMRN 568

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  253 bits (646), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 156/518 (30%), Positives = 262/518 (50%), Gaps = 18/518 (3%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E  ++++   A  + R LK RH                     L  AGP G LI +   A
Sbjct: 70  EAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTA 129

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+   +  SLGE+A   PV+  +  ++ RF+  ++G AN + Y     +   LE+     
Sbjct: 130 TMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASV 189

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T      A++++FWV++  +N+F V+ +GE E   +L+KV+ I+GF+I    ++
Sbjct: 190 TVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLI 249

Query: 193 CGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
            G G    V G +YW  PG F       +    +F G  S  + AAF+F G+EL+G+ A 
Sbjct: 250 SGGGPDHEVIGGKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAA 304

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA-SPFIIAIE 310
           E   PRK++P+A K+V                  VP ++  L +     +A SPF+IA++
Sbjct: 305 ETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMD 364

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
                VLP I N VI+  +IS GNS++Y  SR M  L+     P I     + G P  A+
Sbjct: 365 MHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAI 424

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
             TSLFG L ++  +    + F+WLL I+G++ FFTWL I+L+H+RF  AL+ +G + ++
Sbjct: 425 CFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNE 484

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP---------WNGIDFLTAYISVFMFIA 481
           L F +      + Y V  + ++++ Q + +  P          + I F   Y+S  + I 
Sbjct: 485 LSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIV 544

Query: 482 IWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQ 518
           +++A + W R  +   + +++DIDT RR ++  ++ E+
Sbjct: 545 MYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEE 582

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  253 bits (646), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 262/528 (49%), Gaps = 15/528 (2%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
            N+DS   +     S+ +E    RR+L  R                  + T ++  GP  
Sbjct: 100 QNRDSPKSQ-----SLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGS 154

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            LIA+   + +   +++ +  M T++PVT SF  F++RFV  + G A G+ Y+       
Sbjct: 155 LLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANV 214

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
             E++ V  V+++WT  +P AA IS+  +L   +N++ V ++GE EF++++ KVV  +G 
Sbjct: 215 CFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGL 274

Query: 185 LIYCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
           +I+   ++ G      V GF+ W +PGAF   I   D +  RF G++S L+ A + F G 
Sbjct: 275 IIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGV 332

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY---- 299
           + +G  A EA NPRK +P + +KV                  +PY+D  +          
Sbjct: 333 DYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVG 392

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
             ASP++ A++  G  VLPHI N +I+ +IISAGNS++Y  SR+++ L+    AP I   
Sbjct: 393 AGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKV 452

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
           TT+ GVP    +   +   LAY+  S        W LN+   A    ++FI +S+++F +
Sbjct: 453 TTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRK 512

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVF 477
               + +    LP+ +  +P LA++ +F++ L++++ G+T F    W+   F+ +Y  + 
Sbjct: 513 GCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIP 572

Query: 478 MFIAIWIAFQAWFRCRLIWRVE-DVDIDTDRRAVEEAVWIEQEPRGFW 524
            F+      + +   + +  +E D+    +  A E+  W E  P   W
Sbjct: 573 FFLVFLFGHKLYKGTKSVRPLEMDLFTGIEELADEDRYWAENPPTLNW 620

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  252 bits (644), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 163/536 (30%), Positives = 265/536 (49%), Gaps = 19/536 (3%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           +   S +++ I+  + + +   +++ +K RH                  +  L   GP  
Sbjct: 72  NENTSDLEDGIQSFTSDSK---LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
            +I Y+ ++ + Y + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W   
Sbjct: 129 LVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTV 188

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMG 183
             LEL      IQFW   +    +I IF+V L  ++ F VK YGE EF     K++ I G
Sbjct: 189 LPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAG 248

Query: 184 FLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           F++    + CG AG  G +G  YW  PGAF     A D + ARF      L+ A F+F G
Sbjct: 249 FIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGG 303

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPY-DDWKLTSTDSYVS 301
            EL  ++  E  NPRK+ P A K+ +                 VPY DD  L +  S   
Sbjct: 304 MELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATH 363

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASP+++A    G  ++PHI NAVI+ +++S  NS++Y G R++  L+    AP  L    
Sbjct: 364 ASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVD 423

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P  A++V  + G +A++  S+  +  F WL  I G++  FTW  I LSH+RF QA+
Sbjct: 424 REGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAM 483

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW------NGIDFLTAYIS 475
           +++G S ++L +KA      + YG FF  L+ I Q + +  P       N   F  +Y++
Sbjct: 484 KVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLA 543

Query: 476 VFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNV 530
             +++  +I +  + R   L+  ++ +D+D  RR V +   + QE     +K  N+
Sbjct: 544 APIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRR-VYDPELMRQEDEENKEKIKNM 598

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  251 bits (641), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 149/505 (29%), Positives = 253/505 (50%), Gaps = 15/505 (2%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           +T++  +K RH                     L   GP G +I Y+  +T+ Y V Q+  
Sbjct: 66  QTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACC 125

Query: 85  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 143
           E+   +  +  ++  +    V   FG A   +Y   W     LEL      +++WT +V 
Sbjct: 126 ELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVN 185

Query: 144 LAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGF 203
              +++IF+V L  ++ F  + Y E EF    +KV+ + GF+I    +  GA   G +G 
Sbjct: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG 245

Query: 204 RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 263
           +YW  PGAFG      D+   RF G  S  + AAF + G+E + +TA E ANPR++VP+A
Sbjct: 246 QYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKA 300

Query: 264 IKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD--SYVSASPFIIAIENSGTHVLPHIF 321
            K+ +                 VP++  +L S +  S   ASPF+IA    G  V+PHI 
Sbjct: 301 TKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHII 360

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           N +I+ ++IS GNS +Y   RI+  L+   + P I +   + G P V ++  SLFG +A+
Sbjct: 361 NFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAF 420

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S   +  F WL  I G++  FTW  I++SH+RF +A+ ++G S  +L ++A      
Sbjct: 421 VAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALG 480

Query: 442 AYYGVFFMTLIIIIQGFTSFCP---WNGID---FLTAYISVFMFIAIWIAFQAWFRC-RL 494
           +YY +FF  +++I Q + +  P      +D   F   Y++  + +  ++ ++ W R  RL
Sbjct: 481 SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRL 540

Query: 495 IWRVEDVDIDTDRRAVEEAVWIEQE 519
           +    +VD+ + R+  +E V +++E
Sbjct: 541 VIPSSEVDLLSHRQIFDEEVLLQEE 565

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  249 bits (637), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/525 (28%), Positives = 261/525 (49%), Gaps = 11/525 (2%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+  ++    +   +  +E    RR+L  R                  + T +++ GP  
Sbjct: 23  HDVGAETIRSLEGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGS 82

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
            LIA+   + +   ++Q +  M T++PVT SF  F++RFV  + G + G+ Y+       
Sbjct: 83  LLIAFCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANV 142

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
             E++ V  V++FWT  +P AA ISI   L   +N+F V  +GE EF++++ KV+  +G 
Sbjct: 143 CFEITAVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGL 202

Query: 185 LIYCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
           + +   ++ G      V GF+ W +PGAF   I     +  +F G++S LI A + F G 
Sbjct: 203 IFFTIVVMAGGNPQHKVLGFKNWSNPGAFAEYI--SKGSAGKFHGFMSCLIFALYVFWGV 260

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY---- 299
           + +G  A EA NPRK +P + +KV                  VP++D  +    S     
Sbjct: 261 DYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVG 320

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
             ASP++ A++  G  VLPHI N +I+ +IISAGNS++Y  SR+++ L+    AP +  +
Sbjct: 321 AGASPYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-K 379

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
            T+ GVP    +   L   LAY+  S        W LN+   A    ++FI +S+++F +
Sbjct: 380 ITKRGVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAK 439

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVF 477
             + + I    LP+ + ++P L ++ +F++ L++ + G+  F    W+   F+ +Y  + 
Sbjct: 440 GCKAQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIP 499

Query: 478 MFIAIWIAFQAWFRCRLIWRVE-DVDIDTDRRAVEEAVWIEQEPR 521
            FI ++   + + + R +  VE D+       A E+A W E  P+
Sbjct: 500 FFIVLFAGHKLYKKTRFVKPVEMDLFSGIAELAEEDAYWEENPPK 544

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  249 bits (637), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 161/544 (29%), Positives = 263/544 (48%), Gaps = 23/544 (4%)

Query: 2   LGGHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
           L  ++ DS+    +     +     +++ LK  H                  S+ L   G
Sbjct: 28  LTSYSNDSEKNGSLPN-KPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCG 86

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIP-------VTSSFTVFSQRFVSPAFGAANGY 114
           P G  I+Y  M+T+ Y V  +L EM  F+P          S +    R+V  + G A G+
Sbjct: 87  PAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGW 146

Query: 115 MYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
            Y + + I  A E +    V+ +WT AVP AAWI+IF  ++  +N   V++YG  E    
Sbjct: 147 NYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFC 206

Query: 175 LVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSL 233
            +K+  I+G +I    +  G G     +GFR+W+ PGA+   +   D    R    ++ +
Sbjct: 207 SLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGV 264

Query: 234 INAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWK 292
           I A F F  G ELV +T+ EA + R+ + +A ++ V                 V  +D  
Sbjct: 265 IRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPV 324

Query: 293 LTSTDSY----VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLS 348
           L +  S       +SPF+I I+N+G  VLPHI N  I+++  S+GNS +Y  +R +  LS
Sbjct: 325 LLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLS 384

Query: 349 TSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWL 408
               AP I +R  + GVP+  V   + F  LAY+  S+     FNW  NI+ ++GF  W+
Sbjct: 385 QEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWI 444

Query: 409 FISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID 468
              ++++RF +A+    +  D LPFK  + P   ++ +  + +I +I G+ SF  WN  D
Sbjct: 445 CSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFVHWNYKD 503

Query: 469 FLTAYISVFMFIAIWIAFQAWFRCRLIW--RVEDVDIDTDRRAVEEAVWIEQE----PRG 522
           F+ AYI++ +F+ +W+  +A+ R    W   V ++D+ T  R +EE           PR 
Sbjct: 504 FIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLREIEEETKELNARRIPPRN 563

Query: 523 FWDK 526
            W+K
Sbjct: 564 LWEK 567

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  249 bits (637), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 155/528 (29%), Positives = 264/528 (50%), Gaps = 18/528 (3%)

Query: 12  KEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
           K ++ E+S+E     +++ +K RH                  +  L   GP   +I Y+ 
Sbjct: 51  KSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYIL 110

Query: 72  MATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 130
           ++ + Y + Q+ GEMA   P +  SF  ++  F+S   G A  +++   W     LEL  
Sbjct: 111 VSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELIT 170

Query: 131 VGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC 190
               IQ+W  ++    WI IF+V L  +++F VK YGE EF     K++ I GF+I+   
Sbjct: 171 GTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIV 230

Query: 191 M-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGIT 249
           +   GAG  G +G +YW++PG+F     A   +  RF      L+ A F++ GTEL  ++
Sbjct: 231 VNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLS 285

Query: 250 AGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD-SYVSASPFIIA 308
             E ANPR++ P+A K+ +                 VP+D+ +L     S   ASP+++A
Sbjct: 286 VNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLA 345

Query: 309 IENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWV 368
               G  V+PHI NAVI+  + S GNS++Y   R+   L+    AP  L+   + G P +
Sbjct: 346 ASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPII 405

Query: 369 AVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISR 428
           A+   ++ G +A+   S+  ++ F WL  I  ++  FTW  I LSHIRF  A++++G   
Sbjct: 406 ALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDL 465

Query: 429 DDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSFCPWNGI----DFLTAYISVFMFIAI 482
           ++L +KA  + G+  + +G  F  L+ I Q + +  P  G      F  +Y++  +++  
Sbjct: 466 NELGYKA--LTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFF 523

Query: 483 WIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           + A+  W R    + ++ED+D+D  RR + +  ++ QE     +K  N
Sbjct: 524 YFAYMLWKRDFTFLTKLEDIDLDAHRR-IYDPEFLRQEDEERKEKIRN 570

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  250 bits (638), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 163/519 (31%), Positives = 262/519 (50%), Gaps = 21/519 (4%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E   +  ++    +RR ++ RH                     L   GP G +I Y  ++
Sbjct: 66  ETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVS 125

Query: 74  TLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132
            +AY + Q+ GEMA   P +  +F  +S  F+S  FG A+ ++Y   W   F LEL    
Sbjct: 126 VVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITAS 185

Query: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
             I++WT +V    +I+IF+V +  ++ F  + YGE EF   L KV+ I GF+I    + 
Sbjct: 186 LTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVIN 245

Query: 193 CG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG AG +G +G RYW  PGAF  G  A     ++F G+   L+   F++ GTEL  +T  
Sbjct: 246 CGGAGNSGYIGARYWHDPGAFAVGDPA-----SKFKGFCYVLVTGYFSYGGTELYAMTVN 300

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPY--DDWKLTSTDSYVSASPFIIAI 309
           E ++PR+ +  A K+ +                 VP+  D+   +   S   ASP+++A+
Sbjct: 301 EQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAV 360

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
              G  V+PHI NAVI+  ++S GNS +Y G R++  L+    AP  L+   + G P +A
Sbjct: 361 SLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMA 420

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
           ++  S+ G LA++  S   +  F WL  I G++  FTW  I LSHIRF QA++  G S  
Sbjct: 421 LIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLS 480

Query: 430 DLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSFCPW--NG----IDFLTAYISVFMFIA 481
            L +K+  + GL  + YGV F  L+ + Q + +  P   NG    + F  +Y++  ++  
Sbjct: 481 QLGYKS--ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFV 538

Query: 482 IWIAFQAWFRCRLIWR-VEDVDIDTDRRAVEEAVWIEQE 519
            ++ +  +    +I R ++D+DI+  R   +E   IEQE
Sbjct: 539 FFLGYMVYSGEWMILRPLKDIDINHFRCVYDEER-IEQE 576

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  250 bits (638), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 160/534 (29%), Positives = 268/534 (50%), Gaps = 21/534 (3%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
            D+ +++  R +        +++ +K RH                  +  L  AGP   +
Sbjct: 69  DDNDLEDGTRSMR---SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLV 125

Query: 67  IAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y+ ++ + Y + Q+ GEM    P +  +F  ++  FVS +FG A  +++   W     
Sbjct: 126 IGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLP 185

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++W   +    +I+IF+V L  ++ F VK YGE EF     K++ I GF+
Sbjct: 186 LELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFI 245

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG AGV G +G  YWR+PG+F  G      +  RF G    L+ A F+F G E
Sbjct: 246 ILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGICFILVTAYFSFGGIE 300

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSAS 303
           L  ++  E ANPRK+ P A K+ +                 VP+D+ +L  S  S   AS
Sbjct: 301 LFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHAS 360

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P+++A    G  V+PHI NAVI+ ++IS  NS +Y   R+M  L+    AP  L+   + 
Sbjct: 361 PYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P  A++V S  G + ++  S+  ++AF WL  I G++  FTW  I LSHIRF +A+++
Sbjct: 421 GRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKV 480

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGID-------FLTAYISV 476
           +G S D++ +K+      +YYGV F  L+ + Q + +  P  G D       F  +Y++ 
Sbjct: 481 QGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSP-PGSDGKCDVESFFQSYLAA 539

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            ++I +++ +  + +   L+  ++ +D+D  RR  +  + + QE     ++  N
Sbjct: 540 PLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEI-MRQEDEENKERLRN 592

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  249 bits (636), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 149/504 (29%), Positives = 260/504 (51%), Gaps = 20/504 (3%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           ++R LK RH                     L   GP   ++A++   ++ YSV Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA- 145
              +PV+ S+  +  RF+ P+FG A  Y Y     +T  LE+      + +W      A 
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 146 AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGV--TGPVGF 203
            ++++F+V +  +N   VK YGE EF  +++KV+AI+GF+I    +VCG G   TG +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 204 RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 263
           +YW +PG F  G          F G+ +  + +AF+F G+E+  + A E+ NPR+ +P+A
Sbjct: 264 KYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKA 313

Query: 264 IKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-TSTDSYVSASPFIIAIENSGTHVLPHIFN 322
            K+V                  VPY +  L  S+    SASPF+IAI+ +G   LP + N
Sbjct: 314 AKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVIN 373

Query: 323 AVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYM 382
            VI+  ++S GN+ ++  SR    L+     P   +   + G P   ++++ +FG L+++
Sbjct: 374 VVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFL 433

Query: 383 ETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLA 442
            +S      F W+L ++G+  FFTW  I + H+RF Q L  +G S D+L FKA+     +
Sbjct: 434 SSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGS 493

Query: 443 YYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWR 497
            YG+  +++++  Q + +  P     +   F   Y+S+ + I  ++  + + R  RL+  
Sbjct: 494 IYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIP 553

Query: 498 VEDVDIDTDRRAVEEAVWIEQEPR 521
            +++D+DT RR V+  + ++QE +
Sbjct: 554 AKELDLDTGRREVDLEL-LKQEIK 576

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  249 bits (636), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 157/533 (29%), Positives = 263/533 (49%), Gaps = 19/533 (3%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
            D+ +++  R +        +++ +K RH                  +  L  AGP   +
Sbjct: 69  DDNDLEDGTRSMK---SNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLV 125

Query: 67  IAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y+ ++ + Y + Q+ GEM    P +  +F  ++  F+S +FG A  +++   W     
Sbjct: 126 IGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLP 185

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++W   +    +I IF+V L  ++ F VK YGE EF  +  K++ I GF+
Sbjct: 186 LELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFI 245

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG AGV G +G +YWR PG+F  G         RF G    L+ A F+F G E
Sbjct: 246 ILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGICFILVTAYFSFGGIE 300

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS-AS 303
           L  ++  E +NPRK+ P A K+ V                 VP+++ +L  + S  + AS
Sbjct: 301 LFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS 360

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P+++A       V+PHI NAVI+ ++IS  NS +Y   R+M  L+    AP  L    + 
Sbjct: 361 PYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDRE 420

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P  A+ V  L G + ++  S   ++AF WL  I G++  FTW  I LSHIRF +A+++
Sbjct: 421 GRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYISVF 477
           +G S D++ +KA      +YYGVFF  L+ + Q + +  P       N   F  +Y++  
Sbjct: 481 QGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAP 540

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           +++ +++ +  + R    +  ++ +D+D  RR  +  + I QE     ++  N
Sbjct: 541 LWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEI-IRQENEENKERLKN 592

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  251 bits (641), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 274/536 (51%), Gaps = 26/536 (4%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+ D+++ +  +       ++ +++ +K RH                 + + L+ AGP G
Sbjct: 143 HHHDAQINDNSK-------SDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAG 195

Query: 65  ALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
            +I +  M +  Y + Q++GE+A  +  +   F  +    V  AF  A  ++Y   W   
Sbjct: 196 LIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCV 255

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIM 182
             LEL      I++WT  V    ++ IF++L+ G+N+      Y E EF     K++ ++
Sbjct: 256 CPLELVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMI 315

Query: 183 GFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           GF I    ++CG AG  G +G +YW  PGA     +  D +  RF G +++L+NAAF F 
Sbjct: 316 GFFILGITVICGGAGTDGYIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFG 370

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYV 300
            +E +G+TA E +NPRK +P A KK++                 VPY+ D  L ST S V
Sbjct: 371 MSEFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGV 430

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
            ASP+++AI   G  V+PH  NAVI+ +++S  NS  Y  SR++  L+    AP I S  
Sbjct: 431 KASPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYI 490

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P V +   ++FG +A+  TS    + F WLL I+G++  FTW+ I +SHIRF +A
Sbjct: 491 DREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRA 550

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN--------GIDFLTA 472
           + ++G S  +L F+++     + Y    M +I+I Q + +  P N          +F   
Sbjct: 551 MHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFEN 610

Query: 473 YISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKF 527
           Y+++ + +A +  ++ W +  +L  R +++D+ + R   +E + I+QE   + ++ 
Sbjct: 611 YLAMPILLAFYFGYKIWKKDWKLFIRAKNIDLISHRNIFDEEL-IKQEEDEYRERL 665

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  248 bits (634), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 152/533 (28%), Positives = 262/533 (49%), Gaps = 27/533 (5%)

Query: 12  KEEIREISVEVE----AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
            E+++E+  E E    A  +++ +K RH                     L  AGP G +I
Sbjct: 51  SEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVI 110

Query: 68  AYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
            Y   + + Y + Q+ GE+   +  +  ++T +S   V PA G +  ++Y   W     L
Sbjct: 111 GYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPL 170

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           +L      +++WT A P   ++++F+V++  +NMF  K Y E EF   + KV+ I GF+I
Sbjct: 171 QLVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVI 229

Query: 187 YCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
               + CG AG +G +G +YW  PG+F  G          F G       AAF++ G E+
Sbjct: 230 LGIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEV 279

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL--TSTDSYVSAS 303
           + +TA E  NPRK++P A KKV+                 VPY+  +L  +S +S   AS
Sbjct: 280 MVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHAS 339

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P +IA+ + G  ++PHI NAVI+ ++IS GNS++Y   R++  LS    AP  L+   + 
Sbjct: 340 PLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQ 399

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P +   +T L   +A++  S   +  F WLL I+G++  F W  I LSH+RF  A+  
Sbjct: 400 GRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHA 459

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYISVF 477
           +G+S   + +K++     +++ +    L++I Q + +  P       N   F   Y++  
Sbjct: 460 QGLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFP 519

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           + +  +  ++ + +  RL     +VD+ + R   +E + + QE   + +K  N
Sbjct: 520 ILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEI-LRQEDYEWNEKMSN 571

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  248 bits (634), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 161/533 (30%), Positives = 266/533 (49%), Gaps = 17/533 (3%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           D+    E   I+        ++ +K RH                     L   GP G LI
Sbjct: 63  DASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLI 122

Query: 68  AYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
            Y  ++ +AY + Q+ GEMA   P +  +F V+S  F+S +FG A  ++Y   W     L
Sbjct: 123 GYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPL 182

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           EL      I++W  ++   A+I+IF+ ++  ++ F    YGE EF  +  KV  I GF+I
Sbjct: 183 ELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFII 242

Query: 187 YCFCMVCGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
               + CG   TG      YWR+PGAF  G          F G    L+ A F++ G EL
Sbjct: 243 LSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMEL 297

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL--TSTDSYVSAS 303
             +T  E ANPRK VP A KK +                 VPY+  +L  +S  S   AS
Sbjct: 298 FALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS 357

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P++IA+ + G  V+PHI NAVI+ +++S GNS +Y   R++  L+    AP I S   + 
Sbjct: 358 PYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRA 417

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P VA++  S+FG L+++  S   ++ F WL  I G++  FTW  I LSH+RF  A++ 
Sbjct: 418 GRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKY 477

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGID-----FLTAYISVF 477
           +G S  +L +K+K     + Y +FF  ++ + Q + +  P  NG       F  +Y++  
Sbjct: 478 QGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFP 537

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++I+ ++ ++ + +  +L+  ++++D+++ R   ++ + ++QE     +K  N
Sbjct: 538 IWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHI-LQQEDDEHKEKLKN 589

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  247 bits (631), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 155/533 (29%), Positives = 266/533 (49%), Gaps = 19/533 (3%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           +D+ +++  + +        +++ +K RH                  +  L  AGP   +
Sbjct: 69  EDNDLEDGTKSMK---SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLV 125

Query: 67  IAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y+ ++ + Y + Q+ GEM    P +  +F  ++  F+S +FG A  +++   W     
Sbjct: 126 IGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLP 185

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      +++W   +    +I IF+V L  ++ F VK YGE EF     K++ + GF+
Sbjct: 186 LELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFI 245

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG AGV G +G +YWR PG+F  G         RF G    L++A F+F G E
Sbjct: 246 ILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIE 300

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSAS 303
           L  ++  E +NPRK+ P A K+ V                 VP+++ +L  S  S   AS
Sbjct: 301 LFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS 360

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P+++A       V+PHI NAVI+ ++IS  NS +Y   R+M  L+    AP  L+   + 
Sbjct: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P  A++V SL G + ++  S   ++AF WL  I G++  FTW  I LSHIRF +A+++
Sbjct: 421 GRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYISVF 477
           +G S D++ +KA      +YYGVFF  L+ + Q + +  P       +   F  +Y++  
Sbjct: 481 QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP 540

Query: 478 MFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++I +++ +  + R    +  ++ +D+D  RR  +  + + QE     ++  N
Sbjct: 541 LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEI-MRQEDEENKERLKN 592

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  248 bits (634), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 163/546 (29%), Positives = 270/546 (49%), Gaps = 35/546 (6%)

Query: 6   NQDSKMKEEIREISVEVEAETV----------RRELKQRHXXXXXXXXXXXXXXXXXVST 55
           + ++K  E I  ++ ++E  T           +  +K RH                  + 
Sbjct: 123 DPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAK 182

Query: 56  PLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGY 114
            L  +GP G ++ Y  ++ + Y V Q+ GEMA   P +   F  +   F+S  FG A  +
Sbjct: 183 SLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVW 242

Query: 115 MYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
           ++  +W     LEL      +++WT ++    ++ IF++ L  ++   ++ Y E EF+  
Sbjct: 243 IFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFN 302

Query: 175 LVKVVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSL 233
             K++ I GF+I+   + CG AG  G +G +YW  PG F     A D   ARF      L
Sbjct: 303 SCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVL 357

Query: 234 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL 293
           INA F++ GTEL  ++  E  NPRK VP A K  V                 VPY+   L
Sbjct: 358 INAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDL 417

Query: 294 TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLA 353
               +   ASP+++A +  G  ++PH  NAVI+ ++IS  NS ++ G R++  L+    A
Sbjct: 418 MGNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFA 477

Query: 354 PGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLS 413
           P  L+   + G P +A+ V SLFG +A+  TS    + F WL  I G++  F W  I LS
Sbjct: 478 PKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLS 537

Query: 414 HIRFMQALEMRGISRDDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSF-CPWNG---- 466
           HIRF  A++  G S D++ +KA  + G+  +YYG+FF  L++I Q + +   P +G    
Sbjct: 538 HIRFRWAMKYHGKSMDEVGYKA--ITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVT 595

Query: 467 -IDFLTAYIS----VFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPR 521
            I F  +Y++    VF ++   I  + W    ++  ++D+D+D  RR + +A ++ QE  
Sbjct: 596 AISFFESYLAFVIWVFFYLCYMIYNKDW---TILIPLKDIDVDYQRR-IYDADFLRQEKE 651

Query: 522 GFWDKF 527
             ++K+
Sbjct: 652 ESYEKY 657

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  247 bits (631), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 168/535 (31%), Positives = 269/535 (50%), Gaps = 22/535 (4%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N+ +  + E    SVE   + +++ +K RH                   + L+ AGP G 
Sbjct: 92  NEMTTAEPEAEMASVE---DNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGL 148

Query: 66  LIAYLFMATLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFVSPAF--GAANGYMYWFSWCI 122
           +  Y  M T  Y + QS GEMA  +  +   F  +    V P F      G ++    C+
Sbjct: 149 VTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCL 208

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
           +F +         ++WT  V    ++ IF+VL+  +N+F  + Y E EF+    KV+ + 
Sbjct: 209 SFGIGYCF--DDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMA 266

Query: 183 GFLIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           GF I    + V GAG  G +G  YWR+PGAF       DK    F G V++L+ AAF F 
Sbjct: 267 GFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFG 321

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS 301
           GTE + +TA E +NPRK +P A KKV+                 VP+   +L  + S  +
Sbjct: 322 GTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAAT 381

Query: 302 A-SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
           A SP++IA+ + G  V+PH  NAVI+ +++S GNS  Y  SR++  LS    AP      
Sbjct: 382 AASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYV 441

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P  A++V++LFG +A+  TS    + F WLL I+G++  FTW+ I LSHIRF  A
Sbjct: 442 DREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAA 501

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYIS 475
           ++ +G S  ++ FKA+     +YY +F M L +I Q + +  P      +  +F   Y++
Sbjct: 502 MKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLA 561

Query: 476 VFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           + + I  +  ++ W +   L  + ED+D+ + R+  +E + ++QE     +K  N
Sbjct: 562 MPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEEL-LKQEDYELKEKLKN 615

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  246 bits (629), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/524 (29%), Positives = 260/524 (49%), Gaps = 19/524 (3%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
            DS    ++ + +   + +  ++ +K RH                     L  AGP   +
Sbjct: 75  DDSPDHNDLEKTTTAHQEQ--KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132

Query: 67  IAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           IAY  ++ + Y + Q+ GEMA   P +  SF  ++  F+S  FG A  +++   W     
Sbjct: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++W  ++    ++ IF+V L  ++ F V+ YGE EF     K++ I GF+
Sbjct: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I+   + CG AG  G +G +YW  PGAF     A     +RF G   +L+NA F++ G E
Sbjct: 253 IFAIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNE 307

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL--TSTDSYVSA 302
           L  ++  +  NPRK+ P A K  V                 VP++  +L   S  + + A
Sbjct: 308 LFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHA 367

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP+++A    G  V+PHI NAVI+  +IS  NS++Y G R++  L+    AP  LS   +
Sbjct: 368 SPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDR 427

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G P  A+L+++L G + +  TS   ++ F WL  I+G++  FTW  I  SHIRF +A++
Sbjct: 428 RGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMK 487

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN------GIDFLTAYISV 476
           ++  S D L +KA      +Y+GV F  L+   Q + +  P N         F  +Y+++
Sbjct: 488 LQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAM 547

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
            +++  +  +  W++   ++  +  VD+D  R+ V +  ++ QE
Sbjct: 548 PIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRK-VYDPEFLRQE 590

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  244 bits (623), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 246/498 (49%), Gaps = 19/498 (3%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R LK RH                     L   GP+  L+ +  +  +A++V +S+GE+
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEI 108

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
            T  P    FT  ++RF   A  A  GY Y   +    A E + +  ++QFW   VPL  
Sbjct: 109 ITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 168

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV-GFRY 205
           +I IFW       +  V  +GE E+W++  K+V ++ + I+    + G     P  GF Y
Sbjct: 169 YILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHY 228

Query: 206 WRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 265
           W  PG+   G          F G     +  +  + GTE V + A E+ NP K VP A++
Sbjct: 229 WNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVR 278

Query: 266 KVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVI 325
           + +                 VP+DD  L++T + V  SP  IAI  +G     H+ NA I
Sbjct: 279 QTLWRVLIVYIGIAVFYGATVPFDDPNLSAT-TKVLKSPISIAISRAGWAGGAHLVNAFI 337

Query: 326 VATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETS 385
           + T ISA N ++Y+GSR +  L+   LAP IL+ T + GVP  A+ V +  G ++ M  S
Sbjct: 338 LVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVS 397

Query: 386 TGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYG 445
            G   A+++++N++GV  F  W  IS +H+R  +A   +G S ++LP+KA   P    + 
Sbjct: 398 VGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFS 457

Query: 446 VFFMTLIIIIQGFTSFCPWNGIDFLTAYI----SVFMFIAIWIAFQAWFRCRLIWRVEDV 501
           +     + +IQG+TSF P++  +F+ AYI    ++ +++AI +     FR   I  ++ V
Sbjct: 458 LIANVFLALIQGWTSFVPFDAGNFVDAYILLPVAIVLYVAICVFKNHHFR---IVDLKSV 514

Query: 502 DIDTDRRAVEEAVWIEQE 519
           D+D  RR   +A + +QE
Sbjct: 515 DLDEGRRKDIDADFSDQE 532

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  243 bits (620), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 162/516 (31%), Positives = 254/516 (49%), Gaps = 34/516 (6%)

Query: 12  KEEIREISVEVEAETVR--------------RELKQRHXXXXXXXXXXXXXXXXXVSTPL 57
           K+EI E+S  ++ + +R              R L  RH                  +  L
Sbjct: 17  KQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLSTAKSL 76

Query: 58  MNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYW 117
            N GP    + Y  +  + Y     LGEM+TF+P++ SF  ++++F S +F  A  + YW
Sbjct: 77  HNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYW 136

Query: 118 FSWCITFALELSVVGQVIQFWTFA---VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVA 174
           F+  ++ A +L+ +  V+ +W  A    P      IFW  +  +N+  V+ YGE E+W+A
Sbjct: 137 FNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLA 196

Query: 175 LVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGA-FGPGIIAKDKNQARFLGWVSS 232
           ++KV+AI+ F I    +  G       +GF+ W H  A F  G          F G+ S 
Sbjct: 197 MLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPFVNG----------FKGFASL 246

Query: 233 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWK 292
            ++A F + GTE + +T GEA+NP +  P+ +K V                  +PYD   
Sbjct: 247 FVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPG 306

Query: 293 LTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRL 352
           L++    V  SPF +  + +GT       NAVI+ ++ISA N  ++ GSRIMY ++    
Sbjct: 307 LSTKS--VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGY 364

Query: 353 AP-GILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFIS 411
            P  I+ RT ++  P+VAVL+T   G L    +  G    + WL NI GV+    WL I 
Sbjct: 365 LPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIG 424

Query: 412 LSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLT 471
           ++ IRF + LE++G   D L FK    P   Y+ V F   II+IQG+ +F PW+  DF +
Sbjct: 425 ITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDPWSVTDFFS 483

Query: 472 AYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDR 507
            Y+ +F+F  ++I +  W R   + + ED+D  TDR
Sbjct: 484 VYLELFVFPFVYIIWWLWKRDWFV-KYEDMDFVTDR 518

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  243 bits (620), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 151/488 (30%), Positives = 237/488 (48%), Gaps = 17/488 (3%)

Query: 8   DSKMKEEIREISVEVEA-----ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           D K  E   E S+  E        V+R+LK RH                     L   GP
Sbjct: 32  DPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGP 91

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
           +  L+ +  +  LA+ + +S+GEM T  P    FT  ++RF S A  A  GY Y   +  
Sbjct: 92  LALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFA 151

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
             A E + +  ++QFW   VPL  +I IFW       +  V  +GE E+W+A  K++ ++
Sbjct: 152 VLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLL 211

Query: 183 GFLIYCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
            + I+    + G     P  GF+YW  PGA   G          F G  +  +  +  + 
Sbjct: 212 TYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG----------FKGIANVFVFCSTFYS 261

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS 301
           GTE V + A E+ NPR+ VP AI++                   VPY+D  L    + V 
Sbjct: 262 GTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA-TKVL 320

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
            SP  IAI  +G     H+ NA I+ T ISA N ++Y+GSR +  L+   LAP +L+ T 
Sbjct: 321 KSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTD 380

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + GVP  A+ V +  G ++ M  S     A+N+++N++GV  F  W  ISL+H+RF +A 
Sbjct: 381 RRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAW 440

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIA 481
           +++G +RD+LP+KAK  P      +     + ++QG++ F P++  +F+ AYI +   I 
Sbjct: 441 KLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKPFDAKNFVDAYILIPAGII 500

Query: 482 IWIAFQAW 489
           +++    W
Sbjct: 501 LYLGVSYW 508

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  241 bits (615), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/516 (29%), Positives = 259/516 (50%), Gaps = 22/516 (4%)

Query: 10  KMKEEIREISVEVEAET-VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIA 68
           K++++ R++S E +  T V+R LK RH                     L   GP+  L+ 
Sbjct: 16  KIRDD-RDVS-EFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLG 73

Query: 69  YLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALEL 128
           ++ +  +A++V +S+GEM T  P    FT  ++RF S A  A  GY Y   +    A E 
Sbjct: 74  FVIIGIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEY 133

Query: 129 SVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYC 188
           + +  ++QFW   VPL A+  IFW++     +  V  +GE E+W++L+K++ ++ + I+ 
Sbjct: 134 NTLSSILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFS 193

Query: 189 FCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVG 247
              + G     P  GF YW+ PG+   G          F G     +  +  + GTE V 
Sbjct: 194 IIYMSGGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVA 243

Query: 248 ITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFII 307
           +TA E+ NP K+VP A+++ +                 VP++D  L S ++ V  SP  I
Sbjct: 244 LTATESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAI 302

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367
           AI  +G     H+ NA I+ + ISA N ++Y+GSR +  L+   LAP  L+ T + GVP 
Sbjct: 303 AISRAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPI 362

Query: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427
            A+ + +  G ++ M  S G   A+++++N++GV  F  W  IS +H+R  +A   +G  
Sbjct: 363 PAITIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRL 422

Query: 428 RDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYI----SVFMFIAIW 483
            ++LP+KA + P    + +     + +IQG+TS  P+   +F+ AYI    ++ +++ + 
Sbjct: 423 LEELPYKALFYPWTPIFSLISNIFLALIQGWTSLVPFKAPEFVDAYILLPAAIILYVGVC 482

Query: 484 IAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           +     FR   I  +  V++D  RR   E    +QE
Sbjct: 483 VFKNHNFR---IVDLTSVNLDEGRRKDMENDQSDQE 515

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  242 bits (618), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 257/525 (48%), Gaps = 28/525 (5%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           +  ++++      ++R LK RH                     L  AGP G LI +    
Sbjct: 63  DAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTG 122

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQ 133
           T+ Y +  ++GE+A   P+   FT ++ RFV  +FG A   +Y   W +   LE+     
Sbjct: 123 TMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASI 182

Query: 134 VIQFW-TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
            + +W T       ++++F+V++  +N F VK YGE EF  + +KV+ ++G++I    +V
Sbjct: 183 TVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILV 242

Query: 193 CGAGVTGPVGF-RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
           CG G  G     R W +PGAF  G          F G  S  + AAF+F G+ELVG+ A 
Sbjct: 243 CGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAA 292

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIE 310
           E ANPRK++P A K+V                  VPY   +L    S   +ASPF+I+I+
Sbjct: 293 ETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQ 352

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
           N+G   LP + N VI+  ++S GNS ++  SR M  L+     P I     + G P V +
Sbjct: 353 NAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGI 412

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           +VT +FG L+++  S    + F+WLL ++G++  FTW  I L HIR  +AL  +  +  +
Sbjct: 413 IVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAE 472

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW----NGIDFLTAYISVFMFIAIWIAF 486
           L F A      + YG   + LI++ Q + +  P     +   F  AY+S  + IA +I  
Sbjct: 473 LSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGH 532

Query: 487 QAWFRC-RLIWRVEDVDIDTDRRAV----------EEAVWIEQEP 520
           + W +  +L  R +++DIDT RR            EE  +I  +P
Sbjct: 533 KIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEKAFIASKP 577

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  241 bits (615), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 158/506 (31%), Positives = 249/506 (49%), Gaps = 29/506 (5%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R LK RH                     L   GP+  L+ +  +  +A++V +S+GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
            T  P  S F+  S+RF S A  A +GY Y   +    A E + +  ++QFW   VPL  
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 163

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV-GFRY 205
           +I IF V      M  V  +GEFE+W+A  K++ ++ + I+    + G     P  GF Y
Sbjct: 164 YILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHY 223

Query: 206 WRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 265
           W +PGA   G          F G     +  +  + GTE V + A E+ NP K VP AIK
Sbjct: 224 WNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIK 273

Query: 266 KVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSA--SPFIIAIENSGTHVLPHIFNA 323
           +                   VPY+D   TS  ++  A  SP  IAI  +G     H+ NA
Sbjct: 274 QTFWRIIIVYLGIAVFYGATVPYND---TSLGAHTKALKSPIAIAITRAGWEGGVHLVNA 330

Query: 324 VIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYME 383
            I+ T +SA N ++Y+GSR +  L+   LAP  L  T + GVP  A+ + +  G ++ M 
Sbjct: 331 FILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMN 390

Query: 384 TSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKA---KWMPG 440
            S G   A+++++N++GV  F  W  ISL+H+RF +A +++G S  +LP+K+    W P 
Sbjct: 391 VSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPI 450

Query: 441 LAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYI----SVFMFIAIWIAFQAWFRCRLIW 496
            +     F+ L   IQG+T+F P++  DF+ AYI    +V ++I I +     F+   + 
Sbjct: 451 FSLAANIFLGL---IQGWTTFVPFSAKDFVDAYILLPAAVILYIVISLVKIGGFK---LV 504

Query: 497 RVEDVDIDTDRRAVEEAVWIEQEPRG 522
            +  VD++  RR   ++   +++  G
Sbjct: 505 DLRTVDLEEGRREDLDSDGTDEDSEG 530

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  243 bits (620), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 261/535 (48%), Gaps = 22/535 (4%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           Q S     I    V ++ E ++R++ QRH                  ++ L +AGP G L
Sbjct: 97  QLSNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLL 156

Query: 67  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y  M T  Y V Q+ GE+  T+  +   F  +    V+P+F  + G++Y   W     
Sbjct: 157 IGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTP 216

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++WT  V    ++ IF++L+  +N F  K Y E +F+   +K+  I GF 
Sbjct: 217 LELVTASLTIKYWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFF 276

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG AG  G +G +YW +PGAF       +K    F G  S  + +AF F G+E
Sbjct: 277 ILGIVVACGGAGHDGYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSE 331

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
            V ++A E ANPRK++P A K ++                 VP+D  +L  +      SP
Sbjct: 332 FVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSP 391

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           +++AI   G  V+PH+ NAVI+  ++S  NS  +  SR++  LS    AP       + G
Sbjct: 392 YVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKG 451

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
            P  A+L+++LFG + +  TS      F+WLL I+G++  FT+  I +SHIR   A++++
Sbjct: 452 RPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQ 511

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF---------CPWNGIDFLTAYIS 475
           G S  +L F+++    +  YG F+  L++++     F            +   F   Y++
Sbjct: 512 GRSLGELGFRSQ----VGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLA 567

Query: 476 VFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
             + I  +  +  W +  R+  R +D+D+D  R+  +E + I+QE   + ++  N
Sbjct: 568 APIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDEDL-IKQEDEEYAEQMRN 621

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  242 bits (618), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 153/521 (29%), Positives = 254/521 (48%), Gaps = 17/521 (3%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
            D+ ++   R     +    +++ +K RH                  ++ L  +GP   +
Sbjct: 84  DDNDLESGTRSF---ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLV 140

Query: 67  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           +AY  ++ + Y + Q+ GEMA T+  +  +F  +   FVS  FG A  +++   W     
Sbjct: 141 LAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLP 200

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      I++W   +    ++ IF+V L  ++ F V+ YGE EF     K++ I GF+
Sbjct: 201 LELITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFI 260

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I+   + CG AG  G +G +YW  PGAF         N  RF G    L+ A F++ GTE
Sbjct: 261 IFSIVVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTE 315

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSAS 303
           L  ++  E  NPRK+ P+A K+ +                 VP+D+ +L  S  S   AS
Sbjct: 316 LYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHAS 375

Query: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363
           P+++A    G  ++PH  NAVI+ ++IS  NS++Y   R++  L+    AP  L+   + 
Sbjct: 376 PYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQ 435

Query: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423
           G P  A+   SLFG + +   S   ++ F WL  I G++  FTW  I LSH+RF QA+++
Sbjct: 436 GRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKV 495

Query: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP----WNGIDFLTAYISVFMF 479
           +G   ++L +KA      + YGVFF  L+   Q + +  P       + F  +Y++  +F
Sbjct: 496 QGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIF 555

Query: 480 IAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
              +  +  W +    +  +E +D+D  RR V +  +I QE
Sbjct: 556 FTFYFGYMLWNKDFTFLIPLESIDLDFHRR-VYDPEFIRQE 595

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  241 bits (614), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 155/535 (28%), Positives = 261/535 (48%), Gaps = 23/535 (4%)

Query: 7   QDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           +++ +++  R I   V    +++ +K RH                  +  L  +GP   +
Sbjct: 36  EENDLEDGTRSI---VTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLI 92

Query: 67  IAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y+ ++ + Y + Q+ GEMA   P +  SF  ++  F+S  FG A  ++++  W   F 
Sbjct: 93  IGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFP 152

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           LEL      +++W   +    +I IF+  L  ++ F VK YGE EF     KV+ + GF+
Sbjct: 153 LELITASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFI 212

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAF--GPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           I    + CG AG  G +G +YW  PG+F  GP I        RF G    L++A F++ G
Sbjct: 213 ILSIVINCGGAGTDGYIGAKYWHDPGSFADGPPI-------TRFKGVCFILVSAYFSYGG 265

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS- 301
            EL  ++  E  NPRK+ P A K+ +                 VP++  +L    S  + 
Sbjct: 266 AELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATH 325

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASP+++A       V+PH  NAVI+ ++IS  NS +Y   R+M  L+    AP  L+   
Sbjct: 326 ASPYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVD 385

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P   +++ +LFG + ++  S+  ++ F WL  I G++  FTW  I LSHIRF QA+
Sbjct: 386 REGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAM 445

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYIS 475
           +  G S D++ FKA      +YYG  F  L+ I Q + +  P       +   F  +Y++
Sbjct: 446 KFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLA 505

Query: 476 VFMFIAIWIAFQAWFRCRLIWR-VEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
             +++  +  +  + R   I   +E +D+D  RR + +  +I+QE     ++  N
Sbjct: 506 APIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRR-IYDPDFIKQEDEENKERLKN 559

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  241 bits (616), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 155/513 (30%), Positives = 258/513 (50%), Gaps = 16/513 (3%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           +++ +K RH                  +  L  AGP   +I Y+ ++ + Y + Q+ GEM
Sbjct: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEM 145

Query: 87  A-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA 145
              +  +  +F  ++  F+S +FG A  +++   W     LEL      I++W  ++   
Sbjct: 146 GVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSINAD 205

Query: 146 AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGPVGFR 204
            +I IF+V L  ++ F VK YGE EF     K++ + GF+I    + CG AGV G +G +
Sbjct: 206 VFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGK 265

Query: 205 YWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 264
           YWR PG+F  G      N  RF G    L+ A F+F G EL  ++  E +N RK+ P A 
Sbjct: 266 YWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAA 320

Query: 265 KKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS-ASPFIIAIENSGTHVLPHIFNA 323
           K+ V                 VP+++ +L  + S  + ASP+++A       V+PHI NA
Sbjct: 321 KRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPHIINA 380

Query: 324 VIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYME 383
           VI+ ++IS  NS +Y   R+M  L+    AP  L+   + G P  A+ V +L G + ++ 
Sbjct: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVA 440

Query: 384 TSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAY 443
            S   ++AF WL  I G++  FTW  I LSHIRF +A++++G S  +L +KA      +Y
Sbjct: 441 CSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSY 500

Query: 444 YGVFFMTLIIIIQGFTSFCP-WNGID-----FLTAYISVFMFIAIWIAFQAWFRC-RLIW 496
           YGVFF  L+ + Q + +  P  NG       F   Y++  ++I +++ +  + +   L+ 
Sbjct: 501 YGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLN 560

Query: 497 RVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
            ++ +D+D  RR  +  + + QE     +K  N
Sbjct: 561 PLDKIDLDFHRRVYDPEI-MRQEDEENKEKLRN 592

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  240 bits (613), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 155/489 (31%), Positives = 254/489 (51%), Gaps = 20/489 (4%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           E ++R LK RH                  +  L   GP    + Y  M  + Y     LG
Sbjct: 52  EDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLG 111

Query: 85  EMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV-- 142
           EM+T++P++ SF  ++++F S +F  A  + YWF+  ++ A +++ +  V+ +W      
Sbjct: 112 EMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASG 171

Query: 143 -PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP- 200
            P  A   +FW L+  +N+  V++YGE E+W+A++KV+AI+ F I    +  G       
Sbjct: 172 FPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEY 231

Query: 201 VGFRYWRHPGA-FGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
           +GF+ W H  A F  G          F G+ S  ++A+F + GTE + +T GEAANP + 
Sbjct: 232 IGFKNWNHGEAPFVDG----------FKGFASLFVSASFAYGGTESITLTNGEAANPLRN 281

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
            P+ +K V                  +PYD   L +    V  SPF +  + +GT     
Sbjct: 282 TPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS--VVTSPFTLVFQMAGTKAAGS 339

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPG-ILSRTTQHGVPWVAVLVTSLFGA 378
             NAVI+ ++ISA N  ++ GSR+MY +      P  I+SRT ++ VP+V+VL+TS  G 
Sbjct: 340 FMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGL 399

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           L +  +  G    + WL NI GV+    WL I ++ IRF + LE +G +  +L +K    
Sbjct: 400 LCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTY 458

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRV 498
           P   Y+ V F+T II++QG+++F PW+  +F + Y+ +F+F   +I +  + R R + ++
Sbjct: 459 PYGPYFLVIFVTFIILVQGWSAFDPWDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFV-KL 517

Query: 499 EDVDIDTDR 507
           ED+D  TDR
Sbjct: 518 EDMDFVTDR 526

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 168/512 (32%), Positives = 256/512 (50%), Gaps = 28/512 (5%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           ++R LK RH                     L  AGP G LI +    T+ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW-TFAVPLA 145
           A   PV   +T ++ RFV  +FG A   +Y   W IT  LE+      + +W T A    
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 146 AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGF-R 204
           A++++F+V++ G+N+F VK YGE EF  + +KV+A++GF+I    +VCG G  G     R
Sbjct: 196 AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGR 255

Query: 205 YWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 264
            W +PGAF  G          F G  S  + AAF+F G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAA 305

Query: 265 KKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIENSGTHVLPHIFNA 323
           K+V                  VPY   +L    S   +ASPF+I+I+N+G   LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 324 VIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYME 383
           VI+  ++S GN  ++  SR M  L+     P I     + G P V ++VT +FG L+++ 
Sbjct: 366 VILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIA 425

Query: 384 TSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAY 443
            S    + F+WLL ++G++  FTW  I L HIR  +AL  +  +  +L F A      + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSV 485

Query: 444 YGVFFMTLIIIIQGFTSFCPWNG----IDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRV 498
           Y +  + LI+I Q + +  P  G      F  AY+S  ++I  +I  + W +  +L  + 
Sbjct: 486 YSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKA 545

Query: 499 EDVDIDTDRRAV----------EEAVWIEQEP 520
            D+DID+ RR            EE  +I  +P
Sbjct: 546 SDIDIDSGRRETDIEALKQEIAEEKAFIASKP 577

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 257/529 (48%), Gaps = 23/529 (4%)

Query: 6   NQDSKMKEEIR---EISVEVEAET-VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAG 61
           N+ S++  ++    + +  V  +T +++ +K RH                  +  L   G
Sbjct: 66  NKHSEVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGG 125

Query: 62  PVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSW 120
           P   +I Y  ++ + Y + Q+ GEMA   P +  +F  ++  FVS  FG A  +++   W
Sbjct: 126 PAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQW 185

Query: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180
                LEL     +I++WT  V    ++ IF+V L  ++   VK YGE EF   L K++ 
Sbjct: 186 LTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILM 245

Query: 181 IMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 239
           I GF+I+   + CG AG  G +G +YW  PGAF     A      RF G    L++  F+
Sbjct: 246 IAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFS 300

Query: 240 FQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD-S 298
           + GTEL  ++  E  NPRK+ P A K+ +                 VP++D +L     S
Sbjct: 301 YGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGS 360

Query: 299 YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358
              ASP+++A    G  V+PHI NAVI+  +IS  NS++Y   R++  L+    AP  ++
Sbjct: 361 ATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMT 420

Query: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418
              + G P  A+L  ++FG +A+   S   ++ F WL  I G++  FTW  I LSH+RF 
Sbjct: 421 YVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFR 480

Query: 419 QALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFM 478
           QA++++G   +++ + A      + YGV F  L+ I Q + +  P        ++   ++
Sbjct: 481 QAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYL 540

Query: 479 FIAIWIAFQAWFRCRLIWR--------VEDVDIDTDRRAVEEAVWIEQE 519
              IWIAF   +   +IW         ++ +D+D  RR  +  V  +++
Sbjct: 541 AFPIWIAF---YFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQED 586

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  241 bits (614), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 152/516 (29%), Positives = 262/516 (50%), Gaps = 20/516 (3%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E   +++ +K+RH                  +  L +AGP G +I Y  M +  Y + Q+
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 83  LGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GE+A  +  + S+F ++    V  AFG A  ++Y   W     LEL      I++WT +
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200
           V    ++SIF+VL+  +N F  + Y E EF+    KV+ + GF I    + CG AG +G 
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YW  PGAF       ++    F G +++   AAF F  +E + +TA E +NPRK +
Sbjct: 293 IGAKYWHSPGAFN-----GNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDD-WKLTSTDSYVSASPFIIAIENSGTHVLPH 319
           P+A K ++                 VPY+  + L S      ASP+++A+ + G  V+PH
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPH 407

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S GNS  Y  SR++  L+    AP + +   + G P VA++ ++LF  +
Sbjct: 408 FINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTI 467

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           A+   S   ++ F WLL I+G++  FTW+ I +SH+RF +AL+++G S  ++ FK++   
Sbjct: 468 AFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGI 527

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRCRL 494
             + Y    + L +I Q + +  P   NG+D   F   Y+++ + + ++  ++   R   
Sbjct: 528 YGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWK 587

Query: 495 IW-RVEDVDIDTDRRAVEEAVW------IEQEPRGF 523
            W     +D+ + R+  +E +       IEQE +  
Sbjct: 588 FWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNL 623

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  238 bits (608), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 159/522 (30%), Positives = 252/522 (48%), Gaps = 25/522 (4%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           N ++   +E  ++S       V+R LK RH                     L   GP+  
Sbjct: 28  NVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLAL 87

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           L+ +  +  +A+SV +S+GEM T  P    FT  ++RF S A  A  GY Y   +    A
Sbjct: 88  LLGFSIIGIIAFSVMESIGEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLA 147

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
            E + +  ++QFW   VPL  +I IFW       +  V  +GE E+W+A +K+V ++ + 
Sbjct: 148 NEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYY 207

Query: 186 IYCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I+    + G     P  GF YW  PGA   G          F G     +  +  + GTE
Sbjct: 208 IFSIVYISGDIRNRPAFGFHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTE 257

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
            V + A E+ NP K VP A+++ +                 VP+DD  L+++ + V  SP
Sbjct: 258 SVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNLSAS-TKVLKSP 316

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
             IAI  +G     H+ NA I+ T ISA N ++Y+GSR +  L+   LAP IL+ T + G
Sbjct: 317 IAIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRG 376

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           VP  A+ V +  G ++ M  S G   A+++++N++GV  F  W  IS +H+R  +A   +
Sbjct: 377 VPIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQ 436

Query: 425 GISRDDLPFKA---KWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYI----SVF 477
           G S ++LP++A    W P L+     F+ L   IQG++ F P++  +F+ AYI     + 
Sbjct: 437 GRSIEELPYEALFYPWTPVLSLAANIFLAL---IQGWSYFVPFDAGNFVDAYILLPVGIL 493

Query: 478 MFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           ++I I +     FR      +  +++D  RR   EA   +QE
Sbjct: 494 LYIGICVFKSNHFRTV---DLRSINLDEGRRKDMEADLSDQE 532

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  239 bits (609), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 147/514 (28%), Positives = 251/514 (48%), Gaps = 17/514 (3%)

Query: 7   QDSKMKEEIREISVEVEA--ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           +D   KE   E +  +    + ++  +K RH                     L   GP G
Sbjct: 49  EDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGG 108

Query: 65  ALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
            LI YL  +T+ Y V Q+  E+   +  +  ++  +    V   FG A   +Y   W I 
Sbjct: 109 LLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIV 168

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMG 183
             LEL      I++WT +V    +++IF++ +  ++ F  + Y E EF    +KV+ + G
Sbjct: 169 LPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAG 228

Query: 184 FLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
           F+I    + CGA   G +G +YW +PG F     A +++     G  S  + +AF + G+
Sbjct: 229 FIIMGISLNCGASKLGYIGAKYWSNPGTF-----AGERSINHLKGICSVWVQSAFAYGGS 283

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPY--DDWKLTSTDSYVS 301
           E + +TA E ANPR++VP A K+ +                 VPY  D    +S  S   
Sbjct: 284 EFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASH 343

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASPF+IA    G  ++PHI NA+I+ ++IS GNS +Y   RI+  L+ + L P I +   
Sbjct: 344 ASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVD 403

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P   +L   +FG L+++  S   +  F WL  I G++  FTW  I+LSHIRF  A+
Sbjct: 404 RAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAM 463

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYIS 475
           +++G S  +L + +      +YY VFF  ++++ Q + +  P       +   F   Y++
Sbjct: 464 KVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLA 523

Query: 476 VFMFIAIWIAFQAWFR-CRLIWRVEDVDIDTDRR 508
             + +  ++ ++ W+R  +L+  V+ +D++T R+
Sbjct: 524 FAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQ 557

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  239 bits (611), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 153/516 (29%), Positives = 249/516 (48%), Gaps = 22/516 (4%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           +++ ++ RH                   + L  AGP   +I Y  M +  Y + Q+ GEM
Sbjct: 119 LQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEM 178

Query: 87  A-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA 145
           A  +  +  +F  +    V         ++Y   W     LEL      I +WT  V   
Sbjct: 179 AVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSD 238

Query: 146 AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM-VCGAGVTGPVGFR 204
            ++ IF+VL+T +N F  K Y E EF+    KV+ + GF I    +   GAG  G +G +
Sbjct: 239 VFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAK 298

Query: 205 YWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 264
           YW +PGAF       DK+  RF   +S+   AAF F  +E + I A E +NPR+ +P A 
Sbjct: 299 YWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAA 353

Query: 265 KKVVXXXXXXXXXXXXXXXXXVPYDDWKL--TSTDSYVSASPFIIAIENSGTHVLPHIFN 322
           K ++                 VPYD  +L  +   +   ASP++IA+ + G  V+PH  N
Sbjct: 354 KTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFIN 413

Query: 323 AVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYM 382
           AVI+ +++S  NS  Y   RI+Y L+    AP       + G P  A+LVT++FG +A+ 
Sbjct: 414 AVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFC 473

Query: 383 ETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK---WMP 439
             S   +  F WLL+I G++  FTW  I LSHIRF +A++++G S D++ FK++   W  
Sbjct: 474 SCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGS 533

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC-R 493
           G   Y    M L +I + + S  P      +  +F   Y+++ + I ++  ++ + +  +
Sbjct: 534 G---YAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWK 590

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           L  R +D+D+    R + +   + QE   + +K  N
Sbjct: 591 LFIRAKDIDL-ISHRTIFDGELVRQEEEEYKEKLRN 625

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  238 bits (606), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 258/506 (50%), Gaps = 14/506 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           + +T+++ +K RH                     L N GP   LI Y  ++T+ Y V QS
Sbjct: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142

Query: 83  LGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
             E+A  +  ++  F  +    V  AF  +  ++Y   W     LEL      I++W  +
Sbjct: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200
           +   A++ IF+V+L  +N      Y E EF+    KV+ ++GF I    + CG AG  G 
Sbjct: 203 INPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGY 262

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G  YW  PGAF       +    RF G V+ L+NAAF + G E   +TA E  NP+K++
Sbjct: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS-ASPFIIAIENSGTHVLPH 319
             A KK+V                 VPY+  +L  + S  + ASPF+IAI + G  V+PH
Sbjct: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
           I NAVI+ +++S  NS +Y  SRI+  LS    AP + +   + G P   +LV+ +FG L
Sbjct: 378 IINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
            ++  S   +  F WLL I+G++  FTW  ISLSH+RF +++ ++G S D+L +++    
Sbjct: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRC-R 493
             AYY +  + LI+I Q + +  P   N +D   F   Y+++ + I +++ ++ W+R  R
Sbjct: 498 WGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWR 557

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQE 519
           +I    +VD+ + R+  +  +   ++
Sbjct: 558 VIIPANEVDLVSHRKIFDAEIMQSEQ 583

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  237 bits (605), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/534 (28%), Positives = 262/534 (49%), Gaps = 23/534 (4%)

Query: 10  KMKEEIREISVEVEAET-------VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           +++ E+R  S   + E        +++ +K RH                  ++ L   GP
Sbjct: 47  RVEGEVRNSSDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGP 106

Query: 63  VGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
            G LI Y F++ ++Y + Q+ GEMA   P +  +F  +S  F+S  FG A  +++   W 
Sbjct: 107 GGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWT 166

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
               LEL     V+++WT  +    ++ IF++ +  ++    + YGE EF     KV+ +
Sbjct: 167 TILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMV 226

Query: 182 MGFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
            GF+I    + CGA G  G +G +YW  PGAF  G         RF G    L+ A F++
Sbjct: 227 AGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSY 281

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSY 299
            G EL  ++  E  NPRK +P A  K V                 VP+D  KL  S  S 
Sbjct: 282 GGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSG 341

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
           V  SP+++A+   G  ++PHI NAVI+ ++IS GNS +Y G R++  L+    AP IL  
Sbjct: 342 VHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDY 401

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             + G P +A+++ S+FG +A++  S   +  F WL  I+G++  FTW  I LSH RF +
Sbjct: 402 VDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRR 461

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW-NGIDF-LTAYISVF 477
           A++++G S + L +++      + Y V F   ++I Q + +  P  NG  F + +     
Sbjct: 462 AMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSC 521

Query: 478 MFIAIWIAFQAWFRC-----RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDK 526
           + + +W++    +        ++  +  + +D+ RR+ +  V ++QE   +  K
Sbjct: 522 LALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEV-MKQEDLEYKQK 574

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  237 bits (605), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 152/519 (29%), Positives = 255/519 (49%), Gaps = 20/519 (3%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +A  +++ +K RH                  ++ L   GP   +I Y+ ++ + Y + Q+
Sbjct: 71  DASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQA 130

Query: 83  LGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
            GEMA   P +  +F  ++  F+S  FG A  ++++  W   F LEL      I++W   
Sbjct: 131 AGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDK 190

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200
           +    +I IF+V L  ++ F VK YGE EF     KV+ I GF+I    + CG AG  G 
Sbjct: 191 INADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGY 250

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G +YWR PG+F  G      +  +F G    L+ A F++ G EL  ++  E  NPRK+ 
Sbjct: 251 IGAKYWRDPGSFAEG-----DSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKST 305

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIAIENSGTHVLPH 319
           P+A K+ +                 VP+++ +L  S  S   ASP+++A    G  V+PH
Sbjct: 306 PQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPH 365

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ ++IS  NS +Y   R+M  L+    AP  L    + G P  A+++ ++FG +
Sbjct: 366 FINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVI 425

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
            ++  S+  ++ F WL  I G++  FTW  I LSH+RF Q +++ G S +++ F+A    
Sbjct: 426 GFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGI 485

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWR 497
             + YG+ F  L+ I Q + +  P   +G     ++   ++   IW+ F  +F   L  R
Sbjct: 486 WGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFF--YFGYMLYKR 543

Query: 498 -------VEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
                  ++ +D++  RR  +  + I QE     +K  N
Sbjct: 544 DFTFLVPLDKIDLNFHRRIYDPEL-IRQEDEENKEKIKN 581

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  236 bits (603), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 152/544 (27%), Positives = 263/544 (48%), Gaps = 25/544 (4%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
            +D   +  I  +  E  +  ++R LK RH                     L   GP   
Sbjct: 38  QEDDLERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPL 97

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIPV--TSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
           LI+Y+ M+   +++   L EM    P+   +S    ++ +++       G+  +++  + 
Sbjct: 98  LISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMI 157

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMG 183
              E++    +IQ+WT A   A ++SIF V+   +   PVK +GE EFWV+++K++ I G
Sbjct: 158 APSEITASTLLIQYWTDANS-AIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITG 216

Query: 184 FLIYCFCMVCGAGVTGP--VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF- 240
            +I    +  G G      +GF YW+HPGAF P I     N  +FL   +++I + F F 
Sbjct: 217 LIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHI--STGNTGKFLAVWTAIIKSGFAFI 274

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST---- 296
              E +   + EA  PR+ +PRA  + V                 V YD+  L S     
Sbjct: 275 LSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASG 334

Query: 297 DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356
            S  +ASPF+I I+  G  VLPHI NA I+    SAG + +Y  SR+++ ++    AP I
Sbjct: 335 QSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKI 394

Query: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416
            +R  ++GVP+ +++V S F  LAY+  S    + F WL NI+ ++GF +W+F+S++++R
Sbjct: 395 FARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVR 454

Query: 417 FMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYI 474
           F + ++   ++ D + F+  +    AY+   F  ++ +  G+  F    W+  DF   YI
Sbjct: 455 FRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYI 513

Query: 475 SVFMFIAIWIAFQAWFRCRLIWRVEDVD-------IDTDRRAVEEAVWIEQEPRGFWDKF 527
           ++   + ++I   A+++    WR  D++          D    EE+  I  EP  ++ K 
Sbjct: 514 TIGFVVVLFIMGTAYYKE---WRFRDMEEIRSELIPKIDMADEEESNEIVIEPTTWYGKL 570

Query: 528 WNVV 531
            NV+
Sbjct: 571 GNVL 574

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  239 bits (609), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 154/500 (30%), Positives = 258/500 (51%), Gaps = 15/500 (3%)

Query: 19  SVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYS 78
            +E +++ +++ +K RH                 + + L+ AGP G L+ +  M T  Y 
Sbjct: 141 KIENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYC 200

Query: 79  VTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQF 137
           + Q++GEMA  +  +   F  +    V PAFG +  ++Y   W     LEL      I++
Sbjct: 201 IIQAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKY 260

Query: 138 WTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAG 196
           WT  V    ++ IF+VL+  +N+      Y E EF     K++ ++GF I    ++CG  
Sbjct: 261 WTTKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGA 320

Query: 197 VT-GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAAN 255
              G +G +YW  PGAF  G  A D    RF G +++L+NAAF F  +E +G+TA E +N
Sbjct: 321 GNDGYIGGKYWHEPGAF-RGEHAID----RFKGVMATLVNAAFAFGMSEFIGVTASEQSN 375

Query: 256 PRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGT 314
           PRK +P A KK++                 VPYD D  L S+   V ASP+++A+   G 
Sbjct: 376 PRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGV 435

Query: 315 HVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTS 374
            V+PH  NAVI+ +++S  NS  Y  SR++  L+    AP I     + G P V + + S
Sbjct: 436 KVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMAS 495

Query: 375 LFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFK 434
           LFG +A+  TS    + F WLL I+G++  FTW+ I +SH+RF +A+ ++G S  +L F+
Sbjct: 496 LFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFR 555

Query: 435 AKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAW 489
           ++     + Y    M  I+I Q + +  P      +  +F   Y+++ + +A++  ++ +
Sbjct: 556 SQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIY 615

Query: 490 FRCRLIW-RVEDVDIDTDRR 508
            +   I+ R +D+D+ + R 
Sbjct: 616 TKNWTIFIRAKDIDLVSHRN 635

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  237 bits (604), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 250/529 (47%), Gaps = 22/529 (4%)

Query: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVG 64
           H+  S    E         +  ++R +K RH                     L   GP G
Sbjct: 61  HSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAG 120

Query: 65  ALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCIT 123
            +I Y  ++ +AY + Q+ GEMA   P +  +F  +S + +S  FG A  ++Y   W   
Sbjct: 121 LIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTV 180

Query: 124 FALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMG 183
             LEL      I++W  ++    +I+IF+V +  ++ F  + YGE EF   + KV+ I+G
Sbjct: 181 LPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIG 240

Query: 184 FLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQG 242
           F+I    + CG AG    +G +YW  PGAF  G         +F G    L+   F++ G
Sbjct: 241 FVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGG 295

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL--TSTDSYV 300
           TEL  +T  E +NPR+ +    K+ +                 VP+   +L  +S  S  
Sbjct: 296 TELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSAT 355

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
            ASP+++A+   G  ++PHI NAVI+  +IS GNS +Y G RI+  L+    AP  L+  
Sbjct: 356 HASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYV 415

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P VA++  S+FG LA++  S   +  F WL  I G++  FTW  I LSH+RF QA
Sbjct: 416 DRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQA 475

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW------NGIDFLTAYI 474
           +        +L +KA      +  G+ F  L+ I Q + S  P+      + + F  +Y+
Sbjct: 476 MRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYL 535

Query: 475 S----VFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           +    V +F    I F+ W    +I  ++D+D+D  R   ++    +++
Sbjct: 536 AFPLWVVLFFGYMIVFRNW---EIIKPLKDIDLDHYRSIYDQDRLYQED 581

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  236 bits (602), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 159/503 (31%), Positives = 256/503 (50%), Gaps = 23/503 (4%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           E + R L  RH                  +  L   GP   LI Y+ M  + Y    SLG
Sbjct: 60  ERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVIYLTMLSLG 119

Query: 85  EMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW---TFA 141
           EM+TF+P++ S+  +S++FVS ++  A     W+S  ++ A +L+ +  V+ +W   T  
Sbjct: 120 EMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLDYWKTNTHH 179

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP- 200
            P  A   +FW L+ G+N+  VK YGE E+W+A++KVVA++ F I      CG       
Sbjct: 180 FPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANCGHNQQHEY 239

Query: 201 VGFRYWRHPGA-FGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
           +GF+ W H  A F  G          F G+V+  + ++F++ GTE V +T GEA NP + 
Sbjct: 240 IGFKNWSHGDAPFVQG----------FKGFVTIFVTSSFSYGGTETVTLTGGEAKNPVRN 289

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
            P+ IK V                  +PYD   L +    V  SPF I  + +GT     
Sbjct: 290 TPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS--VLTSPFTIVFQMAGTKAAGS 347

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAP--GILSRTTQHGVPWVAVLVTSLFG 377
             NAVI+ + ISA N  ++ GSRI+Y +      P     ++T ++  P+VAV+ T   G
Sbjct: 348 FMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAVITTWAVG 407

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            L +  +  G  + F+WL NI GV+   +WL I++  IRF + LE +G    +L F+   
Sbjct: 408 GLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHELKFRNWT 466

Query: 438 MPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWR 497
            P   ++ + F++LII++QG+++F PW+   F + Y+ + +F A WI +    R R   +
Sbjct: 467 YPYGPWFCIIFISLIILVQGWSAFDPWSTSSFFSFYLELIVFPACWIFWWVIKRDRFK-K 525

Query: 498 VEDVDIDTDR--RAVEEAVWIEQ 518
            +D+D  TD+  ++ EE++  E+
Sbjct: 526 AKDMDFITDKYVQSEEESLLNER 548

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  238 bits (606), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 148/501 (29%), Positives = 253/501 (50%), Gaps = 15/501 (2%)

Query: 24  AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSL 83
            + +++ ++ RH                     L  AGP G +I Y  M +L Y + Q+ 
Sbjct: 113 GDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQAC 172

Query: 84  GEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           GEMA  ++ +   F  +    + P F  A  ++Y   W     LEL      I++WT  V
Sbjct: 173 GEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKV 232

Query: 143 PLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT-GP 200
               ++ IF+V + G+N+    + Y E EF     K++ ++GF I    ++CG   T G 
Sbjct: 233 DPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGY 292

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G RYW  PGAF       ++   RF G V++L+ AAF+F  +E + +TA E +NPR+ +
Sbjct: 293 IGGRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAI 347

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFIIAIENSGTHVLPH 319
           P A KK++                 VPY+  +L    S  + ASP+++A+ N G  V+PH
Sbjct: 348 PSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPH 407

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S  NS  Y   R++  LS    AP I S   + G P + ++V SLF  +
Sbjct: 408 FINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVI 467

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           A+  TS    + F WLL ++G++  FTW+ I LSH+RF +A+ ++G S  +  F ++   
Sbjct: 468 AFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGI 527

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAIWIAFQAWFRC-R 493
             + Y  F + LI++ Q + +  P      +   F   Y++  ++IA++I ++ + +  R
Sbjct: 528 YGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWR 587

Query: 494 LIWRVEDVDIDTDRRAVEEAV 514
           L  + +D+D+   R+  +E +
Sbjct: 588 LYIKSQDIDLVAHRQIYDEDI 608

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  235 bits (600), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 149/524 (28%), Positives = 257/524 (49%), Gaps = 17/524 (3%)

Query: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGA 65
           + DS +++  +  S+  + + +++ +K RH                     L  AGP   
Sbjct: 59  HADSDLEDGSK--SITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPL 116

Query: 66  LIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124
           ++ Y  ++ + Y + Q+ GEMA   P + +SF  ++  FVS  FG A  +++   W    
Sbjct: 117 VLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVL 176

Query: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184
            LEL      I++W   +    +I IF+V L  ++ F VK YGE EF     K++ I GF
Sbjct: 177 PLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGF 236

Query: 185 LIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
           +I    + CG AG  G +G +YW +PGAF     A +   ARF G    L+   F++ GT
Sbjct: 237 IILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGT 291

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSA 302
           EL  ++  E  NPRK+ P A K+ +                 VP+D D  + +  S   A
Sbjct: 292 ELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHA 351

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SP+++A    G  V+PH  NAVI+ +++S  NS +Y   R+M  L+    AP   +   +
Sbjct: 352 SPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDR 411

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G P  A+ +  LFG + ++  S   ++AF WL  I G++  FTW  I +SHIRF  A++
Sbjct: 412 EGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMK 471

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYISV 476
           ++G S ++L ++A      + Y VFF  L+ I Q + +  P      ++   F  +Y++ 
Sbjct: 472 VQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAA 531

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
            +++  +  +  + R    +  ++ +D+D  RR  +  +  +++
Sbjct: 532 PLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQED 575

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  234 bits (598), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 249/507 (49%), Gaps = 35/507 (6%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           + + ++R LK RH                     L   GP+  LI +    T        
Sbjct: 64  DPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHG 123

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +S RF+ P+       +Y   W     LE+      ++FWT +V
Sbjct: 124 LGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSV 183

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W+++F+ L+  +N+F V+++G+ +F  +++K+V I GF+I C  ++ G G T   +
Sbjct: 184 DPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFI 243

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G RYW  PGA   G          F G  + ++ A+++  G+E+  + +GE  +P K +P
Sbjct: 244 GARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEIP 291

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK++                  VPY + +L    S V+ SPF+IAI+     VLPHI 
Sbjct: 292 HAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG-GSNVNNSPFVIAIKMHNIRVLPHII 350

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           N VI+ +I+S GNS I+  SR +  ++   L P I     + G P   +L  SLFG LA+
Sbjct: 351 NGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAF 410

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPF-KAKWMPG 440
           +  S+     F WL+ + G+A    WL I++SHIRF  A++ +G S D+L F  A  M G
Sbjct: 411 LVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWG 470

Query: 441 LAYYGVFFMTLIIIIQGFTSFCPWNG------------IDFLTAYISVFMFIAIWIAFQA 488
             Y GV    ++++ Q + S  P  G             ++L A I +FMF+A  I +++
Sbjct: 471 SVYSGV-MNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRS 529

Query: 489 ----WFRCRLIWRVEDVDIDTDRRAVE 511
               W++   I  + ++D+++ R+ ++
Sbjct: 530 TTGQWWK---ILPLAEIDLESGRKNID 553

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  233 bits (595), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 155/489 (31%), Positives = 251/489 (51%), Gaps = 20/489 (4%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           E + R LK R                   S  L   GP    + Y  M  + Y    +LG
Sbjct: 48  EDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTLLALG 107

Query: 85  EMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT---FA 141
           EM+T++P++ SF V++++F S +F  A  + YWF+  ++ A +L+ +  V+ +W      
Sbjct: 108 EMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYWKTSEHG 167

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP- 200
            P  A   IFW ++  +N+  V++YGE E+W+A++K++AI+ F I    +  G       
Sbjct: 168 FPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSIVVNVGKNPQHEY 227

Query: 201 VGFRYW-RHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
           +GF+ W R    F  GI           G+ S  ++A+F + GTE + +T GEA NP + 
Sbjct: 228 IGFKNWTRGEAPFVDGI----------KGFASLFVSASFAYGGTESITLTNGEAENPIRN 277

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
            P+ +K V                  +PYD   L S    +  SPF +  + +GT     
Sbjct: 278 TPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--IVTSPFTLVFQMAGTKGAGS 335

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPG-ILSRTTQHGVPWVAVLVTSLFGA 378
             NAVI+ ++ISA N  ++ GSRIMY +      P  I+SRT ++ VP+V+VL+T+  GA
Sbjct: 336 FMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGA 395

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           L +  +  G    + WL NI GV+    WL I ++ IRF + LE +G +  +L +K    
Sbjct: 396 LCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELIYKNWTY 454

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRV 498
           P   Y+ + F++ II+IQG+++F PWN  +F + Y+ +F+F   +I +    R R + + 
Sbjct: 455 PYGPYFVIIFVSFIILIQGWSAFAPWNVSNFFSYYLELFVFPVCFIIWWLVKRDRFV-KY 513

Query: 499 EDVDIDTDR 507
           ED+D  TDR
Sbjct: 514 EDMDFTTDR 522

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  234 bits (598), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 153/512 (29%), Positives = 246/512 (48%), Gaps = 30/512 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
               ++R LK RH                     L + GP+  +I +    T        
Sbjct: 81  HTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHG 140

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +S RF+ P+       +Y   W     LE+      IQ+W  ++
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSI 200

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+ ++  +N+F  + +GE EF  + +KV+ I+GF+I C  ++CG G     V
Sbjct: 201 DPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFV 260

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G RYW  PG    G          F G +S L+ A+++  GTE+V + +GE  NPR+ +P
Sbjct: 261 GARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LP 308

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+                   VPY +  L    S V+ SPF+IAI+      LP I 
Sbjct: 309 SAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFVIAIKLHHIKALPSIV 367

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +I+S GNS I+  SR +  ++   L P       + G P   +L  SLFG LA+
Sbjct: 368 NAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAF 427

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPF-KAKWMPG 440
           +  S+   + F+WL+ I G+A    WL I++SHIRF  A++ +G S D+L F  A  M G
Sbjct: 428 LVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWG 487

Query: 441 LAYYGVFFMTLIIIIQGFTSFCPWNG--------IDFLTAYISVFMFIAIWIAFQAWFRC 492
            A Y     +LI+I Q + +  P  G          F  +Y+   +   +++  + ++R 
Sbjct: 488 SA-YSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRY 546

Query: 493 RL-----IWRVEDVDIDTDRRAVEEAVWIEQE 519
           +      I  ++ +D++TDR+ ++  V ++QE
Sbjct: 547 KTGKWWAIMDLDKIDLETDRKNIDIDV-LKQE 577

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  234 bits (596), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/557 (27%), Positives = 265/557 (47%), Gaps = 37/557 (6%)

Query: 5   HNQDSKMKEEIREISVEVE------------AETVRRELKQRHXXXXXXXXXXXXXXXXX 52
           H+ + K    I  +  ++E            +  V R LK RH                 
Sbjct: 30  HSTNQKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIG 89

Query: 53  VSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVT--SSFTVFSQRFVSPAFGA 110
             T L + GP   LI+Y  M+   +++   + EM   IP++  SS    +  +++     
Sbjct: 90  SGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSF 149

Query: 111 ANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFE 170
             G+  +++  +    E++    +I++WT A   A +++IF +L T +++ PVK +GE E
Sbjct: 150 MCGWNCFYAMSMVVPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFGESE 208

Query: 171 FWVALVKVVAIMGFLIYCFCMVCGAGVTGP--VGFRYWRHPGAFGPGIIAKDKNQARFLG 228
           F V+++K++ I+G ++    +  G G      +GF YW  PGAF   ++    +   FL 
Sbjct: 209 FCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLV--KGSTGAFLA 266

Query: 229 WVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVP 287
              ++I + F F    E+    + EAA PRK +PRA ++ V                 V 
Sbjct: 267 VWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVG 326

Query: 288 YDDWKL----TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRI 343
           YD+  L    +S  +  +ASPF+I I+ +G  +LPHI NA I+ +  S   S +Y  SR+
Sbjct: 327 YDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRV 386

Query: 344 MYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAG 403
           ++ L+    AP   S+  ++GVP+ +V  TSLFG LAY+  S      FNWL NI  ++G
Sbjct: 387 LHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISG 446

Query: 404 FFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP 463
           F  W+F+S++++RF +  +   I+ D +P++ +    LAY    F  L+ I  GF  F  
Sbjct: 447 FVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIA 505

Query: 464 --WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDI-------DTDRRAVEEAV 514
             WN  DF T Y+++     ++I    +++    W   D+D+         D+   EE  
Sbjct: 506 GNWNVSDFFTCYVTIGFVGVLFIGSSIYYK---EWTFRDMDVVGREIMPKIDQADQEEKE 562

Query: 515 WIEQEPRGFWDKFWNVV 531
                P+ + ++ W +V
Sbjct: 563 EYLPPPKNWVERVWRIV 579

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  235 bits (600), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 152/507 (29%), Positives = 250/507 (49%), Gaps = 14/507 (2%)

Query: 11  MKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYL 70
           +KE    I+ + E   +R+ ++ RH                   + L  AGP G +I Y 
Sbjct: 111 IKEHDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYA 170

Query: 71  FMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129
            M T  Y + Q+ GEMA ++  +  +F  +    V   FG A  ++Y   W     LEL 
Sbjct: 171 IMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELV 230

Query: 130 VVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCF 189
                I +WT  V    ++ IF+VL+  +N+F  K Y E +F+    KV+ I GF I   
Sbjct: 231 TASMTIDYWTTKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAI 290

Query: 190 CM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGI 248
            +   GAG +G +G +YW  PGAF       D++  RF   +++   AAF F  +E + I
Sbjct: 291 IINAGGAGTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAI 345

Query: 249 TAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY-VSASPFII 307
            A E +NPR+ +P A K ++                 VPYD  +L  + S    ASP+++
Sbjct: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVL 405

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPW 367
           AI + G  V+PH  NAVI+  ++S  NS  Y   RI++ LS    AP   +   + G P 
Sbjct: 406 AISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPA 465

Query: 368 VAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGIS 427
            A++++ LFG +A+   S+  ++ F WLL I+G++  FTW+ I LSHIRF +A+ ++G S
Sbjct: 466 RAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRS 525

Query: 428 RDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-----WNGIDFLTAYISVFMFIAI 482
             +L F+++     + Y    + L +I + + S  P      +   F   Y+++ + I  
Sbjct: 526 ISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585

Query: 483 WIAFQAWFRC-RLIWRVEDVDIDTDRR 508
           +  ++ + R  +L  R +++D+ T R 
Sbjct: 586 YFGYKIYNRDWKLFIRAKNIDLITHRN 612

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  235 bits (599), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 156/546 (28%), Positives = 264/546 (48%), Gaps = 26/546 (4%)

Query: 4   GHNQDSKMKEEIREISVEVEAET---------VRRELKQRHXXXXXXXXXXXXXXXXXVS 54
           G+N  SK K    E S+++E            +++ +K RH                  +
Sbjct: 83  GNNGGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANA 142

Query: 55  TPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANG 113
             L   GP   +I Y+ ++ + Y + Q+ GEMA T+  +  +F  +S  FVS AFG A  
Sbjct: 143 KGLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATV 202

Query: 114 YMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFW 172
           +++   W     LEL      I++W   +    +I IF+V L  +++F  V  YGE EF 
Sbjct: 203 WIFCIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFL 262

Query: 173 VALVKVVAIMGFLIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVS 231
             L K++ ++GF+I    +   GAG    +G ++W  PGAF     A     +RF G   
Sbjct: 263 FNLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAF-----AGKTAGSRFKGICY 317

Query: 232 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-D 290
            L++  F++ GTEL  ++  E +NPR++ P+A K  +                 VPYD D
Sbjct: 318 VLVSGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSD 377

Query: 291 WKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTS 350
             + S  S   ASP+++A   +G  + PH  NAVI+ ++IS  NS++Y   R+M  L+  
Sbjct: 378 ELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQ 437

Query: 351 RLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFI 410
             AP  L    + G P +A++   L G + ++  S   ++ F WL  I G++  FTW  I
Sbjct: 438 GYAPKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSI 497

Query: 411 SLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW------ 464
            LSH+RF  A++++  S ++L +KA      + YGV F  L+   Q +T+  P+      
Sbjct: 498 MLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKA 557

Query: 465 NGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGF 523
           N   F   Y+++ +++  +  +  W R  +L+  ++ +D+D  RR + +   + QE    
Sbjct: 558 NANSFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRR-IYDPELMRQEDEES 616

Query: 524 WDKFWN 529
            ++  N
Sbjct: 617 KERLRN 622

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  233 bits (595), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 156/503 (31%), Positives = 255/503 (50%), Gaps = 22/503 (4%)

Query: 13  EEIREISVEVEA---ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAY 69
           E I   S + E+   E ++R+L  RH                  S  L   GP    + Y
Sbjct: 51  ESIESASFDPESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNY 110

Query: 70  LFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129
                + Y     LGEM+T++P++ SF  ++++F S +F  A  + YWF+  ++ A +L+
Sbjct: 111 SIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLT 170

Query: 130 VVGQVIQFWT---FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
            +  V+ +W       P  A   +FWV +  +N+  V+ YGE E+W+AL+KV+AI+ F I
Sbjct: 171 ALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFI 230

Query: 187 YCFCMVCGAGVTGP-VGFRYWRHPGA-FGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
               +  G       +GF  W H  A F  G          F G+ S  ++A+F + GTE
Sbjct: 231 LSIVVNVGHNPEHKYIGFHNWNHGDAPFVNG----------FKGFASLFVSASFAYGGTE 280

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASP 304
            + +T GEA NP +  P+ IK V                  VPYD   L +    V  SP
Sbjct: 281 SITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS--VMTSP 338

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           F I  + +G+       NAVI+ ++ISA N  ++ GSR+MY +S     P  +++T ++ 
Sbjct: 339 FTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYK 398

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
            P+VAV +T   G L +  +  G    + WL NI GV+    WL I+++ IRF + LE++
Sbjct: 399 APYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQ 458

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWI 484
           G +  +L FK    P   Y+ V F++ +I+IQG+++F PW+  +F + Y+ +F+F A ++
Sbjct: 459 GKTH-ELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDPWSTSNFFSVYLELFVFPACYL 517

Query: 485 AFQAWFRCRLIWRVEDVDIDTDR 507
            +  + R + I + ED+D  TD+
Sbjct: 518 IWWLYKRDKFI-KYEDMDFVTDK 539

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  232 bits (592), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 144/478 (30%), Positives = 238/478 (49%), Gaps = 24/478 (5%)

Query: 9   SKMKEEIREISVE-VEAET---------VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLM 58
            K++ +I E+ ++ +E ++         V+R LK RH                     L 
Sbjct: 14  DKLEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALN 73

Query: 59  NAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWF 118
             GP+  L+ +  +  + +S+ +S+GE+ T  P    F   ++RF S    A +GY Y  
Sbjct: 74  KGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIV 133

Query: 119 SWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKV 178
            +    A E + +  ++QFW   VP+  +  IFW       +  V  +GE E+W+A  K+
Sbjct: 134 VFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKI 193

Query: 179 VAIMGFLIYCFCMVCGAGVTG--PVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236
           + ++ F I+    + G G+ G  P+GF+YW++PGA   G          F G     +  
Sbjct: 194 LGLVAFYIFSIVYMSG-GIPGKPPIGFQYWKNPGALSHG----------FRGIAVVFVFC 242

Query: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTST 296
           +  + GTE V + A E+ NPRK VP A+++                   VPY+D  L + 
Sbjct: 243 STFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQ 302

Query: 297 DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356
              +  SP  IA+  +G     H+ NA I+ T ISA NS++Y+GSR +  L+   LAP I
Sbjct: 303 TKSLK-SPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRI 361

Query: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416
           L+ T + GVP  A++V +  G ++ M  S G   A+N+++N++GV  F  W  IS++H+R
Sbjct: 362 LAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLR 421

Query: 417 FMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYI 474
           F +A   +G S  +LP++A + P    + +     + +IQG+TS  P+   DF+ AYI
Sbjct: 422 FRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVPFVAKDFVDAYI 479

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  234 bits (598), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 271/525 (51%), Gaps = 16/525 (3%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
           E R+++   E++ +++ +K RH                  S+ L  AGP   +I Y  M 
Sbjct: 110 EHRKVN-NTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMG 168

Query: 74  TLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132
           +  Y + Q+ GEMA  +  +   F  +    + PA G +  ++Y   W     LEL    
Sbjct: 169 SCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTAS 228

Query: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192
             I++WT  V    ++ IF+VL+  +N+F  + Y E EF+  + KV+ ++GF I    + 
Sbjct: 229 LTIKYWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIIT 288

Query: 193 CG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251
            G AG  G +G +YW  PGAF  G  A D    RF G + + + AAF F  TE + +TA 
Sbjct: 289 AGGAGNDGYLGAKYWHEPGAF-RGEHAVD----RFKGVMDTFVAAAFAFGATEFIALTAA 343

Query: 252 EAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIE 310
           E +NPRK +P A KKV+                 VPYD D  L S+ S V ASP+++A+ 
Sbjct: 344 EQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVS 403

Query: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370
             G  V+PH  NAVI+ +++S GNS  Y  SR++  LS    AP       + G P  A+
Sbjct: 404 LHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAM 463

Query: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430
           L+++LFG +A+  TS      FNWLL I+G++  FTW  I +SH+RF  A++++G S  +
Sbjct: 464 LMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGE 523

Query: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN-----GIDFLTAYISVFMFIAIWIA 485
           + F ++     + Y    M L ++ Q + +  P N       +F  +Y+++ + IA++  
Sbjct: 524 VGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFG 583

Query: 486 FQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++ ++R  +L  + + +D+ + R+  +E + ++QE   + +K  N
Sbjct: 584 YKLYYRDWKLYIKADKIDLISHRQIFDENI-LKQEDEEYKEKLRN 627

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  233 bits (594), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 155/513 (30%), Positives = 248/513 (48%), Gaps = 28/513 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
            ++ ++R+LK RH                     L   GP+  +I +    +        
Sbjct: 66  HSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHG 125

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +S R + P+       +Y   W     +EL      +QFWT  V
Sbjct: 126 LGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKV 185

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+V++  +N+F VK +GE EF  +LVKV+ I+GF+I    ++CG G     +
Sbjct: 186 DPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFI 245

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G  YW HPGA   G          F G  S  + A+++  G+E+V + + E  +P K +P
Sbjct: 246 GTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAET-DP-KELP 293

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V+ SPF+IAI+ SG  VLP I 
Sbjct: 294 HAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVLPSII 352

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +I+S GNS I+  SR +  ++   L P +     + G P V ++V SLFG LA+
Sbjct: 353 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAF 412

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S      F+WL+ I G+A    WL I++SHIRF  A++ +  S D+L FK+      
Sbjct: 413 LVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYG 472

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNG--------IDFLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI+I Q + S  P  G          F   Y+   + + +++  + +F+C 
Sbjct: 473 SIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCS 532

Query: 494 L-----IWRVEDVDIDTDRRAVEEAVWIEQEPR 521
                    + ++D++TDR+ ++  + ++QE R
Sbjct: 533 TGKWFDFKPLAEIDLETDRKNIDIEI-VKQEVR 564

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  233 bits (594), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/511 (27%), Positives = 242/511 (47%), Gaps = 28/511 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++R LK RH                     +   GP+G ++ +    +        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHG 133

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +  RF+ P+       +Y   W     LE+      +Q+W  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+ ++  +N+F  + +GE EF  + VK + + GF+I C  ++CG G     +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFI 253

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PG    G          F G +S L+ A+++  G E+  + +GE  +P K +P
Sbjct: 254 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IAI+     VLP I 
Sbjct: 302 SAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLPSIV 360

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +++S GNS I+  SR +  ++   L P       + G P V ++  SLFG LA+
Sbjct: 361 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S    + FNWL+ I G+A    WL I+LSH+RF  A++ +G S D+L F +      
Sbjct: 421 LVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWG 480

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNGID--------FLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI+I Q + S  P  G          F   Y+   + + I++  + ++RC+
Sbjct: 481 SVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYRCQ 540

Query: 494 L-----IWRVEDVDIDTDRRAVEEAVWIEQE 519
           +     +  ++D+D++TDR+ ++  + ++QE
Sbjct: 541 MGKWWGVKELKDIDLETDRKDIDIEI-VKQE 570

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  233 bits (593), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/542 (27%), Positives = 261/542 (48%), Gaps = 28/542 (5%)

Query: 8   DSKMKEEIREISVEVEA--------ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMN 59
           DS  + E+    +++E         + +++ +K RH                  +  L  
Sbjct: 50  DSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYL 109

Query: 60  AGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWF 118
           AGP   +I Y  ++ + Y V Q+ GEMA   P +   F  ++  FVS  FG A  +++  
Sbjct: 110 AGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCI 169

Query: 119 SWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKV 178
            W     LEL      I++W   +    ++ I +V L  ++ F V+ YGE EF     K+
Sbjct: 170 QWLTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKI 229

Query: 179 VAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAA 237
           + I GF+I    + CG AGV G +G +YWR PGAF     A D   +RF G    L+ A 
Sbjct: 230 LMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAY 284

Query: 238 FTFQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTST 296
           F++ G EL  ++  E  NPR++ P A K+ +                 VP++ D  + + 
Sbjct: 285 FSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAG 344

Query: 297 DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356
            S   ASP+++A+   G  V+PHI NAVI+ ++ S  NS +Y   R++  L+    AP  
Sbjct: 345 GSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKY 404

Query: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416
            +   + G P  A+++ S+FG +A+   S   +  F WL  I G++  FTW  I LSH+R
Sbjct: 405 FNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVR 464

Query: 417 FMQALEMRGISRDDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTSFCP------WNGID 468
           F  A++ +G S ++L + +  + G+  + YG FF  L+ I Q + +  P      ++   
Sbjct: 465 FRLAMKAQGKSLNELGYIS--ITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEA 522

Query: 469 FLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKF 527
           F  +Y++  +++  ++ +  + R    +  ++ +D+D  RR  +  + + QE     ++ 
Sbjct: 523 FFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPEL-LRQEDEETKERI 581

Query: 528 WN 529
            N
Sbjct: 582 RN 583

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  232 bits (591), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 151/529 (28%), Positives = 255/529 (48%), Gaps = 28/529 (5%)

Query: 13  EEIREISVEVEAETVR------------RELKQRHXXXXXXXXXXXXXXXXXVSTPLMNA 60
           + IRE  +E   ETVR            + +K RH                     L   
Sbjct: 50  QTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFG 109

Query: 61  GPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFS 119
           GP G +I Y+  +T+ Y V Q+  E+  ++  +  ++  +    V   F  A  ++Y   
Sbjct: 110 GPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQ 169

Query: 120 WCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVV 179
           W I   LEL      I++W  ++    +++IF+  +  ++ F  + Y E EF     KV+
Sbjct: 170 WAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVL 229

Query: 180 AIMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 239
            ++GF+I    + CGA  +G +G +YW  PGAF       +K    F G  S  + +AF 
Sbjct: 230 MMVGFIIMGISVNCGASKSGYIGGKYWHTPGAF-----VGEKAIDHFKGICSVWVQSAFA 284

Query: 240 FQGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY 299
           + G+E + +TA E  NPRK+VP+A K+ +                 VPYD   L  +   
Sbjct: 285 YGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQ 344

Query: 300 VS--ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 357
            +  ASPF+IA  + G  V+PHI NAVI+ ++IS GNS  Y   RI+  L+   + P + 
Sbjct: 345 AASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVF 404

Query: 358 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 417
           +   + G P V +L  ++FG ++++  S   +  F WL  I  ++  FTW  ISLSHIRF
Sbjct: 405 TYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRF 464

Query: 418 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNG-----IDFLT 471
             A++ +G S  +L +KA      ++Y + F  +++  Q + +  P  NG      +F  
Sbjct: 465 RDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQ 524

Query: 472 AYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
            Y++  + +  +  ++ W+R  +L    + VD+++ R+ + +A  I+QE
Sbjct: 525 NYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLESHRK-IFDADLIKQE 572

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  231 bits (589), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 147/553 (26%), Positives = 264/553 (47%), Gaps = 32/553 (5%)

Query: 4   GHNQDSKMKE----------EIREISVEV---EAETVRRELKQRHXXXXXXXXXXXXXXX 50
           GH+ DS   E          ++ + S+E+   +   V R+LK RH               
Sbjct: 31  GHSADSWNNEKSAYQVDQIIDVEDASMELIEGQEHQVARKLKSRHIQLIALGGAIGTGLF 90

Query: 51  XXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQR--FVSPAF 108
                 L   GP   LI+Y+ M+   + +   L EM   +P++   ++F+    +++   
Sbjct: 91  IGSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPL 150

Query: 109 GAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGE 168
               G   +++  +    E++    +IQ+WT A   A +ISIF V+   + M PV ++GE
Sbjct: 151 SFMCGINLFYAMSMIAPSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGE 209

Query: 169 FEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP--VGFRYWRHPGAFGPGIIAKDKNQARF 226
            EFWV+++K+  I G +I    +  G        +GF YW+HPGAF P ++    N  +F
Sbjct: 210 SEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPG--NTGKF 267

Query: 227 LGWVSSLINAAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXX 285
           L   +++I + F++    E+V   A EA +PR+ +PR  ++ V                 
Sbjct: 268 LACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIM 327

Query: 286 VPYDDWKLTST----DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGS 341
           V YD+ +L +     +S  +ASPF+I I+  G  VLPHI NA I+ +  S G S +Y  S
Sbjct: 328 VGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGAS 387

Query: 342 RIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGV 401
           R+++ ++ +   P I + T + G P+ +    S+F  LAY+  S      F WL NI  +
Sbjct: 388 RVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATI 447

Query: 402 AGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF 461
           +GF  W+ + + ++RF + +E   ++ D +PF+ ++M  LAY    F  ++ +  G+  F
Sbjct: 448 SGFVDWMLVCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVF 506

Query: 462 CP--WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAV----EEAVW 515
               WN  DF   Y ++ +   ++I    +++   +  +++V  +   +      EE   
Sbjct: 507 VADNWNVSDFFACYTTLGLAAVLYIGAAIYYKTIKLRDLDEVAAEIIPKIAMADEEEKGE 566

Query: 516 IEQEPRGFWDKFW 528
           +   P+ + +K W
Sbjct: 567 VPIVPKNWLEKVW 579

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  231 bits (589), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 144/511 (28%), Positives = 241/511 (47%), Gaps = 28/511 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++R LK RH                     +   GP+G +I +    +        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +  RF+ P+       +Y   W     LE+      +Q+W  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+ ++  +N+F V+ +GE EF  + +K + + GF+I C  ++CG G     +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFI 253

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PG    G          F G +S L+ A+++  G E+  + +GE  +P K +P
Sbjct: 254 GAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IAI+      LP I 
Sbjct: 302 SAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKALPSIV 360

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +++S GNS I+  SR +  ++   L P       + G P V ++  SLFG LA+
Sbjct: 361 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S    + FNWL+ I G+A    WL I+LSHIRF  A++ +G S D+L F +      
Sbjct: 421 LVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG 480

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNGID--------FLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI+I Q + S  P  G          F   Y+   + + I+I  + +++C+
Sbjct: 481 SAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQ 540

Query: 494 L-----IWRVEDVDIDTDRRAVEEAVWIEQE 519
                 +  ++D+D++TDR+ ++  + ++QE
Sbjct: 541 TGKWWGVKALKDIDLETDRKDIDIEI-VKQE 570

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  230 bits (586), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 149/523 (28%), Positives = 249/523 (47%), Gaps = 16/523 (3%)

Query: 11  MKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYL 70
           + E I++  +  +   +++ LK RH                     L   GPVG LIAY+
Sbjct: 30  LDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYV 89

Query: 71  FMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL---- 126
            +  +      ++ E+A+F+P T +    S++F+  A G      + F W  T++     
Sbjct: 90  LVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPG 143

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           ELS    V+ +WT   P A +I+IF VL    N++ +++YGE E++   +K+  I   +I
Sbjct: 144 ELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILII 202

Query: 187 YCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELV 246
               +  G      +GF YWR+PG F   ++  D    +F+G+ ++L +  +++ G + +
Sbjct: 203 TGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGD--TGKFVGFWAALSSVVYSYSGIQNI 260

Query: 247 GITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFI 306
            I AGE  N R  +    K V                  VPY+D  + +      +SPF+
Sbjct: 261 AILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNARSSPFV 320

Query: 307 IAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVP 366
           IA+E +G  VLPHI NA+I+ +  SAGN  I  GSR ++ L+T   AP I  +T++ G+P
Sbjct: 321 IAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIP 380

Query: 367 WVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGI 426
           WV VL  S F  LAYM  S      F+W   +        W+ IS +HI   +AL  +G 
Sbjct: 381 WVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGY 440

Query: 427 SRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN-GID-FLTAYISVFMFIAIWI 484
           SR DLP+     P  A++      + ++  GF +F   N  I+ F + Y  + + IA++ 
Sbjct: 441 SRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFT 500

Query: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKF 527
            ++ + + R + R  +VD+ +    + E      E    W + 
Sbjct: 501 FWKLFKKTRYL-RPHEVDLQSIFEDIRENPEYIPETTPLWKRL 542

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  230 bits (586), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 145/495 (29%), Positives = 236/495 (47%), Gaps = 19/495 (3%)

Query: 27  VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86
           V+R LK RH                     L   GP+  L+ +  +  +A+++ +S+GEM
Sbjct: 51  VKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEM 110

Query: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 146
            T  P    FT  ++RF S +  A  GY Y   +    A E + +  + QFW   VPL  
Sbjct: 111 ITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYG 170

Query: 147 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV-GFRY 205
           +I IFW       M  V  +GE E+W++  K++ ++ F I+    + G     P  GF Y
Sbjct: 171 YILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHY 230

Query: 206 WRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 265
           W +PGA   G          F G     +  +  + GTE V  +A E+ NP + +P AI+
Sbjct: 231 WNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIR 280

Query: 266 KVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVI 325
           +                   VPY+D  L +    +  SP  IAI  +G     H+ NA I
Sbjct: 281 QTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALK-SPISIAITRAGWEGGTHLVNAFI 339

Query: 326 VATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETS 385
           + T ISA N ++++GSR +  L+   LAP  L+ T + GVP  A+ + +  G ++ M  S
Sbjct: 340 LVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVS 399

Query: 386 TGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYG 445
            G   A+++++N++GV  F  W  I L+H+RF +A   +G +  +LP+KA + P     G
Sbjct: 400 VGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIG 459

Query: 446 VFFMTLIIIIQGFTSFCPWNGIDFLTAYI----SVFMFIAIWIAFQAWFRCRLIWRVEDV 501
           +     + +IQG+TSF P+   DF+ AY+    +  ++I I +     F+      +  +
Sbjct: 460 IAANIFLALIQGWTSFVPFKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTV---DLLTI 516

Query: 502 DIDTDRRAVEEAVWI 516
           D+D  RR   +A ++
Sbjct: 517 DLDEGRRVDLDATFV 531

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  228 bits (582), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 150/525 (28%), Positives = 254/525 (48%), Gaps = 26/525 (4%)

Query: 8   DSKMKEEIREISVEVEAE-----TVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGP 62
           DS  +    ++  + +AE      +++ +K RH                   + L  AGP
Sbjct: 41  DSFRRGRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGP 100

Query: 63  VGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWC 121
            G ++ Y+  + + Y + ++ GE+   +  +T ++T +S   V PA G +  ++Y   W 
Sbjct: 101 AGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWM 160

Query: 122 ITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAI 181
             F L+L     +IQ+WT   P   +++I + ++  +N+F  K Y E EF+  L KV+ I
Sbjct: 161 TVFPLQLVTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMI 219

Query: 182 MGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           +GF+I    + CG AG +G +G +YW  P  F  G          F G       AAF +
Sbjct: 220 IGFVILGVVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAY 269

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYV 300
            G E++ ++A E  NPRK++  A KKV+                 VP D   L S  S  
Sbjct: 270 GGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS-- 327

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
            ASP +IA+   G  ++PHI NAVI+  ++S GNS++Y   R++  L+    AP I +  
Sbjct: 328 RASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYI 387

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P  A  V  +FG LA++  S      F WLL I+G++  F W+ I +SHIRF  A
Sbjct: 388 DRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDA 447

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFM 478
           ++ +G S  ++ +KA+     ++  V    LI+I Q + +  P    G+D  + + S   
Sbjct: 448 MKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLA 507

Query: 479 FIAIWIAFQAWFRCRLIWRV----EDVDIDTDRRAVEEAVWIEQE 519
           F  + +A+  +      WR+     +VD+ + R+  +E    +++
Sbjct: 508 FPILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFDEDELKQED 552

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  227 bits (578), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 157/508 (30%), Positives = 254/508 (50%), Gaps = 19/508 (3%)

Query: 13  EEIREISVEVE-AETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
            E+  I  E    E + R LK RH                  ST L   GP    I Y  
Sbjct: 35  NEVYTIDPEANIREDLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSL 94

Query: 72  MATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131
           +  + Y     L EM+T++P++ SF  ++++F S +F  A  + YWF+  ++ A +L+ +
Sbjct: 95  IGGIVYLTLLCLAEMSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTAL 154

Query: 132 GQVIQFW---TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYC 188
             V+ +W   +   P  A   IFW  +  +N+  V++YGE E+W+A++KV+AI+ F I  
Sbjct: 155 QLVMDYWNTDSNHFPYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMS 214

Query: 189 FCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVG 247
             +  G       +GF+ W          + +      F G+ S  ++A+F + GTE + 
Sbjct: 215 IIVNVGHNPQHEYIGFKNWT---------VGEAPFVDGFKGFASLFVSASFAYGGTESIT 265

Query: 248 ITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFII 307
           +T+GE+ NP +  P+ +K V                  VPY+   L+S    V  SPF I
Sbjct: 266 LTSGESDNPLRNTPKIVKTVFWRILFFYIGTTFFIAMNVPYNYPGLSSGS--VVTSPFTI 323

Query: 308 AIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAP-GILSRTTQHGVP 366
             + +GT       NAVI+ ++ISA N  ++ GSRIMY +      P  I+SRT ++ VP
Sbjct: 324 VFKMAGTAGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVP 383

Query: 367 WVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGI 426
           +VAVL+T   G L +  +  G    + WL NI GV+    WL I+++ IRF Q LE +  
Sbjct: 384 YVAVLITWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQNK 443

Query: 427 SRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAF 486
           +  +L FK    P   Y+ V  +T II++QG++SF PWN  +F + YI +F+F   +I +
Sbjct: 444 TH-ELKFKNWTYPFGPYFLVVAVTFIILVQGWSSFAPWNVSNFFSVYIELFVFPFCFIIW 502

Query: 487 QAWFRCRLIWRVEDVDIDTDRRAVEEAV 514
             + R   + + +D+D  TD+    + +
Sbjct: 503 WLYKRDPFV-KCKDMDFVTDKYVPSQEI 529

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  227 bits (579), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 147/512 (28%), Positives = 245/512 (47%), Gaps = 30/512 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++R LK RH                     +   GP+  +I +    +        
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +S RF+ P+       +Y   W     LE+      +Q+W  ++
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+  +  +N+F  + +GE EF  + VKV+ I GF+I C  ++CG G     V
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PG    G          F G +S L+ A+++  GTE+V + +GE  +P K +P
Sbjct: 261 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP-KELP 308

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+                   VPY +  L    S V+ SPF+IAI+     VLP I 
Sbjct: 309 SAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVLPSIV 367

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +I+S GNS I+  SR +  ++   L P       + G P   ++  SLFG LA+
Sbjct: 368 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAF 427

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPF-KAKWMPG 440
           +  S+   + F+WL+ I G+A    WL I++SHIRF  A++ +G S D+L F  A  + G
Sbjct: 428 LVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWG 487

Query: 441 LAYYGVFFMTLIIIIQGFTSFCPWNG--------IDFLTAYISVFMFIAIWIAFQAWFRC 492
            AY  V   +LI++ Q + +  P  G          F  +Y+   + I +++  + ++R 
Sbjct: 488 SAYSAV-INSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRY 546

Query: 493 RL-----IWRVEDVDIDTDRRAVEEAVWIEQE 519
           +      +  +  +D++TDR+ ++  + ++QE
Sbjct: 547 KTGKWWSMLPLNKIDLETDRKNIDIEI-LKQE 577

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  227 bits (579), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 147/536 (27%), Positives = 265/536 (49%), Gaps = 18/536 (3%)

Query: 5   HNQDSKMKEEIREISVEVEAET-VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPV 63
           H   ++   ++ + +  +++++ +++ LK RH                  +  L   GP 
Sbjct: 67  HGNLNEKSADLEDGTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPA 126

Query: 64  GALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
             +I Y+ ++ + Y + Q+ GEMA   P +  +F  +   F+S ++G A  +++   W  
Sbjct: 127 SLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWIT 186

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
              LEL      IQ+WT  +    ++ IF+V L  ++   VK YGE EF   L K++ I 
Sbjct: 187 VLPLELITSSLTIQYWT-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMIS 245

Query: 183 GFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
           GF+I+   + CG AG  G +G +YW  PG+F  G        +RF G    L+   F++ 
Sbjct: 246 GFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAEG-----GPTSRFKGICYVLVAGYFSYG 300

Query: 242 GTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYV 300
           GTEL  ++  E A PRK  P A KK +                 VP++ D  + +  S  
Sbjct: 301 GTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSST 360

Query: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360
            ASP+++A    G  V+PHI NAVI+ +++S  NS++Y   R++  L+    AP  L+  
Sbjct: 361 HASPYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYI 420

Query: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420
            + G P VA+L+ ++FG +A++ +S   ++ F WL  I G++  FTW  I  SH+RF  A
Sbjct: 421 DREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLA 480

Query: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYI 474
           ++++    D++ +KA      +++G  F  L++I Q + +  P       +   F   Y+
Sbjct: 481 MKVQNKDIDEVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYL 540

Query: 475 SVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529
           ++ +++  +I +  + +   ++  +  +D+D  RR + +   I QE     +K  N
Sbjct: 541 AMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRR-IYDPDLIRQEDAENKEKLKN 595

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  226 bits (575), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 153/536 (28%), Positives = 261/536 (48%), Gaps = 32/536 (5%)

Query: 14  EIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMA 73
            I E+ V+ + E VR  LK RH                     L   GP   LI+Y+ M+
Sbjct: 39  SISELEVKPQNEMVR-GLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMS 97

Query: 74  TLAYSVTQSLGEMATFIPVTSSFTVFS--QRFVSPAFGAANGYMYWFSWCITFALELSVV 131
              +++   L EM   IP+    +++S  + +V        G+  +++  +    E++  
Sbjct: 98  FFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITAC 157

Query: 132 GQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191
             +IQ+WT A   A +ISIF V    + M PV+ +GE EF V+ +K++ I+G +I    +
Sbjct: 158 AMLIQYWTDANS-AIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVI 216

Query: 192 VCGAGVTGP--VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT-ELVGI 248
             G G +    +GF YW+ PGAF   ++    +  +FL   +++I + F+F    E V  
Sbjct: 217 FFGGGPSQDHILGFHYWKKPGAFKEHLVPG--STGKFLAVWTAIIKSGFSFVLVPETVAS 274

Query: 249 TAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT----STDSYVSASP 304
            + E+A+PR+ +PRA ++ V                 V  DD  L     S  S  +ASP
Sbjct: 275 CSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASP 334

Query: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364
           ++I I+ +G  VLPHI NA I+ +  S G + +Y  SRI++ ++    AP I ++  + G
Sbjct: 335 YVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFG 394

Query: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424
           VP+ +  V  LF  LAY+  S      FNWL NI  ++GF +W+F+S+++ RF   ++  
Sbjct: 395 VPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTVIDKL 454

Query: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAI 482
            ++ D +PF+ ++  G AY  + F  L+ +  G+  F    WN  DF  +Y+++     +
Sbjct: 455 DLN-DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVL 513

Query: 483 WIAFQAWFRCRLIWR---------VEDVDI-DTDRRAVEEAVWIEQEPRGFWDKFW 528
           +I    +++  L +R         +  +DI D D R     V     P+ + +K W
Sbjct: 514 FIGSTIYYK-ELRFRDVSEIGREIIPKIDIADEDERNDVPVV-----PKNWGEKIW 563

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  225 bits (574), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 143/511 (27%), Positives = 240/511 (46%), Gaps = 28/511 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++R LK RH                     +   GP+G ++ +    +        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 133

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +  RF+ P+       +Y   W     LE+      +Q+W  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+V++  +N+F V+ +GE EF  + +K + + GF+I C  ++ G G     V
Sbjct: 194 DPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYV 253

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PG    G          F G +S L+ A+++  G E+  + +GE  +P K +P
Sbjct: 254 GAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IAI+     VLP I 
Sbjct: 302 SAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLPSIV 360

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           N VI+ +++S GNS I+  SR +  ++   L P       + G P V ++  SLFG LA+
Sbjct: 361 NVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S      FNWL+ I G+A    WL I++SHIRF  A++ +G   D+L F +      
Sbjct: 421 LVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWG 480

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNGID--------FLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI++ Q + S  P  G          F   Y+   + + I+IA + +++C+
Sbjct: 481 SAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQ 540

Query: 494 L-----IWRVEDVDIDTDRRAVEEAVWIEQE 519
                 I  ++D+D++TDR+ ++  + ++QE
Sbjct: 541 TGQWWGIKALKDIDLETDRKNIDIEI-VKQE 570

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  225 bits (573), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 142/519 (27%), Positives = 255/519 (49%), Gaps = 19/519 (3%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           + + R LK RH                     L   GP   LIAY+ ++   +S+   + 
Sbjct: 53  QKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMT 112

Query: 85  EMATFIPVTSSFTVFS--QRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           EM   IP+    +++S  + +++       G+  +++  +    E++    ++Q+WT A 
Sbjct: 113 EMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDAN 172

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-- 200
             A +ISIF V+   + M PVK +GE EFWV+ +K++ I+G +I    +  G G      
Sbjct: 173 S-AIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHV 231

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT-ELVGITAGEAANPRKT 259
           +GF YW++PGAF P +   + N  RFL   +++I + F+F    E V   + E   PR+ 
Sbjct: 232 LGFHYWKNPGAFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRN 289

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL----TSTDSYVSASPFIIAIENSGTH 315
           +P+A ++ +                 V +++ +L     S  S  +ASPF+I I+ +G  
Sbjct: 290 MPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIK 349

Query: 316 VLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSL 375
           +LPHI NA I+ +  S G   +Y  SR +Y ++    AP I ++  + G P+ +  + SL
Sbjct: 350 ILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASL 409

Query: 376 FGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKA 435
           F  LAY+  S      FNWL NI  ++GF +W+F+S+++IRF + +    ++ D +PF+ 
Sbjct: 410 FSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRR 468

Query: 436 KWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQAWFRCR 493
            +   LAY    F  ++ +  G+  F    WN  DF  +Y+++   I +++    +++  
Sbjct: 469 PFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQW 528

Query: 494 LIWRVEDVDID----TDRRAVEEAVWIEQEPRGFWDKFW 528
                ++++++     D    EE   +   PR F +K W
Sbjct: 529 TFRDFKEIEVEILPKIDIADEEERNDVIPVPRNFMEKVW 567

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  225 bits (573), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 143/525 (27%), Positives = 252/525 (48%), Gaps = 23/525 (4%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           DS  ++E  + S   +   + + ++ RH                   + L  +GP+G +I
Sbjct: 66  DSFKRKE-HDDSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLII 124

Query: 68  AYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126
            Y+  + + + + Q+ GE+   +  V  +FT +    V PAFG A  ++Y   W I   L
Sbjct: 125 GYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPL 184

Query: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186
           +L      IQFW   V L  ++   +V++  +N+   + Y E EF+  L K+V + GF+I
Sbjct: 185 QLVTAAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVI 244

Query: 187 YCFCMVCGAGVTGPVGF---RYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243
               +  G    GP G+   +YWR+PG F  G          F G  S    AAF++ G 
Sbjct: 245 LGIIITAGGIPNGPDGYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGV 294

Query: 244 ELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKL-TSTDSYVSA 302
           E + ++A E  NP K++P A KKV+                 VPY    L  S+ S   +
Sbjct: 295 ETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHS 354

Query: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362
           SPF+IAI + G  V+PH+ NAVI+ +++S  NS +YV  R++  L+    AP  L+   +
Sbjct: 355 SPFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDK 414

Query: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422
            G P    LV  LFG + ++  S   +  F WLL+I+G+   F W+ I +SHIRF  A+ 
Sbjct: 415 RGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMR 474

Query: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAYISV 476
           ++G    ++ +KA+     +Y  +     +++ Q + +  P       +  +F   Y++ 
Sbjct: 475 VQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAF 534

Query: 477 FMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEP 520
            + +  ++ F+ +++  +L+   + +++D +R        +E +P
Sbjct: 535 PVVLCAYLGFKVYYKQWQLLIPADKIELDNNRNVYVPEEALEDKP 579

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  224 bits (571), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 155/501 (30%), Positives = 246/501 (49%), Gaps = 20/501 (3%)

Query: 25  ETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 84
           E + R L  RH                     L   GP   LI Y  +  + Y+   SLG
Sbjct: 45  EHLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIGLIVYATLLSLG 104

Query: 85  EMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW-TFAVP 143
           EM+T++P++ SF  F+++F S +F  A    YWF+  ++ A +L+ +  V+ +W T    
Sbjct: 105 EMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKTSESG 164

Query: 144 LAAWIS--IFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP- 200
              WI+  IFWV L  +N+  VK YGE E+W+A++KV+AI+ F I       G       
Sbjct: 165 FPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEY 224

Query: 201 VGFRYW-RHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259
           +GFR W R    F  G          F G+ +  ++A+F + GTE + +T+GE  NP + 
Sbjct: 225 IGFRNWTRGDAPFVNG----------FRGFATLFVSASFAYGGTESITLTSGETKNPVRN 274

Query: 260 VPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
            P+ IK V                  VPYD   L  ++  V  SPF I  +  G+     
Sbjct: 275 TPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNL--SEKSVMTSPFTIVFQMVGSKAAGS 332

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLS-TSRLAPGILSRTTQHGVPWVAVLVTSLFGA 378
             NAVI+ +++SA N  ++ GSRI++ L       P +++RT  + VP+VAVLVT   G 
Sbjct: 333 FMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGG 392

Query: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438
           L +  +  G    + WL N+ GV+    WL I +  IRF + L  +G +  +L F     
Sbjct: 393 LCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRFRRGLSRQGKTH-ELKFVNWTY 451

Query: 439 PGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRV 498
           P   Y+ +  ++ II++QG++S  P +   F + Y+ +F+F+A W+ + A+ R   + R 
Sbjct: 452 PYGPYFVIISVSFIILVQGWSSSSPMDVTSFFSYYVELFIFLACWLVWWAFKRDGFV-RE 510

Query: 499 EDVDIDTDRRAVEEAVWIEQE 519
           +D+D  TD+    E   +  E
Sbjct: 511 KDMDFVTDKYIPSERELLLNE 531

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  226 bits (575), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 148/512 (28%), Positives = 250/512 (48%), Gaps = 26/512 (5%)

Query: 8   DSKMKEEIREISVEVEAET-VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGAL 66
           DS  ++++R      E ET + + +K RH                     L  +GP G +
Sbjct: 86  DSFKRQKVRNDGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLV 145

Query: 67  IAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125
           I Y   + + Y V Q+ GE+   +  +T ++T +    + PA G A   +Y   W     
Sbjct: 146 IGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLP 205

Query: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185
           L+L      I++WT  V    +++   VL+  +NMF  K Y E EF+    K++ + GF+
Sbjct: 206 LQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFV 265

Query: 186 IYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244
           I    + CG AG    +G +YW+ PGAF  G          F G  +    AAF++ G E
Sbjct: 266 ILGIVINCGGAGDKEYIGVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGGIE 315

Query: 245 LVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD---SYVS 301
           ++ +TA E ANPRK +P A +KVV                 VPY+   L  ++   S   
Sbjct: 316 VLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSD 375

Query: 302 ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           ASPF+IA+ + G  V+PHI NA I+ ++IS  NS++Y G R++  LS    AP   +   
Sbjct: 376 ASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYID 435

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           + G P + VLV+   G +A++      ++ F WLL ++G++  F W+ I++SH+RF  A+
Sbjct: 436 RRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAI 495

Query: 422 --EMRGI-SRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW--NG-ID---FLTA 472
             ++ G+ +RD + + A+     +   +     I++ Q + +  P   NG +D   F   
Sbjct: 496 RSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFEN 555

Query: 473 YISVFMFIAIWIAFQAWFRC-RLIWRVEDVDI 503
           Y++  + +  ++A++ W R  RL     ++D+
Sbjct: 556 YLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  223 bits (568), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/445 (31%), Positives = 212/445 (47%), Gaps = 14/445 (3%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           + ++++R LK RH                     L   GP+  +I +L   T        
Sbjct: 73  DPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHG 132

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +  RF+ P+       +Y   W     LE+      IQFW  ++
Sbjct: 133 LGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSI 192

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+V +  +N+F V+ +GE EF  + +KV+ I GF+I C  ++ G G T   V
Sbjct: 193 DPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYV 252

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G RYW  PGA   G          F G  S  + A+++  G+E+  + +GE  +P K +P
Sbjct: 253 GARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGET-DP-KELP 300

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V+ SPF+IA       VLP I 
Sbjct: 301 SAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFVIACNLYHIKVLPSII 359

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +I+S GNS I+  SR +  ++   L P I     + G P V ++  SLFG LA+
Sbjct: 360 NAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAF 419

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S+   + FNWL+ I G+A    WL I++SHIRF  A++ +  + D+L F +      
Sbjct: 420 LVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWG 479

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNG 466
           + Y      LI+I Q + S  P  G
Sbjct: 480 SVYSAVVNVLILIAQFYISLWPVGG 504

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  224 bits (571), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 252/499 (50%), Gaps = 24/499 (4%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           E E +++ +K  H                     + +AG  G L+ Y  + ++     QS
Sbjct: 66  ENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQS 125

Query: 83  LGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
           +GE+    P +   F  + +RFV P+FG    +++   W I   LEL      I++W  +
Sbjct: 126 VGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNS 185

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA-GVTGP 200
           +  + +++IF+ L+ G++ F  + Y + EF   L KV+ I GF+I    +  GA G +G 
Sbjct: 186 LNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGY 245

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAA--NPRK 258
           +G +Y + PGAF          +  F    S+L+NA F+  G E + ++A E A  N  K
Sbjct: 246 IGIKYLKTPGAF--------NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISK 297

Query: 259 TVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT-STDSYVSASPFIIAIENSGTHVL 317
           ++ RA  +V+                 VPY+  +L  S+   + +SP++IA+ + G  V+
Sbjct: 298 SIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVV 357

Query: 318 PHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFG 377
           PH+ NAVI+  ++S  NS +Y  SR ++ L+    AP   ++    G P+  ++V+ +FG
Sbjct: 358 PHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFG 417

Query: 378 ALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKW 437
            L+++      +  F WLL+I+G++  FTW  I ++H+RF  A++ +  S ++L  +A W
Sbjct: 418 LLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRA-W 476

Query: 438 MPGL--AYYGVFFMTLIIIIQGFTSFCPWNG------IDFLTAYISVFMFIAIWIAFQAW 489
             G+  +YY +   +L +++Q + S  P +G      ++F   Y++V   + +++  + +
Sbjct: 477 -SGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIY 535

Query: 490 FRC-RLIWRVEDVDIDTDR 507
            R  + I   + +D+DT R
Sbjct: 536 TRSWQFIIPADKIDVDTSR 554

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  224 bits (570), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/511 (28%), Positives = 240/511 (46%), Gaps = 28/511 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   +++ LK RH                     L   GP+  +I +    +        
Sbjct: 82  DTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHG 141

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +S RF+ P+       +Y   W     LE+      +Q+W  ++
Sbjct: 142 LGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESI 201

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+V +  +N+F V+ +GE EF  + +KV+ I GF++ C  ++ G G     V
Sbjct: 202 DPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYV 261

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G RYW +PG    G          F G +S ++ A+++  GTE+  + +GE  +P K +P
Sbjct: 262 GSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGET-DP-KELP 309

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IAI+     VLP I 
Sbjct: 310 SAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKIHHIKVLPSIV 368

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +I+S GNS I+  SR +  ++   L P       + G P V ++  SLFG LA+
Sbjct: 369 NAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAF 428

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S    + F+WL+ I G+A    WL I++SHIRF  A++ +G S ++L F +      
Sbjct: 429 LVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWG 488

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNG--------IDFLTAYISVFMFIAIWIAFQA--WFR 491
           + Y      LI++ Q + S  P  G          F  +Y+   + + IWI  +   W +
Sbjct: 489 SVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIYYWRQ 548

Query: 492 CRLIWR---VEDVDIDTDRRAVEEAVWIEQE 519
              IW    + ++D+D  R+ ++  V ++QE
Sbjct: 549 TGKIWAFTPLAEIDLDEGRKNIDLDV-LKQE 578

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  223 bits (569), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 248/528 (46%), Gaps = 38/528 (7%)

Query: 22  VEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQ 81
           V + T +R L  RH                 +  PL   GP   L+A+         +T 
Sbjct: 68  VASHTTKRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITV 127

Query: 82  SLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW--- 138
           S  EM  F+PV+S F   + + V  +      + +WF  C+    E+  V  +I +W   
Sbjct: 128 STAEMVCFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYWRDD 187

Query: 139 -TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCF-CMVCGAG 196
            + A+PL    S+ ++L++   +  VK+YGE EFW+A  K+V  MG   + F  M+ G  
Sbjct: 188 YSAAIPLVIQ-SLLYLLIS---LAAVKWYGEMEFWLASFKIVLAMGLFCFTFITMLGGNP 243

Query: 197 VTGPVGFRYWRHPGAFG---PGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEA 253
                GFRY+ H   F    P  I +  +   F G+   LI A+FT  G E + + AGE 
Sbjct: 244 KKDRFGFRYF-HDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAGGEYISMLAGEI 302

Query: 254 ANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVS----ASPFIIAI 309
             PR+ +PRA K+V                     +D  LT+  +       +SP++IA+
Sbjct: 303 EIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGAGSSPYVIAM 362

Query: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369
            N G  +LP I N  ++    S+GN+  Y  SR +YG++    AP I +R  + GVP  A
Sbjct: 363 NNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYA 422

Query: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429
           V V+ L+  ++ ++ ++      NWL+NI   +    +  + ++++ F +A  ++     
Sbjct: 423 VGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRAYLLQKDKLP 482

Query: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFMFIAIWIAFQ 487
           +LPFK+ W P  A +G+    +++I+QG+T F P  WN  DFL  Y+ +F+ I I+I + 
Sbjct: 483 ELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFY- 541

Query: 488 AWFRCRLIWR-----VED---VDIDTDRRAVEEAVWIEQEPRGFWDKF 527
                + IWR     ++D   +  + + R +E       E    +DKF
Sbjct: 542 -----KFIWRLGKDKIKDPATISFEDELREIE-----NHELEHNFDKF 579

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  223 bits (568), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 142/503 (28%), Positives = 233/503 (46%), Gaps = 27/503 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++R LK RH                     L   GP+  +I +    +        
Sbjct: 59  DTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHG 118

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +S RF+ P+       +Y   W     LE+      IQ+W  ++
Sbjct: 119 LGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSI 178

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+ ++  +N+F  + +GE EF  + +K + I GF+I C  ++CG G     +
Sbjct: 179 DPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFI 238

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PGA   G          F G +S L+ A+++  GTE+  + +GE  +P K +P
Sbjct: 239 GAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DP-KELP 286

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IAI+      LP I 
Sbjct: 287 SAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKALPSIV 345

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +I+S GNS I+  SR +  ++   L P       + G P   ++  SLFG LA+
Sbjct: 346 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAF 405

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S+   + F+WL+ I G+A    WL I+LSHIRF  A++ +  + D+L F +      
Sbjct: 406 LVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWG 465

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNG--------IDFLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI+I Q + S  P  G          F  +Y+   + + I+   + ++R  
Sbjct: 466 SAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVS 525

Query: 494 L-----IWRVEDVDIDTDRRAVE 511
                 +  ++D+D++T R+ V+
Sbjct: 526 FGKWWDVKPLKDIDLETGRKNVD 548

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  223 bits (569), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 145/527 (27%), Positives = 262/527 (49%), Gaps = 21/527 (3%)

Query: 5   HNQDSKMKEEIREISVEVEAET-VRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPV 63
           HN  S   E++ +    + ++T  ++ L  RH                  +  L   GP 
Sbjct: 57  HNARS---EDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPG 113

Query: 64  GALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
             +I Y+ ++ + Y + Q+ GEMA   P +  +F  +   F+S ++G A  +++   W  
Sbjct: 114 SLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLT 173

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFP-VKYYGEFEFWVALVKVVAI 181
              LEL      I++W   +    ++ IF+V L  +++   ++ YGE EF     K++ +
Sbjct: 174 VLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMV 233

Query: 182 MGFLIYCFCM-VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240
           +GF+I    +   GAG  G +G +YW  PG+F  G        +RF G    L++  F++
Sbjct: 234 IGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEG-----DATSRFKGICLVLVSGYFSY 288

Query: 241 QGTELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTD-SY 299
            GTEL  ++  E A PRK  P A KK +                 VP+++ +L     S 
Sbjct: 289 GGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSA 348

Query: 300 VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSR 359
             ASP+++A    G  ++PH  NAVI+ ++IS  NS+++ G R++  L+T   AP ILS 
Sbjct: 349 THASPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSY 408

Query: 360 TTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQ 419
             + G P VA+ ++ L G +A++  ++  ++ F WL  I G++  FTW  I  SH+RF  
Sbjct: 409 VDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRA 468

Query: 420 ALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP------WNGIDFLTAY 473
           A++++G   ++L +KA      + YG FF  L++I Q + +  P       +   F  +Y
Sbjct: 469 AMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESY 528

Query: 474 ISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 519
           ++  +++A +  +  + +   L+  ++ +D+D+ RR  +  + I+QE
Sbjct: 529 LAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPEL-IKQE 574

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  223 bits (567), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 140/516 (27%), Positives = 247/516 (47%), Gaps = 21/516 (4%)

Query: 4   GHNQDSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPV 63
           G  +D    E++   S   E  ++R+ +K RH                     +  AG  
Sbjct: 4   GAKEDCSDAEKLS--SEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVG 61

Query: 64  GALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122
           G LI YL +  +     QS+GE+    P +   F  + ++F+ P+ G    +++   W +
Sbjct: 62  GTLIGYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMV 121

Query: 123 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182
              LEL      I++W   +  + ++S F++L+  +N F    Y E EF    VKV+ + 
Sbjct: 122 VLPLELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLA 181

Query: 183 GFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241
            F++    ++ G  G +GP+GF+Y + PGAF       + N   F     +L+NAAF+  
Sbjct: 182 SFIVLGIVIITGGLGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCG 234

Query: 242 GTELVGITAGEAA--NPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSY 299
           G E + ++A E    N  K++ RA ++V                  VPYD   L  + S 
Sbjct: 235 GVEFLALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSD 294

Query: 300 VS-ASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358
            +  SP++ AI   G  ++PHI NAVI+  ++S  NS +Y  SR ++ L+    AP   +
Sbjct: 295 TTHTSPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFA 354

Query: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418
              +HG P   ++V+++ G ++++      +  F WLL+I+G++  FTW  I ++HIRF 
Sbjct: 355 LLNKHGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFR 414

Query: 419 QALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW------NGIDFLTA 472
            AL+++G S D L +++      +Y       ++II+Q + S  P       + + F   
Sbjct: 415 NALKLQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQN 474

Query: 473 YISVFMFIAIWIAFQAWFRCRLIW-RVEDVDIDTDR 507
           Y++V + + +++  + +      W R   VDI+TDR
Sbjct: 475 YMAVPVAVLLYLGHKLYTNDWTPWIRTHCVDINTDR 510

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  223 bits (569), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 141/511 (27%), Positives = 239/511 (46%), Gaps = 28/511 (5%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           +   ++R LK RH                     +   GP+G ++ +    +        
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +  RF+ P+       +Y   W     LE+      +Q+W  ++
Sbjct: 135 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 194

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
               W++IF+ ++  +N+F  + +GE EF  + VK + + GF+I    ++CG G     +
Sbjct: 195 DPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFI 254

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PG    G          F G ++ L+ A+++  G E+  + +GE  +P K +P
Sbjct: 255 GAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGET-DP-KGLP 302

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IA++     VLP I 
Sbjct: 303 GAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVLPTIV 361

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +++S GNS I+  SR +  ++   L P       + G P V ++  SLFG LA+
Sbjct: 362 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 421

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S      FNWL+ I G+A    WL I+LSHIRF  A++ +G S D+L F +      
Sbjct: 422 LVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG 481

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNGID--------FLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI+I Q + S  P  G          F   Y+   + + I++  + +++C+
Sbjct: 482 SAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQ 541

Query: 494 L-----IWRVEDVDIDTDRRAVEEAVWIEQE 519
                 +  ++D+D++TDR+ ++  + I+QE
Sbjct: 542 TGKWWGVKSLKDIDLETDRKDIDIEI-IKQE 571

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  223 bits (567), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 151/518 (29%), Positives = 242/518 (46%), Gaps = 23/518 (4%)

Query: 12  KEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLF 71
            +E     +    +T RR LK RH                 +   L   GP   LIA+  
Sbjct: 48  DDEDSSSDLLYSTQTFRR-LKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFAL 106

Query: 72  MATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131
                  +T S  EM  F+PV+S F   + R    +      + +WF  C+    E+  V
Sbjct: 107 WCVPILCITVSTAEMVCFLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSV 166

Query: 132 GQVIQFW----TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
             +I +W    + A+PL   I +++++    ++  VKYYGE EFW+A  K++  +G  ++
Sbjct: 167 NTIIHYWRDDYSAAIPLVVQIVLYFLI----SICAVKYYGETEFWLASFKIILALGLFLF 222

Query: 188 CF-CMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQAR----FLGWVSSLINAAFTFQG 242
            F  M+ G       GFRY+     F       DK+       F G+++ LI A+FT  G
Sbjct: 223 TFITMLGGNPKHDRYGFRYYGET-PFKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAG 281

Query: 243 TELVGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTS----TDS 298
            E + + AGE   PRK +PRA K+V                     +D  LT+    +  
Sbjct: 282 GEYISMLAGEVKLPRKVLPRAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRP 341

Query: 299 YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358
              +SP++IA+ N G  VLP I NA ++    SAGN+  Y  SR +YG++    AP I +
Sbjct: 342 GAGSSPYVIAMNNLGIKVLPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFT 401

Query: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418
           R  +HGVP  +VL++ L+G ++ ++ +       NWL+N+   +    +  + + ++ F 
Sbjct: 402 RCNKHGVPIYSVLISLLWGLISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFR 461

Query: 419 QALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISV 476
           +A  +       LPFK+   P  A  G+   T +I+IQG+T F P  W   DFL  Y+ V
Sbjct: 462 RAYLLHKDILPKLPFKSWGQPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMV 521

Query: 477 FMFIAIWIAFQ-AWFRCRLIWR-VEDVDIDTDRRAVEE 512
           F+ I I+I ++  W R R  ++  + VD   D + +E 
Sbjct: 522 FIDIGIYIGYKFIWRRGRDKFKDPKTVDFSKDLKEIES 559

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  222 bits (566), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 146/522 (27%), Positives = 237/522 (45%), Gaps = 37/522 (7%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
            ++ +++ LK RH                     L   GP+  +I +    T        
Sbjct: 69  HSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHG 128

Query: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAV 142
           LGE+    PV  +F  +  RF+ P+       +Y   WC    LE+      +++W  +V
Sbjct: 129 LGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSV 188

Query: 143 PLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-V 201
           P  AW++IF+  +  +N+  V+ +GE EF  +L+KV+ I+GF+I C  ++CG G     V
Sbjct: 189 PPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFV 248

Query: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261
           G +YW  PG    G          F G  +  + A+++  GTE+  + +GE  +P K +P
Sbjct: 249 GAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGET-DP-KELP 296

Query: 262 RAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321
            AIK+V                  VPY +  L    S V  SPF+IAI   G   LP + 
Sbjct: 297 SAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKALPSVV 355

Query: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381
           NAVI+ +++S GNS I+  SR +  ++   L P I     + G P V +L    FG LA+
Sbjct: 356 NAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAF 415

Query: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441
           +  S+     F WL+ I G+A    WL I++SHIRF  A++ +G+S D+L F +      
Sbjct: 416 LVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYG 475

Query: 442 AYYGVFFMTLIIIIQGFTSFCPWNG--------IDFLTAYISVFMFIAIWIAFQAWFRCR 493
           + Y      LI++ Q + S  P  G         +F   Y+   + + ++   + ++R  
Sbjct: 476 SVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYYRIS 535

Query: 494 L-----IWRVEDVDIDTDRRAV----------EEAVWIEQEP 520
                    + D+D+ TD R            E+ V + Q+P
Sbjct: 536 TGKWWGFKALRDIDLLTDMRVTDTELSKHELHEKRVKLAQKP 577

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  223 bits (567), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 153/513 (29%), Positives = 246/513 (47%), Gaps = 23/513 (4%)

Query: 8   DSKMKEEIREISVEVEAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALI 67
           D  M +E +  +  +  + +++ L QRH                 +   L ++GP   LI
Sbjct: 66  DLSMMDEQQRRNYVLANQPLQKTLSQRHLMMIAIGGTLGTGLFIGIGYSL-SSGPGSLLI 124

Query: 68  AYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALE 127
            +L +  + + V QS  E+A   PV+ S+ V   RF+ P+ G      Y  +W I+F  E
Sbjct: 125 GFLIVGLMMFCVVQSAAELACQYPVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSE 184

Query: 128 LSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187
           L      +Q+W  +V  A W++IF+V +  +NMF V+ YGE EFW++L KVVAI+ F+I 
Sbjct: 185 LIGCAMTLQYWNKSVNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIII 244

Query: 188 CFCMVCGAG--VTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245
              ++CG G   TG +G +YW  PG+F   +         F G  ++ ++AAF+F G EL
Sbjct: 245 GIVLICGGGPNSTGYIGTKYWHDPGSFAKPV---------FKGLCNTFVSAAFSFGGAEL 295

Query: 246 VGITAGEAANPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPYDDWKLT--STDSYVSAS 303
           V +TA E +   ++V RA K                    VPY + +L     D  ++AS
Sbjct: 296 VVLTASE-SRKVESVSRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDEDITAS 354

Query: 304 PFIIAIENSGTH--VLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTT 361
           PF+IA+   G+      H  N VI+  ++S  NS +Y  SRI+  L      P I     
Sbjct: 355 PFVIALSGQGSMGTKASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVD 414

Query: 362 QHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQAL 421
           Q G P V + +  +FG L ++  S      F WL  +  ++ FFTW  I  S +RF  AL
Sbjct: 415 QKGRPLVGIAICGVFGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFAL 474

Query: 422 EMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNG----IDFLTAYISVF 477
             +G S D++  K+       + G     L+I  + + S  P  G      F    +S+ 
Sbjct: 475 RAQGRSSDEIAHKSMLGIYGGFLGCLLNALLIAGEIYVSIFPLGGDPSAKQFFQYCLSIP 534

Query: 478 MFIAIWIAFQ--AWFRCRLIWRVEDVDIDTDRR 508
           + IA++I  +  A    R++   +++D++T R+
Sbjct: 535 IMIAVYIGHKLFANKSKRVLIPAQEIDLETGRK 567

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  221 bits (562), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/527 (27%), Positives = 252/527 (47%), Gaps = 27/527 (5%)

Query: 1   MLGGHNQDSKMKEEIREISVEVEA--------ETVRRELKQRHXXXXXXXXXXXXXXXXX 52
           +L   +      + +  ++ +VEA        E +R+ ++ RH                 
Sbjct: 7   LLCKKDASGAEADSVESVAEDVEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVG 66

Query: 53  VSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFVSPAFGAA 111
               +  AG  G LI Y  +  +     QS+GE+    P ++  F  + +RF+ P+ G +
Sbjct: 67  NGKSIACAGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFS 126

Query: 112 NGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEF 171
             +++   W I   LEL      I++W  ++  + ++S+F+ L+  +N F    Y E EF
Sbjct: 127 VSWLFCLQWMIVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEF 186

Query: 172 WVALVKVVAIMGFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWV 230
               +KVV I+GF+I    +  G  G +G +GFRY   PG F       +KN        
Sbjct: 187 IFNSLKVVVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMF-------NKNYNIIKATA 239

Query: 231 SSLINAAFTFQGTELVGITAGEAA--NPRKTVPRAIKKVVXXXXXXXXXXXXXXXXXVPY 288
            +L+NAAF+  G E + ++A E    N  K++ RA  +V                  VP+
Sbjct: 240 GTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPH 299

Query: 289 DDWKLTSTDS-YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGL 347
           +   L  + S  + +SP++ A+  +G  V+PHI NAVI+  +IS  NS +Y  SR ++ L
Sbjct: 300 NSPILMGSGSNMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSL 359

Query: 348 STSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTW 407
           +    AP   ++  +HG P   + +++LFG ++++      +  F WLL+I+G++  FTW
Sbjct: 360 AEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTW 419

Query: 408 LFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPW--- 464
             I ++HIRF  A++ RG S + L +K+      +Y       +I+++Q + S  P    
Sbjct: 420 TTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESN 479

Query: 465 ---NGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDR 507
              N + F   Y++V + +  +I  + + +   L+ R  +VDI TDR
Sbjct: 480 GKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTDR 526

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  221 bits (563), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 254/506 (50%), Gaps = 14/506 (2%)

Query: 23  EAETVRRELKQRHXXXXXXXXXXXXXXXXXVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82
           + +T+++ ++ RH                     L N GP   +I Y  ++++ Y V QS
Sbjct: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136

Query: 83  LGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141
             E+A  +  +   F  +    V  AFG +  ++Y   W     LEL      I++W   
Sbjct: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196

Query: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200
           +   A+++IF+V+L  +N      Y E EF+    KV+ I+GF I    + CG AG  G 
Sbjct: 197 INPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGY 256

Query: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260
           +G RYW  PGAF         +  RF G V+ L+NAAF + G E   +TA E  NP+K++
Sbjct: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311

Query: 261 PRAIKKVVXXXXXXXXXXXXXXXXXVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPH 319
             A KK+V                 VP++ D  L S  S   ASPF+IA+ + G  V+PH
Sbjct: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371

Query: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379
             NAVI+ +++S  NS +Y  SRI+  LS    AP  L+   + G P + +LV+ +FG L
Sbjct: 372 FINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431

Query: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439
           +++  S   +  F WLL I+G++  FTW  ISLSH+R  +A+ ++G S D+L + A    
Sbjct: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491

Query: 440 GLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRC-R 493
             AYY +  +  I++ Q + +  P   N +D   F   Y+++ + I +++ ++ W R  R
Sbjct: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551

Query: 494 LIWRVEDVDIDTDRRAVEEAVWIEQE 519
           L+    +VD+   R+  +  V   ++
Sbjct: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,348,112
Number of extensions: 1819280
Number of successful extensions: 6954
Number of sequences better than 10.0: 386
Number of HSP's gapped: 5593
Number of HSP's successfully gapped: 405
Length of query: 532
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 418
Effective length of database: 40,409,475
Effective search space: 16891160550
Effective search space used: 16891160550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)