Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B070102.152ON62562531280.0
TDEL0B051402.152ON59962318120.0
ZYRO0G06512g2.152ON60462317870.0
SAKL0E10956g2.152ON60053817530.0
Kpol_1048.212.152ON59752917510.0
KLTH0B05170g2.152ON59353017160.0
TPHA0I015102.152ON60362817100.0
Skud_14.2112.152ON61755917060.0
KNAG0H035302.152ON61453617040.0
TBLA0C055302.152ON61053817030.0
Kwal_33.147672.152ON59462316970.0
Smik_14.2072.152ON61755916970.0
YNL121C (TOM70)2.152ON61754416950.0
KAFR0F007202.152ON60852916770.0
Suva_14.2192.152ON61754416760.0
CAGL0L12936g2.152ON60054216410.0
NDAI0B043402.152ON66453915890.0
Ecym_82042.152ON59752915780.0
Suva_15.3142.152ON64454015770.0
Skud_8.1782.152ON63854015710.0
Smik_8.1952.152ON63553515680.0
ABR131W2.152ON59452915630.0
KLLA0F24046g2.152ON60452815520.0
YHR117W (TOM71)2.152ON63954015510.0
NCAS0G024802.152ON59652515470.0
NDAI0F028102.152ON60962215460.0
CAGL0L04048g2.152ON58762413381e-178
Ecym_44133.481ON5101521672e-11
ACR005W6.21ON3271241596e-11
NCAS0G008105.617ON584871627e-11
AAR083C3.481ON5381521573e-10
NDAI0B057903.481ON5231611555e-10
Suva_8.805.617ON586871475e-09
SAKL0G07084g5.617ON585851475e-09
TDEL0A048405.617ON576871465e-09
TPHA0J003406.21ON3381071446e-09
CAGL0H08195g5.617ON583871449e-09
Smik_15.2055.617ON589951441e-08
Kwal_55.199355.617ON593871441e-08
TBLA0E033005.617ON582801422e-08
YOR027W (STI1)5.617ON589951422e-08
KAFR0C058905.617ON575911412e-08
NCAS0H008306.21ON3381141383e-08
Kpol_1018.695.617ON590781403e-08
Ecym_30256.21ON318981331e-07
KLLA0A07062g5.617ON581871341e-07
KNAG0A079003.481ON5121591342e-07
Skud_15.1925.617ON589901332e-07
Kpol_1037.266.21ON3421041303e-07
TBLA0G010506.21ON3501301303e-07
Kpol_1032.86.21ON3431091303e-07
KLTH0F14542g3.481ON5131051313e-07
TPHA0D028805.617ON585871314e-07
AEL224W5.617ON580931314e-07
SAKL0E01210g6.21ON323981285e-07
KAFR0L004106.21ON3311071285e-07
TDEL0D055003.481ON5121781305e-07
NDAI0F009105.617ON583951305e-07
ZYRO0A05676g5.617ON572871296e-07
CAGL0E02739g6.21ON3431201269e-07
KLLA0D01155g6.21ON335831261e-06
KLTH0E02178g5.617ON593951271e-06
CAGL0D05060g3.481ON5101501261e-06
KAFR0B066103.481ON5111751233e-06
TBLA0A072706.21ON373951223e-06
KNAG0B032005.617ON579871215e-06
NCAS0A00490singletonON620981215e-06
NDAI0D008106.21ON3491201189e-06
TDEL0E027505.352ON5641901199e-06
Kwal_56.224336.21ON3221111189e-06
Kwal_27.118908.506ON3341621171e-05
Suva_15.1826.21ON3461121171e-05
KNAG0M011706.21ON3391061162e-05
Kpol_513.28.506ON374971162e-05
Suva_7.4083.481ON5131051162e-05
TBLA0C039503.481ON5121381162e-05
Ecym_55825.617ON584871162e-05
NCAS0F034903.481ON5121541153e-05
TDEL0G044806.21ON3431141143e-05
Kwal_55.211753.481ON5111011144e-05
NDAI0I022406.21ON350701125e-05
TPHA0D032203.481ON5131051126e-05
YOR007C (SGT2)6.21ON3461441116e-05
TPHA0D038606.328ON120731037e-05
Smik_15.1766.21ON3451441107e-05
ZYRO0C07788g6.21ON3341401108e-05
SAKL0F03102g3.481ON513951101e-04
YGR123C (PPT1)3.481ON5131051101e-04
Ecym_20906.328ON172711041e-04
TBLA0H033808.506ON375971082e-04
KLLA0B10912g3.481ON512971072e-04
CAGL0H07095g5.352ON6611461073e-04
Smik_4.5795.352ON6671121073e-04
KLTH0C11220g6.21ON3271151044e-04
Skud_2.2828.506ON3851031054e-04
Smik_6.2153.481ON5131051046e-04
YBR155W (CNS1)8.506ON385871037e-04
Skud_15.1686.21ON3481041037e-04
TDEL0B013108.506ON3801461037e-04
Skud_7.4323.481ON5131051038e-04
YDR320C (SWA2)5.352ON6681131038e-04
TBLA0I023106.328ON11662958e-04
KNAG0C055005.352ON5851221039e-04
CAGL0H07425g8.506ON380981010.001
KLLA0B09966g8.506ON370981010.001
ZYRO0F08624g8.506ON3791441010.001
TPHA0L014208.506ON3741261010.001
Smik_2.2958.506ON3851491010.001
NCAS0D026706.21ON3511381000.002
NDAI0C043205.352ON7061431010.002
KAFR0C018505.352ON646104990.003
KLLA0B10197g5.352ON621121990.003
TPHA0E011105.352ON693111990.003
Kpol_339.135.352ON686112980.003
TDEL0A074306.328ON12462900.004
NCAS0F028705.352ON700131960.006
SAKL0A01672g6.328ON12861900.006
ZYRO0B04224g3.481ON513122960.006
Suva_2.4895.352ON659112960.006
AGL268C8.506ON379150950.007
NDAI0C052908.506ON37998940.009
KLTH0E11748g8.506ON37897930.010
CAGL0C01903g7.412ON769170940.011
SAKL0H10934g8.506ON380125920.013
NCAS0A112003.367ON90759930.014
KNAG0H006103.367ON973127920.018
TDEL0C050903.367ON75956920.019
NCAS0D045006.328ON12158850.020
ZYRO0C16522g3.367ON97459920.020
Kpol_1018.1067.412ON753169910.023
KAFR0L018707.412ON712112900.028
KAFR0J025706.328ON12160840.029
CAGL0D01364g3.367ON114859900.031
Suva_4.4058.506ON38583890.031
KAFR0H008703.367ON88759900.033
CAGL0G10087g7.546ON1411104900.033
Smik_2.2543.367ON102059890.039
Kpol_172.23.367ON41883880.046
NDAI0I004406.328ON12867830.046
YBR112C (CYC8)3.367ON96659890.047
KNAG0I025206.328ON11789820.048
Suva_4.3613.367ON96359890.049
Skud_2.2403.367ON98459880.057
TDEL0C027207.412ON700217870.068
Kpol_1028.516.328ON11761810.071
KAFR0E029808.506ON38097860.073
TBLA0H015203.367ON68985870.074
TPHA0M016303.367ON104356870.078
Ecym_25598.506ON370111850.086
KLTH0C06204g7.412ON627185860.10
Kpol_1050.1127.546ON1360104850.14
Kwal_34.159775.352ON597130840.15
TPHA0M002706.21ON37791840.15
KLTH0F10428g3.367ON795139840.15
KLTH0H14872g5.352ON623112840.15
TPHA0E007407.412ON746148840.15
TBLA0H019705.352ON840108840.16
NCAS0A153007.546ON1398129840.17
AAR054C6.328ON13364790.18
NCAS0B024008.506ON38097820.21
Kwal_27.107407.412ON628185830.23
SAKL0G19712g2.665ON72171820.25
Suva_3.956.328ON11170760.26
NDAI0A051003.367ON100759820.28
KLTH0H14234g1.456ON39580810.33
KLLA0B09262g3.367ON94183810.36
KLTH0E15444gna 1ON54965810.38
Kpol_1006.43.367ON73259810.40
TPHA0G002407.546ON1430102810.41
SAKL0F16236g7.546ON1408220810.42
ADL344W3.367ON91083800.45
ZYRO0B03828g7.412ON727188790.65
YCR060W (TAH1)6.328ON11170730.66
KNAG0B022407.412ON739168790.68
SAKL0B07986g3.367ON88083790.69
KNAG0A039508.506ON38697780.71
Ecym_56372.665ON71771790.71
ACR168W2.665ON70771790.73
KAFR0B002507.546ON1420111790.75
KNAG0F040107.546ON1418112790.76
ZYRO0C03564g3.5ON109664780.80
Kwal_23.36703.367ON80283780.93
TBLA0F012303.367ON118983780.99
ZYRO0D10186g5.352ON635112771.1
NCAS0C043503.5ON1087556771.3
Kwal_23.54087.546ON141069771.4
Suva_2.347.412ON763248761.4
CAGL0K09240g6.328ON14277721.6
KLTH0A00638g7.546ON1411134761.6
SAKL0C02816g1.88ON111890751.8
Ecym_34593.367ON111583751.9
Smik_2.367.412ON751248742.4
KLLA0E20857g7.412ON710175742.6
Kpol_354.68.92ON480102732.7
NCAS0E024907.412ON809110742.9
NDAI0E040407.412ON783173733.1
NDAI0F004005.689ON76488733.1
ABR206W5.72ON614173733.6
NDAI0J001307.546ON1403129733.6
NDAI0H026607.103ON49561724.1
Skud_13.1792.574ON378194724.1
KAFR0F013801.456ON391189724.2
KNAG0H001602.665ON78091724.2
YBL084C (CDC27)7.412ON758248724.6
Ecym_71427.412ON675163724.7
CAGL0L00407g6.278ON137168724.7
SAKL0H02244g5.72ON628121724.8
TDEL0F009708.136ON76243715.1
Kpol_1014.323.5ON1084317725.1
SAKL0D02684g3.296ON69857715.2
KLLA0A07579g5.689ON720149715.3
AGL294W7.412ON65669715.8
ZYRO0D12364g5.519ON80993715.8
Suva_8.1295.689ON74149716.4
ZYRO0G12562g3.296ON686141706.5
SAKL0F12936g7.412ON632165707.1
TBLA0A100106.120ON54262708.1
Kpol_1043.605.689ON70642708.2
Kwal_56.244877.313ON370148698.9
SAKL0G08822g5.352ON582110699.0
CAGL0H06765g5.717ON1294211709.2
NDAI0G037103.5ON112197699.2
TBLA0B079705.72ON68777699.6
NDAI0C033505.72ON64983699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B07010
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...  1209   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   702   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   692   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   679   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   679   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   665   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   663   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   661   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   660   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   660   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   658   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   658   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   657   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   650   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   650   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   636   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   616   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   612   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   612   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   609   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   608   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   606   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   602   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   602   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   600   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   600   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   520   e-178
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    69   2e-11
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    66   6e-11
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    67   7e-11
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    65   3e-10
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    64   5e-10
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    61   5e-09
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    61   5e-09
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    61   5e-09
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    60   6e-09
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    60   9e-09
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    60   1e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    60   1e-08
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    59   2e-08
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    59   2e-08
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    59   2e-08
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    58   3e-08
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    59   3e-08
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    56   1e-07
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    56   1e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    56   2e-07
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    56   2e-07
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    55   3e-07
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    55   3e-07
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    55   3e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    55   3e-07
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    55   4e-07
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    55   4e-07
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    54   5e-07
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    54   5e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    55   5e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     55   5e-07
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    54   6e-07
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    53   9e-07
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    53   1e-06
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    54   1e-06
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    53   1e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    52   3e-06
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    52   3e-06
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    51   5e-06
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       51   5e-06
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    50   9e-06
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    50   9e-06
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    50   9e-06
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    50   1e-05
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    50   1e-05
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    49   2e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    49   2e-05
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    49   2e-05
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    49   2e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    49   2e-05
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    49   3e-05
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    49   3e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    49   4e-05
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    48   5e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    48   6e-05
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    47   6e-05
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    44   7e-05
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    47   7e-05
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    47   8e-05
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    47   1e-04
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    47   1e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    45   1e-04
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    46   2e-04
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    46   2e-04
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    46   3e-04
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    46   3e-04
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    45   4e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   4e-04
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    45   6e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    44   7e-04
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    44   7e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    44   7e-04
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    44   8e-04
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    44   8e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    41   8e-04
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    44   9e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   0.001
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    44   0.001
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    44   0.001
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    44   0.001
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    44   0.001
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    43   0.002
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    44   0.002
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    43   0.003
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...    43   0.003
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    43   0.003
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    42   0.003
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    39   0.004
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    42   0.006
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    39   0.006
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    42   0.006
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    42   0.006
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    41   0.007
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    41   0.009
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    40   0.010
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    41   0.011
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    40   0.013
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    40   0.014
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    40   0.018
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    40   0.019
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    37   0.020
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    40   0.020
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    40   0.023
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    39   0.028
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    37   0.029
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    39   0.031
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.031
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    39   0.033
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    39   0.033
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.039
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    39   0.046
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    37   0.046
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    39   0.047
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    36   0.048
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    39   0.049
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    39   0.057
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    38   0.068
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    36   0.071
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    38   0.073
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    38   0.074
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    38   0.078
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    37   0.086
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    38   0.10 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    37   0.14 
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...    37   0.15 
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    37   0.15 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    37   0.15 
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    37   0.15 
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    37   0.15 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.16 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            37   0.17 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    35   0.18 
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    36   0.21 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.23 
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    36   0.25 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    34   0.26 
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    36   0.28 
KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} simi...    36   0.33 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    36   0.36 
KLTH0E15444g Chr5 complement(1369017..1370666) [1650 bp, 549 aa]...    36   0.38 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    36   0.40 
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    36   0.41 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    36   0.42 
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    35   0.45 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.65 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    33   0.66 
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    35   0.68 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    35   0.69 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    35   0.71 
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    35   0.71 
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    35   0.73 
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    35   0.75 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    35   0.76 
ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} simil...    35   0.80 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    35   0.93 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    35   0.99 
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    34   1.1  
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    34   1.3  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    34   1.4  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    34   1.4  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    32   1.6  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    34   1.6  
SAKL0C02816g Chr3 complement(264072..267428) [3357 bp, 1118 aa] ...    33   1.8  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   1.9  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    33   2.4  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    33   2.6  
Kpol_354.6 s354 complement(11315..12757) [1443 bp, 480 aa] {ON} ...    33   2.7  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    33   2.9  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    33   3.1  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    33   3.1  
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    33   3.6  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    33   3.6  
NDAI0H02660 Chr8 (657972..659459) [1488 bp, 495 aa] {ON} Anc_7.1...    32   4.1  
Skud_13.179 Chr13 (308649..309785) [1137 bp, 378 aa] {ON} YMR024...    32   4.1  
KAFR0F01380 Chr6 complement(272714..273889) [1176 bp, 391 aa] {O...    32   4.2  
KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}...    32   4.2  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    32   4.6  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   4.7  
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    32   4.7  
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    32   4.8  
TDEL0F00970 Chr6 (168428..170716) [2289 bp, 762 aa] {ON} Anc_8.1...    32   5.1  
Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON} (58546...    32   5.1  
SAKL0D02684g Chr4 (221650..223746) [2097 bp, 698 aa] {ON} conser...    32   5.2  
KLLA0A07579g Chr1 complement(679469..681631) [2163 bp, 720 aa] {...    32   5.3  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    32   5.8  
ZYRO0D12364g Chr4 (1037070..1039499) [2430 bp, 809 aa] {ON} simi...    32   5.8  
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    32   6.4  
ZYRO0G12562g Chr7 complement(992906..994966) [2061 bp, 686 aa] {...    32   6.5  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   7.1  
TBLA0A10010 Chr1 complement(2461989..2463617) [1629 bp, 542 aa] ...    32   8.1  
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    32   8.2  
Kwal_56.24487 s56 (1016327..1017439) [1113 bp, 370 aa] {ON} YLR2...    31   8.9  
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...    31   9.0  
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...    32   9.2  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    31   9.2  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    31   9.6  
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    31   9.7  

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 1209 bits (3128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/625 (95%), Positives = 595/625 (95%)

Query: 1   MSSNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQQTHTSLEGEEDGNSTGRNPV 60
           MSSNDHPVGGFLTRNR                FYYYHHLQQTHTSLEGEEDGNSTGRNPV
Sbjct: 1   MSSNDHPVGGFLTRNRTAIVATVAAGSAAIGAFYYYHHLQQTHTSLEGEEDGNSTGRNPV 60

Query: 61  NDEAHLSXXXXXXXXXXXXXXATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKK 120
           NDEAHLS              ATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKK
Sbjct: 61  NDEAHLSKNQKKKQRKKHKKKATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKK 120

Query: 121 ISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTK 180
           ISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTK
Sbjct: 121 ISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTK 180

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIK 240
           ALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIK
Sbjct: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIK 240

Query: 241 VLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFK 300
           VLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFK
Sbjct: 241 VLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFK 300

Query: 301 RTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTD 360
           RTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTD
Sbjct: 301 RTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTD 360

Query: 361 IEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQD 420
           IEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQD
Sbjct: 361 IEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQD 420

Query: 421 YPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYA 480
           YPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYA
Sbjct: 421 YPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYA 480

Query: 481 EILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLME 540
           EILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLME
Sbjct: 481 EILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLME 540

Query: 541 KACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQK 600
           KACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQK
Sbjct: 541 KACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQK 600

Query: 601 RIRADPVISAKVDEALASYRSQGVI 625
           RIRADPVISAKVDEALASYRSQGVI
Sbjct: 601 RIRADPVISAKVDEALASYRSQGVI 625

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/623 (57%), Positives = 452/623 (72%), Gaps = 25/623 (4%)

Query: 3   SNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQQTHTSLEGEEDGNSTGRNPVND 62
           S+D+ V  F++RN+                +YYY   Q+   +L+ +E G          
Sbjct: 2   SSDNSVSSFVSRNKTAIIATAAAGSAAIGAYYYYRQAQRA--ALDEDEKG-------AEG 52

Query: 63  EAHLSXXXXXXXXXXXXXXATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKIS 122
                               TP            YP   + +P +  I  L  E ++  +
Sbjct: 53  SESSKKKKKNKKKKSGENGGTP-----------VYPVGQNGEPLLENIEELSQELRETYA 101

Query: 123 MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKAL 182
             LKD+GN++FK KDY NA+KYYN AL + KDP+FYSNISACYVSLGQLDKV+E+STKAL
Sbjct: 102 TALKDRGNEFFKKKDYDNALKYYNYALVVKKDPVFYSNISACYVSLGQLDKVVENSTKAL 161

Query: 183 ELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVL 242
           EL P+YSKALLRRASANESLENY+DA+FDLSVLSLNGD++G+SIEP+LERNLNKQA+ VL
Sbjct: 162 ELKPDYSKALLRRASANESLENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVL 221

Query: 243 NERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRT 302
            +++    G+N  QQL PS T+L SFFGIF PE TF NYNEND+ADV L  GL +L+KR+
Sbjct: 222 KDKL----GNNVSQQL-PSNTALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRS 276

Query: 303 DQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIE 362
            +GY  AD+ FVK++S F  +L++ P D  L EKTAIALE+NGIF+FLKND L A  DIE
Sbjct: 277 SEGYKLADEAFVKSASFFTNKLSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIE 336

Query: 363 KAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422
           KAI   PR+NSY+Y+ALI ADK  ++EY +YFDKA+ L+P+    YYHRGQ+Y+IT  Y 
Sbjct: 337 KAIQLHPRLNSYIYMALIMADKGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYE 396

Query: 423 KAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEI 482
           KA  +F+KAKE DE NIFPYIQLACLAYRE+ FD C+ LF E ++KFPT PEVP FYAEI
Sbjct: 397 KAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEI 456

Query: 483 LADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKA 542
           L DKGD   A+KQY+IA RLE+A   IHVG+APLVGKAT+LARQP++ N +EAT L+E+A
Sbjct: 457 LGDKGDLEAALKQYEIAKRLEEALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEA 516

Query: 543 CEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRI 602
           C  DP SEQA VGLAQLKLQ EEVD AI LFE+AA+L+RT+DEK+QA TFAEAAK+QKRI
Sbjct: 517 CRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRI 576

Query: 603 RADPVISAKVDEALASYRSQGVI 625
           +ADPV+SAK++E LA+YR+QG++
Sbjct: 577 KADPVVSAKIEETLAAYRAQGMM 599

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/623 (56%), Positives = 447/623 (71%), Gaps = 20/623 (3%)

Query: 3   SNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQQTHTSLEGEEDGNSTGRNPVND 62
           S+D+ V GF++RN+                + YY  LQ    S       +  G +P   
Sbjct: 2   SSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGS------DDKKGESPDGT 55

Query: 63  EAHLSXXXXXXXXXXXXXXATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKIS 122
            A                      ++ +     SYP ++  +P +  +  +  E+++  S
Sbjct: 56  AASKKKRKNKKKKQG---------SSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQKESWS 106

Query: 123 MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKAL 182
             LKDKGN++FK KDY NA+KYY+ AL L KDP+FYSNISACYVS+ QLDKV+E+STKAL
Sbjct: 107 TALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166

Query: 183 ELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVL 242
           EL P+YSKALLRRASANESLENY DA+FDLSVLSLNGD+ G+SIEP+LERNLNKQA+ VL
Sbjct: 167 ELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVL 226

Query: 243 NERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRT 302
            +++ +     ++ QLLPS T+L SFFGIF PE  F NY+E  +AD +L  GL NL+KR+
Sbjct: 227 KDKLGQ-----QKNQLLPSDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRS 281

Query: 303 DQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIE 362
            +GY  AD+ F +A   + +    N  D  L EK AIALE+ GIFRFLKND LGA  D++
Sbjct: 282 SEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQ 341

Query: 363 KAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422
           KAI   PRVNSY+Y+ALI ADK  ++EY ++FDKA++L+P + +VYYHRGQ+YFIT  Y 
Sbjct: 342 KAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYE 401

Query: 423 KAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEI 482
           KA  +F+KAK+L+E NIFPYIQLACLAYREN FD C+ LF E ++KF T PEVP F+AEI
Sbjct: 402 KAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEI 461

Query: 483 LADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKA 542
           LADKGD   A+KQYDIA RLE+A   IHVGI+PLVGKAT+LARQP++ N  EAT+L+E+A
Sbjct: 462 LADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEA 521

Query: 543 CEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRI 602
           C  DPRSEQ  VGLAQLKLQ E++D AI+LFE+AA L+RT+DEK+QA TFAEAAK+QKRI
Sbjct: 522 CAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRI 581

Query: 603 RADPVISAKVDEALASYRSQGVI 625
           RADP++SAK++E LA+Y++QGVI
Sbjct: 582 RADPLVSAKIEETLAAYKAQGVI 604

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/538 (62%), Positives = 428/538 (79%), Gaps = 5/538 (0%)

Query: 88  TATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNL 147
           T+ +   ++YP +++ +P +  I  L  E+++K +M LKDKGN++FK K + +AIKYYNL
Sbjct: 68  TSGSPTASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNL 127

Query: 148 ALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSD 207
           AL+L KDP+FYSN SACYVS+GQL+KV+E +T AL+L  +YSK LLRRASANESL NY+D
Sbjct: 128 ALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYAD 187

Query: 208 ALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVS 267
           A+FDLS LSL GD++GASIEP+LERN+NKQA+ VL E++ +     K+   LPS TSL S
Sbjct: 188 AMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKLEE-----KKDHRLPSNTSLAS 242

Query: 268 FFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKN 327
           FFGIF+PE +F+NY+E+ +AD  LL GLTNL+KRT +GY  AD++F KA++ +   L ++
Sbjct: 243 FFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEES 302

Query: 328 PKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTS 387
           P+++ L +K AIALE+ GIF+FLKND L A  D+++A+ + PRVNSY+YLALI ADK  +
Sbjct: 303 PENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQA 362

Query: 388 QEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLAC 447
            EY + FDKALEL+P+  +VYYHRGQ+YFITQ Y  A  +F+KAKE +E NIFPYIQLAC
Sbjct: 363 TEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLAC 422

Query: 448 LAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQK 507
           LAYREN F+ C+ LF E R+KFPT PEVP FYAEIL+DKGD A A KQY+IA +LE A  
Sbjct: 423 LAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALD 482

Query: 508 NIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVD 567
            IHVGIAPLVGKAT+LAR+P + N  EATQ  E+ACE DPRSEQA +GLAQLKLQ EEVD
Sbjct: 483 GIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVD 542

Query: 568 LAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
            AI LFE+AADL+R+ DEK+QA TFAEA KIQK+IRADP+ISAK++E LA+YR+QG+I
Sbjct: 543 EAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/529 (61%), Positives = 423/529 (79%), Gaps = 5/529 (0%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP + + +PD+    +   E+++  S+ LKDKGN++FK + Y +A+KYYN ALDL +DP+
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSNISACYVSLG L+KV+ESSTKALEL P+YSKALLRRASANE+LEN+++A+FDLSVLS
Sbjct: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           LNGD++ ASIEP+LERNLNKQA++VL ++M     S+  +Q LPS T L SFFGIF PE 
Sbjct: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKM-----SSDAKQQLPSNTFLASFFGIFTPET 248

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336
           T +N++E+++ADVELL  L NL+KR  + YL AD++F KA+  ++++L  NP D+ L EK
Sbjct: 249 TLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEK 308

Query: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396
           TA ALEYNGIF+FLKND LG+  DI+++I   PRVN+Y+Y ALI ADK  S+ Y  +FDK
Sbjct: 309 TATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDK 368

Query: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456
           AL+++P+S  VYYHRGQ++F++Q Y KA  +FEKAKE D +NIFPYIQLACL Y E  FD
Sbjct: 369 ALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFD 428

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516
            C+ LF E ++KFPT PEVP FYAE+L DKGDF  A KQYDIA RLE++   IHVG++PL
Sbjct: 429 DCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPL 488

Query: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
           VGKAT+LARQP + NL E+T L+E+AC++D RSEQA +GLAQLKLQ EE+D AI LFE+A
Sbjct: 489 VGKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEA 548

Query: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           +DL+R M+EK+QA TFAEA+K+QK+IRADPV++AK+   LA+YR QG+I
Sbjct: 549 SDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/530 (60%), Positives = 413/530 (77%), Gaps = 5/530 (0%)

Query: 96  SYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP 155
           SYP N+  +PD+  +  L  E++ K +M LKDKGN++FK K Y  AI+YY+ A+++ +DP
Sbjct: 69  SYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDP 128

Query: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
           +FYSN SACYVSLGQ +KV+E +T AL+L P+YSK LLRRASANESL N++DA+FDLS +
Sbjct: 129 VFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAV 188

Query: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275
           SL GD+SGASIEP+LERN+NKQ++ VL E++ K     +++  LPS TSL SFFGIF PE
Sbjct: 189 SLYGDFSGASIEPLLERNMNKQSMLVLKEKLEK-----QQEYKLPSNTSLASFFGIFQPE 243

Query: 276 LTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLE 335
            TF+NY++N +AD  LL GLTNL+KRT  GY  AD +F KA   F   L +NP+D  L  
Sbjct: 244 TTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKR 303

Query: 336 KTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFD 395
           K AIALE+ GIF+FLKND + A  D++KA+ +FPR N+Y+Y+ALI ADK  + EY   F+
Sbjct: 304 KAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFE 363

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDF 455
           KAL+L+P   +VYYHRGQ+YFITQ + +A  +FEKAKEL E+NIFPYIQLACL YRE  F
Sbjct: 364 KALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKF 423

Query: 456 DRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAP 515
           D  + LF E R+KFPT PEVP FYAE L+DKGD A A KQYDIA +LE A   IHVG++P
Sbjct: 424 DDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSP 483

Query: 516 LVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK 575
           L+GKAT+L+R+P++ N  EATQL EKAC+ DPRSEQA +GLAQLKLQ E++D AI LFE+
Sbjct: 484 LIGKATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEE 543

Query: 576 AADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           AADL+R+ DEK+QA TFAEA KIQK+IRADPV+SAK++E LA+YR+QG+I
Sbjct: 544 AADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/628 (54%), Positives = 451/628 (71%), Gaps = 28/628 (4%)

Query: 1   MSSNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQQTHTSLEGEEDGNSTGRNPV 60
           MS++D  VGGF+ RN+                +YYY  LQ+                   
Sbjct: 1   MSASDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQRQI----------------- 43

Query: 61  NDEAHLSXXXXXXXXXXXXXXATPDQTTA---TADVLTSYPTNDSNDPDMIQITSLPLEE 117
            D++  S              +T +++ +   TA V+  YP   + +PD+    S   E 
Sbjct: 44  -DDSSSSKKKKKKHSKKKKSTSTDEKSNSKNETAKVI--YPVASNGEPDLSGKDSFSDEL 100

Query: 118 QKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIES 177
           ++K +M LKDKGN YFK +D+ NA+KYYN AL L +DP+FYSNISACYVSLGQL+KV+ES
Sbjct: 101 KEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVES 160

Query: 178 STKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQ 237
           ST+AL+L  +YSKALLRRASA ESL NY DA+ DLSVLSLNGD++GASIEP+LERNLNKQ
Sbjct: 161 STEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQ 220

Query: 238 AIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTN 297
           A++VL E++     +  + QLLPS TSL SFFG+F PE++  N+NEN +++ ELL GLTN
Sbjct: 221 AMQVLKEKI-----AENKPQLLPSNTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTN 275

Query: 298 LFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGA 357
           L+ RT+ GYL AD++F KA  L  +E  +N ++  + EK AIALEYNGI +FLKND L A
Sbjct: 276 LYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYAIALEYNGILKFLKNDPLDA 335

Query: 358 QTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFI 417
             DI+KAI  FPRVNSY+Y +LI ADK  ++E  K FD A+ L+  + + YYHRGQLYF+
Sbjct: 336 HNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAINLDATNAATYYHRGQLYFL 395

Query: 418 TQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPT 477
           TQ Y KA ++F+KAKELDE+NI PYIQLACLAY+EN F+ C+ LF E R+KFPT PEVP 
Sbjct: 396 TQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCETLFSEARRKFPTAPEVPN 455

Query: 478 FYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQ 537
           FYA++L ++ +F  A+KQYDI+ +LE+A + IHVGIAP++GKAT+LAR P + NL E+T+
Sbjct: 456 FYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIGKATLLARNPIVENLLESTE 515

Query: 538 LMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAK 597
           L E+AC++DPRSEQA +GLAQLKLQ EEVD AI LFE+AA L+R MDEK+QA TFAEA+K
Sbjct: 516 LFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEEAAFLARNMDEKLQATTFAEASK 575

Query: 598 IQKRIRADPVISAKVDEALASYRSQGVI 625
           +QK++R+DPVI+ K+ E LA+Y+ QG++
Sbjct: 576 VQKKVRSDPVINQKIQETLAAYQQQGLM 603

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/559 (58%), Positives = 422/559 (75%), Gaps = 15/559 (2%)

Query: 82  ATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNA 141
           A   + TA+      YP + + +PD  +  +   EE+ K ++ LKDKGN+YF+ K Y +A
Sbjct: 59  AEGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDA 118

Query: 142 IKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANES 201
           IKYYN AL+L +DP+FYSN+SACYVS+G L KV+E STKALE+ P+YSK LLRRASANE 
Sbjct: 119 IKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEG 178

Query: 202 LENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNK------- 254
           L N++DA+FDLSVLSLNGD++ ASIEP+LERNLNKQA+  L E+   +  +         
Sbjct: 179 LGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELST 238

Query: 255 --------EQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGY 306
                   +Q+ LPS TS+ SFFGIF PELTF NY+E ++AD EL+ GL NL+KR+ + Y
Sbjct: 239 QPPKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESY 298

Query: 307 LDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIG 366
             AD++F KA+ LF E+L K+ +D+ L EK AI+LE+ GIF+FLKND LGA  DI+KAI 
Sbjct: 299 DRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIE 358

Query: 367 FFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKV 426
            FPRVNSY+Y+ALI AD++ S EY  YFDKAL+LNP++ SVYYHRGQ+ FI Q+Y +A  
Sbjct: 359 LFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGK 418

Query: 427 EFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADK 486
           +F+KAKELD  NIFPYIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK
Sbjct: 419 DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDK 478

Query: 487 GDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEID 546
            DF  A+KQYD+A  LE     I+VGIAPLVGKAT+L R P + N  EAT L+EKA ++D
Sbjct: 479 NDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLD 538

Query: 547 PRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADP 606
           PRSEQA +GLAQ+KLQ E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+Q++IR+DP
Sbjct: 539 PRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDP 598

Query: 607 VISAKVDEALASYRSQGVI 625
           +++AK+ E LA  R QG++
Sbjct: 599 ILAAKIQETLAKLREQGLM 617

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/536 (62%), Positives = 408/536 (76%), Gaps = 9/536 (1%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP   S +PD+ Q+ S   E+++  ++ LKDKGN+ FK K    AIKYY  AL+  KDP+
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FY+NISACYVSL   +KV+E+  KALEL P+YSK LLRRA+  E++EN++DA+FDLSVLS
Sbjct: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           LN D+SGASIEP+LERNLNKQA+K+L ER+      +K +Q LPS TS+ SFFGIF PE 
Sbjct: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENT--QDKFEQPLPSDTSMASFFGIFKPET 258

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLL-- 334
            F+ Y+E  +AD  L TGL  LF  T  G++ AD  F +A + + E  +K   ++ L   
Sbjct: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318

Query: 335 --EKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392
             EK AIALEY+GIF+FLKND++GAQ  + +AI  FPRVNSY+YLAL SAD   S EY  
Sbjct: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452
            FDKALELNP+S + YYHRGQLYFITQDY KAK +F KAKELD  NIF YIQLACL YRE
Sbjct: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438

Query: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEK---AQKNI 509
            D D C+KLFDE R+KFP  PEVPTFYAEILADKGDF+ A KQYD+A RLE+   A+  I
Sbjct: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498

Query: 510 HVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLA 569
            VG+APLVGKATVLARQP+  N  EAT L E+AC+ DPRSEQA VGLAQL LQ E+VD A
Sbjct: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558

Query: 570 IELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           I++FE+AADL+RT DEK+QA+TFAEAAK+QK+IRADP+I AKV+EALA YR+QG+I
Sbjct: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/538 (61%), Positives = 414/538 (76%), Gaps = 6/538 (1%)

Query: 87  TTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYN 146
           + AT D    YP  D+ +P++        EE++K S+ LKDKGN  FKA  +  AIKYYN
Sbjct: 76  SPATTDGKPIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYN 135

Query: 147 LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYS 206
            A++L ++PIFYSN+SACYVSL +L+++I+   KALEL P+YSK LLRRA+ANE LENY+
Sbjct: 136 WAIELKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYA 195

Query: 207 DALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLV 266
           DA+FDLSVLSLNGDY+GASIEPILERNLNKQA+ VL +++      N +   LPS TSL 
Sbjct: 196 DAMFDLSVLSLNGDYNGASIEPILERNLNKQAMSVLKDKL-----KNSKDDQLPSDTSLS 250

Query: 267 SFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAK 326
           +FFGIF PEL+F+NY+E + AD ELL GLT+LFKR  + YL ADK+F+ A  L++++L +
Sbjct: 251 AFFGIFKPELSFENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEE 310

Query: 327 NPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKST 386
            P D  L  K +IA EY GIF FLKNDL GA  +I+K+I   PR+NSY+Y ALI ADK  
Sbjct: 311 TPDDTDLKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGE 370

Query: 387 SQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLA 446
           SQ+Y  YFDKAL+L+  S +VYYHR QL F+TQD+ KA V+FEKAKE D TNIFPYIQLA
Sbjct: 371 SQDYLDYFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLA 430

Query: 447 CLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQ 506
           CL YREN FD C+ LF E ++KFPT PEVP FYAE+L DKGDF  A+K Y+ A RLE+A 
Sbjct: 431 CLTYRENKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEAS 490

Query: 507 KN-IHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565
           K+ IHVG+APL+GKAT+LAR+P L NL  A +L+E+A  IDPRSEQA +GLAQLKLQ EE
Sbjct: 491 KDGIHVGVAPLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEE 550

Query: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQG 623
           +D +I LFE++ADL+RTM+EK+QA TFAEAAK+QK IRADP+IS K++E LA+YR+Q 
Sbjct: 551 IDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/623 (53%), Positives = 439/623 (70%), Gaps = 30/623 (4%)

Query: 3   SNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQQTHTSLEGEEDGNSTGRNPVND 62
           S+++ +G F+ RN+                +YYY  LQ+        EDG   G     D
Sbjct: 2   SSENSLGQFVARNKTAIVASVAAGATAVGAYYYYQQLQKKPF-----EDGKEVG-----D 51

Query: 63  EAHLSXXXXXXXXXXXXXXATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKIS 122
           E   S                            S+P ++  +PD+ ++  L  EE+ K +
Sbjct: 52  EPKPSKKKKKGKKKTQG---------------PSFPVDEKGEPDLGKVDELSAEEKDKFA 96

Query: 123 MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKAL 182
           M LKDKGN++FK K + +A+KYY+LA+++ +DP+FYSN SACYVSLGQ +KV+E +T AL
Sbjct: 97  MGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAAL 156

Query: 183 ELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVL 242
           +L P+YSK LLRRASANESL  ++DA+FDLS +SL GD++G+SIEP+LERN+NKQA+ VL
Sbjct: 157 KLKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVL 216

Query: 243 NERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRT 302
            E++ K     +++  LPS TSL SFFGIF PE +F+NY+EN +AD  LL GLTNL+KRT
Sbjct: 217 KEKLEK-----QQEYKLPSNTSLASFFGIFQPETSFENYDENSEADKALLDGLTNLYKRT 271

Query: 303 DQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIE 362
             GY  AD  F KA   +   L  N +D  L +K AIALE+ GIF+FLKND + A  D++
Sbjct: 272 SGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAIALEHVGIFKFLKNDPISAHEDLK 331

Query: 363 KAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422
           KA+ +FPR N+Y+Y+ALI ADK  + EY   F+KALEL+P+  +VYYHRGQ++FITQ + 
Sbjct: 332 KAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQFE 391

Query: 423 KAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEI 482
           +A  +FEKAKEL+E+NIFPYIQLACL YRE  F   + LF E R+KFPT PEVP FYAE 
Sbjct: 392 QAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAET 451

Query: 483 LADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKA 542
           L+DKGD A A K+YDIA +LE A   IHVG++PL+GKAT+L+R+P++ N  EAT+L E+A
Sbjct: 452 LSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGKATLLSREPSVENFIEATRLFEQA 511

Query: 543 CEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRI 602
           CE DPRSEQA +GLAQLKLQ E++D AI LFE+AADL+R+ DEK+QA TFAEA KIQK+I
Sbjct: 512 CENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKI 571

Query: 603 RADPVISAKVDEALASYRSQGVI 625
           RADP++SAK++E LA+YR+QG+I
Sbjct: 572 RADPIVSAKIEETLAAYRAQGMI 594

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/559 (58%), Positives = 423/559 (75%), Gaps = 16/559 (2%)

Query: 83  TPDQTTATADVLTS-YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNA 141
           T D + +TA+  T  YP + + DPD     +   EE+ + ++ LKDKGN++F+ K Y +A
Sbjct: 59  TKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDA 118

Query: 142 IKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANES 201
           IKYYN AL+L  DP+FYSN+SACYVS+G L KV+E STKALEL P+YSK LLRRASANE 
Sbjct: 119 IKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEG 178

Query: 202 LENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKM-----------T 250
           L N++DA+FDLSVLSLNGD++ ASIEP+LERNLNKQA+  L E+   +           T
Sbjct: 179 LGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELST 238

Query: 251 GSNKE----QQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGY 306
            + KE     + LPS TS+ SFFGIF PELTF NY+E+++AD +L+ GLTNL+KR+ + Y
Sbjct: 239 QAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESY 298

Query: 307 LDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIG 366
             AD++F KA  LF E+L KN +D+   EK AI+LE+ GIF+FLKND LGA  DI+KAI 
Sbjct: 299 DKADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIE 358

Query: 367 FFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKV 426
            FPRVNSY+Y+ALI AD++ S EY  YFDKAL+L+ ++ SVYYHRGQ+ FI Q+Y +A  
Sbjct: 359 LFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGK 418

Query: 427 EFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADK 486
           +F+KAKELD  NIFPYIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK
Sbjct: 419 DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDK 478

Query: 487 GDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEID 546
            DF  A+KQYD+A  LE     I+VGIAPLVGKAT+L R P + N  EAT L+E+A ++D
Sbjct: 479 NDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLD 538

Query: 547 PRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADP 606
           PRSEQA +GLAQ+KLQ E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+QKRIR+DP
Sbjct: 539 PRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDP 598

Query: 607 VISAKVDEALASYRSQGVI 625
           +++AK+ E LA  R QG++
Sbjct: 599 ILAAKIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/544 (59%), Positives = 416/544 (76%), Gaps = 15/544 (2%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP + + +PD     +   EE+ K ++ LKDKGN++F+ K Y +AIKYYN AL+L +DP+
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPV 133

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSN+SACYVS+G L KV+E STKALEL P+YSK LLRRASANE L  ++DA+FDLSVLS
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLS 193

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKM-----------TGSNKE----QQLLPS 261
           LNGD++ ASIEP+LERNLNKQA+  L E+   +           T   KE    Q+ LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPS 253

Query: 262 TTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFM 321
            TS+ SFFGIF PELTF NY+E+++AD EL+ GL+NL+KR+ + Y  AD++F KA+ LF 
Sbjct: 254 VTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFE 313

Query: 322 EELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALIS 381
           E+L KN +D+ L EK AI+LE+ GIF+FLKND LGA  DI+KAI  FPRVNSY+Y+ALI 
Sbjct: 314 EQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 382 ADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFP 441
           AD++ S EY  YFDKAL+L+ ++ SVYYHRGQ+ FI Q+Y +A  +F+KAKELD  NIFP
Sbjct: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 442 YIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATR 501
           YIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK DF  A+KQYD+A  
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 502 LEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKL 561
           LE     I+VGIAPLVGKAT+L R P + N  EAT L+EKA ++DPRSEQA +GLAQ+KL
Sbjct: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 562 QNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRS 621
           Q E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+Q+RIR+DPV++ K+ E LA  R 
Sbjct: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLRE 613

Query: 622 QGVI 625
           QG++
Sbjct: 614 QGLM 617

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/529 (61%), Positives = 403/529 (76%), Gaps = 3/529 (0%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           +P  ++ +PD   + +L  +++ K +++LKDKGN+YFK KDY NA+K+Y+ AL L KDP+
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSN+SACYVSL +LDKVIE STKALEL P+YSKALLRRA+ANE LENYSDA+FDLSVLS
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           LN D++GA+IEP+LERNLNKQAIKVL++   K    +K +  LPS TS+ SFF IF PE+
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQ---KSKNPSKNESELPSNTSMASFFSIFTPEI 259

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336
           +F +Y+E   AD ELL GL  L+      Y  A+ +F K+  L+   L      + + +K
Sbjct: 260 SFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKK 319

Query: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396
            AIALEY GIF FL+NDL+ AQ    ++I   PRVNSY+YLALISADK+   E +KYFD+
Sbjct: 320 FAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDE 379

Query: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456
           AL+L+P+   +YYHRGQL F+TQDY  AK +F KAKELDE NIFPYIQLACL+YRE DF+
Sbjct: 380 ALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFE 439

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516
            CQ  F+  R+KFP  PE+PTF  EILADKGD  LA KQY+   RLE  QK+IHVGIAPL
Sbjct: 440 DCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPL 499

Query: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
           +GKAT LARQP   N  EA++L++ A E DPRSEQAIVGLAQLKLQ E+VD AIELFEKA
Sbjct: 500 IGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKA 559

Query: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           +D SR+MDEK+QA TFAEAAK+QKRIRADPVI AKV+E LA Y +QG +
Sbjct: 560 SDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/544 (58%), Positives = 411/544 (75%), Gaps = 15/544 (2%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP   + +PD  +      EE+ K ++ LKDKGN+YF+ K Y +AIKYYN AL+L +DP+
Sbjct: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSN+SACYVS+G L KV+E STKALEL P+YSK LLRRASANE L N++DA+FDLSVLS
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNK---------------EQQLLPS 261
           LNGD++ ASIEP+LERNLNKQA+  L E+   +  +                 +Q+ LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253

Query: 262 TTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFM 321
            TS+ SFFGIF PELTF N +E+++AD EL+ GL NL+KR+   Y  AD++F KA  LF 
Sbjct: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313

Query: 322 EELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALIS 381
           ++L K+ +D+ + EK AI+LE+ GIF+FLKND LGA  DI KAI  FPRVNSY+Y+ALI 
Sbjct: 314 DQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373

Query: 382 ADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFP 441
           AD++ S EY  YFDKAL+L+ ++ SVYYHRGQ+ FI Q+Y +A  +F+KAKELD  NIFP
Sbjct: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 442 YIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATR 501
           YIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK DF  A+KQYD+A  
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 502 LEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKL 561
           LE   + I+VGIAPLVGKAT+L R P + N  EAT L+EKA ++DPRSEQA +GLAQ+KL
Sbjct: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 562 QNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRS 621
           Q E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+Q+RIR+DPV++ K+ E LA  R 
Sbjct: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613

Query: 622 QGVI 625
           QG++
Sbjct: 614 QGLM 617

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/542 (58%), Positives = 407/542 (75%), Gaps = 6/542 (1%)

Query: 89  ATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLA 148
           AT+D        D   PDM  + +   +++K  +  LKDKGN  FK K + +AI++YN A
Sbjct: 60  ATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHA 119

Query: 149 LDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
           + L++DP+F+SNISACYVSLG LDKV+ESST+ALEL P+YSKALLRRASA E++  Y DA
Sbjct: 120 IKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDA 179

Query: 209 LFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMN-----KMTGSNKEQQLLPSTT 263
           +FD+SVLSLNGD++G+SIEP+LERNLNKQA++VL E M            +E+Q LPS T
Sbjct: 180 MFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNT 239

Query: 264 SLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEE 323
           SL SFFGIF PE     Y+E+++ADV L+ GL  L+  T  GY  AD+ F KA+ L+ E+
Sbjct: 240 SLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQ 299

Query: 324 LAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISAD 383
           LA N  D    EK A ALEY GIF FLKNDL  ++ ++++A+   PRVN+Y+YLAL  AD
Sbjct: 300 LANN-NDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMAD 358

Query: 384 KSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYI 443
           +  S++Y  YF+KA+ L+P++ +VYYHRGQ+YFITQ+Y KA  +F+K+KE D  NIFPYI
Sbjct: 359 RGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYI 418

Query: 444 QLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLE 503
           QLACLAYREN    C+KLF+E R+ FPT PEVP FYAEILADKGD   A+KQY+IA RLE
Sbjct: 419 QLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLE 478

Query: 504 KAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQN 563
             QK IHVGIAPLVGKAT+LARQP   N    +QL+E AC+ DPRSEQA VGLAQL+LQ 
Sbjct: 479 SLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQ 538

Query: 564 EEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQG 623
           E+VD AIELFE+AA ++RT+DEK+QA+TFAEA K+QKRIRADPV+S KV+E LA+Y++Q 
Sbjct: 539 EKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQN 598

Query: 624 VI 625
           + 
Sbjct: 599 MF 600

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/539 (57%), Positives = 404/539 (74%), Gaps = 12/539 (2%)

Query: 96  SYPTNDSNDPDMIQITSLPLEEQ---KKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN 152
           SYP +  NDPD  +I  L    +    K + +LK+KGN+YFK+KD  NAIKYY  AL L+
Sbjct: 129 SYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLD 188

Query: 153 KDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDL 212
           +DP+FYSNISACY ++ QLDKVIESS KALEL P+YSKALLRRA+A E+L N  +AL+D 
Sbjct: 189 QDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF 248

Query: 213 SVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIF 272
           S+LSL G+YSG  +EP+L R L+K +  VL  +++     N    +L S ++LVSFFGIF
Sbjct: 249 SILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDN---FILLSDSALVSFFGIF 305

Query: 273 DPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAK---NPK 329
            PE T  NYN +D+AD EL+ GL  L K+T +G+LDADK+F+KA+ LFME+L     N +
Sbjct: 306 PPETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDE 365

Query: 330 DKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQ- 388
           +  LLEK AIALEY+G+F+FLK DLLG++TD++KAI  +PR NSY+Y+A++ ADK+  + 
Sbjct: 366 NSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKN 425

Query: 389 --EYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLA 446
             +Y KYFDKA  LNP+    YYHRGQL  + Q + +A+  F KAKELD++N++PYIQLA
Sbjct: 426 DLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLA 485

Query: 447 CLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQ 506
           C+AY  + F +CQ+LFDE R KFPT PEVPTFYAEILADKG+   A+KQYDIA RLE A 
Sbjct: 486 CVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAY 545

Query: 507 KNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEV 566
           K IHVGIAPL+GKA  LAR P   N    T+L+EKACE+DPRSEQA + LAQLKLQ E++
Sbjct: 546 KYIHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDI 605

Query: 567 DLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           D AI LFE+ ADL+RT  +K+QA TFAEAAKIQKRI+ +P+ +AK++E LA+YR+ G+I
Sbjct: 606 DTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII 664

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/529 (58%), Positives = 392/529 (74%), Gaps = 5/529 (0%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP + + +PD+  + S   E++++ SM +KDKGN+ FK K Y  AIKYY+ AL L KDP+
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSN SAC+V L +L+KV+E +T ALEL P+YSK LLRRA+ANESL N++DA+ DLS +S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           L G Y+  SIEP+LERN+NKQA++VL     K+   +K Q  LPS TSL SFFGIF  E 
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLK---RKLADGSKHQ--LPSNTSLASFFGIFPSET 247

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336
           +F NY+E  +AD  LL GL  L +R    Y  +D+ F KA+ L       + +D  L  K
Sbjct: 248 SFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMK 307

Query: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396
            AIALE+ GIF+FLKN+ L A   ++KA+   PR NSY+Y+ALI ADK  + EY +YFDK
Sbjct: 308 LAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDK 367

Query: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456
           ALEL P+S +VYYHRGQ+YF+TQ + K+  +F+KAKE +  NIFPYIQLACLAYREN F+
Sbjct: 368 ALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFE 427

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516
            C+ LF E R+KFPT PEVP FYAEIL+DKGD   A+K+Y+ A +LE AQ+ IHVG+APL
Sbjct: 428 DCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPL 487

Query: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
           VGKATVLARQ +  +  EAT L E+AC+ DPRSEQA +GLAQLKLQ E+VD AI+LFE+A
Sbjct: 488 VGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEA 547

Query: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
            DL+R  +EK+QA TFAEAAKIQKRIRADP++SAK+ E L +YR QGV+
Sbjct: 548 TDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/540 (56%), Positives = 400/540 (74%), Gaps = 12/540 (2%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDP 155
           YP     +PDM ++  L   +++  ++QLKDKGN +F AK + +AIKYY  A++L+  DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
           +FYSNISACY+S G LDKV+E +TKALE+ P++SKALLRRASANESL N++DA+FDLSVL
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275
           SLNGD+ G SIEP+LERNLNKQA+KVLNE + K  G +K  Q+LPS TSL SFFGIFDP+
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLK-NGDDKSSQILPSNTSLASFFGIFDPD 284

Query: 276 LTFQNYNEN---DQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKH 332
           L     N     D A   L   L +L+  T +GYL AD    KA+  +   L  N +D+ 
Sbjct: 285 LETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRV 344

Query: 333 LLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392
           + E  A+A  Y GIF+FLKNDLL AQ  ++++I   P  NSY+++AL  ADK  SQE+ K
Sbjct: 345 IRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFK 404

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452
           +F  A++L+P+    YYHRGQ+YFI QDY  AK +F+KA+ L+  N++PYIQLACL Y++
Sbjct: 405 FFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQ 464

Query: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVG 512
           + F   + LF+E + KFP  PEVPTFYAEIL DKGDF  AIKQYDIA RLE+ QK IHVG
Sbjct: 465 DKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVG 524

Query: 513 IAPLVGKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565
           I PL+GKAT+LARQ    P  L+      A +L+ KACE+DPRSEQA +GLAQL+LQ E+
Sbjct: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584

Query: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           +D+AI+LF+++A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK+++ LA+YR+QG+I
Sbjct: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/540 (56%), Positives = 405/540 (75%), Gaps = 12/540 (2%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDP 155
           YP     +PDM Q+  LPL ++++ ++QLKDKGN +F +K++ +AIKYY  A++L+  DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
           +FYSN+SACY+S G L+KV+E +TKALE+ P++SKALLRRASANESL N++DA+FDLSVL
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275
           SLNGD+ GASIEP+LERNLNKQA+KVLN  ++K +G ++  ++LPS TSL SFFGIFDP+
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSG-DRGSEILPSNTSLASFFGIFDPD 278

Query: 276 LTFQNYNE---NDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKH 332
           L     +     D A   LL  L  L+  T +GYL A+  F KA+  +   L+ +  D  
Sbjct: 279 LEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGA 338

Query: 333 LLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392
           +    A+A  Y GIF+FLKNDLL AQ  ++++I   P  NSY+++AL  ADK  SQE+  
Sbjct: 339 IRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFS 398

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452
           +F KA++L+P+    YYHRGQ+YFI QDY  AK++F+KA+ L+  NI+PYIQLACL Y++
Sbjct: 399 FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458

Query: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVG 512
             F   +KLF+ET+ KFPT PEVPTF+AEIL DKGD+  AIKQYDIA RL++ Q+ IHVG
Sbjct: 459 GKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVG 518

Query: 513 IAPLVGKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565
           I PL+GKAT+LARQ    P  L+      A +L+ +AC++DPRSEQA +GLAQLKLQ E+
Sbjct: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578

Query: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           +D AIELF+ +A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK+++ LASYR+ G+I
Sbjct: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/535 (57%), Positives = 396/535 (74%), Gaps = 14/535 (2%)

Query: 102 SNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSN 160
           + +PD+ Q+  L L +++  ++QLK+KGN +F  K++T AIKYY  A++L+  DP+FYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 161 ISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGD 220
           ISACY+S G L+KV+E +TKALE+ P++SKALLRRASANESL N++DA+FDLSVLSLNGD
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 221 YSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQN 280
           + GASIEP+LERNLNKQA+KVLNE ++K  G  +  QLLPS TSL SFFGIFDP+L    
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSK--GDGRGSQLLPSNTSLTSFFGIFDPDLEISR 281

Query: 281 YNENDQADVE---LLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKT 337
            N +   D     L   L  L+  T++GYL ADK F  A+  +   LA    D  L E  
Sbjct: 282 VNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQV-DGPLKENA 340

Query: 338 AIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKA 397
           A+A  Y GIF FLKN+LLGAQ  ++++I   P  NSY++LAL  ADK  SQE+ KYF KA
Sbjct: 341 ALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKA 400

Query: 398 LELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDR 457
           ++L+ +    YYHRGQ+YFI QDY  AK +F+KA+ L   NI+PYIQLACL Y++  F  
Sbjct: 401 IDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTE 460

Query: 458 CQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLV 517
            + LF+ET+ KFPT PEVP F+AEIL DKGDF+ AIKQYDIA RLE+ Q+ IHVGI PL+
Sbjct: 461 SEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLI 520

Query: 518 GKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAI 570
           GKAT+LARQ    P  L+      A  L+ KACE+DPRSEQA +GLAQLKLQ E++D AI
Sbjct: 521 GKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAI 580

Query: 571 ELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           ELF+ +A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK++  LASYR++G+I
Sbjct: 581 ELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 386/529 (72%), Gaps = 5/529 (0%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP + + +PD+  + +   E+++K +M LKDKGN+ FK + Y  AIK+Y+ AL L +DP+
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSN SACYV L +L+KV+E +T AL+L P+YSK LLRRA+ANESL NY+DA+ DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           L G YS  +IEP+LERN+NKQA++VL +++     S  E+  LPS TSL SFF IF  E 
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKL-----SGGEKHELPSNTSLASFFRIFPSET 244

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336
           + +NY+E  +AD  LL GL  L  R    Y  AD+ F  A   F      NP +  L +K
Sbjct: 245 SLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQK 304

Query: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396
            AIALE+ GI +FLKN+ L A   ++KAI  FPR NSY+Y+ LI ADK  + EY++ F+K
Sbjct: 305 LAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEK 364

Query: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456
           ALEL+P S + YYHR Q+ F+ Q + +A  +F+KAKE D + ++PYIQLACLAYRE  FD
Sbjct: 365 ALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFD 424

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516
            C+ LF E R++FPT PEVP FYAEIL+DKGDF  A+K+YD A +LE AQ+ IHVG+APL
Sbjct: 425 DCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPL 484

Query: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
           VGKA +LARQP+  N  EAT+L E ACE DPRSEQA +GLAQLKLQ EEVD AI+LFE A
Sbjct: 485 VGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAA 544

Query: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           ADLSR  +EK+QA TFAEAAKIQKRIRADPV+SAK+ E L +YR+QG++
Sbjct: 545 ADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/528 (55%), Positives = 393/528 (74%), Gaps = 3/528 (0%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP + +  PD+ +      E+  K ++ LKDKGN++FKAKD+  AI+YY LA+ L +DP+
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           FYSN SA YVS+   +KV+E +T AL+L P+YSK  LRRASA E+L  +SDA+FDLS +S
Sbjct: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           L G+YSG S+E +LERN+NKQA KVL E++ +  G   ++  LPS TSL SFFGIF+PE 
Sbjct: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQG---KESPLPSNTSLASFFGIFNPET 255

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336
           +F +Y+  ++ADVEL  GL NL+K     Y  AD+ F KA+ L+ +EL  +P ++ L +K
Sbjct: 256 SFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKK 315

Query: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396
            AIA E+ GIF+F KND + A  ++E+++   PR ++Y+Y+ALI ADK  + +Y +YFDK
Sbjct: 316 AAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDK 375

Query: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456
           ALEL+P+  +VYYHRGQ++F+ +++ +A  +F+KAKEL+  NIF YIQ ACLA+R++ FD
Sbjct: 376 ALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFD 435

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516
            C+ LF E R+KFPT PEVP FYAEILA K     AIKQYDIA +LE A   IHVGIAP+
Sbjct: 436 DCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPM 495

Query: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
           +GKAT L R P + N  EA++L E+AC+IDPRSEQA +GLAQLKLQ EE+D AI+LFE A
Sbjct: 496 IGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDA 555

Query: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGV 624
           ADLSR+ DEK+QA TFAEA K+QK+IRADP I  K+DEA+A+YR+QG+
Sbjct: 556 ADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/540 (56%), Positives = 400/540 (74%), Gaps = 13/540 (2%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDP 155
           YP+  + +PD+ Q+  L   +++  ++QLK++GN +F AK++  AIKYY  A++L+  +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
           +FYSNISACY+S G L+KVIE +TKALE+ P++SKALLRRASANESL N++DA+FDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275
           SLNGD+ GASIEP+LERNLNKQA+KVLNE ++K  G  +  Q+LPS TSL SFFGIFD  
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEG--RGSQVLPSNTSLASFFGIFDSH 279

Query: 276 LTFQNYNEN---DQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKH 332
           L   + N +   D A   L   L  L+  TD+GYL A+    K++ ++   L+ N  D  
Sbjct: 280 LEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDP 339

Query: 333 LLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392
           L E  A+AL Y GIF FLKN+LL AQ  ++++I   P  NSY++LAL  ADK  SQE+ K
Sbjct: 340 LRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFK 399

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452
           +F KA++LNP+    YYHRGQ+YFI QDY  AK +F+KA+ L+  N++PYIQLACL Y++
Sbjct: 400 FFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQ 459

Query: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVG 512
             F   +  F+ET+ KFPT PEVPTF+AEIL D+GDF  AIKQYDIA RLE+ Q+ IHVG
Sbjct: 460 GKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVG 519

Query: 513 IAPLVGKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565
           I PL+GKAT+LARQ    P  L+      A +L+ KACE+DPRSEQA +GLAQLKLQ E+
Sbjct: 520 IGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEK 579

Query: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625
           +D AIELFE +A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK++  LA YR++G++
Sbjct: 580 IDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/525 (57%), Positives = 390/525 (74%), Gaps = 4/525 (0%)

Query: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156
           YP + + +P +  +  L  + +++ +  LK+KGN  FK KD+ NAIKYY  AL L +DP+
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPV 129

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216
           +YSNISACY SL   +KVIE +TKAL L P+YSK L+RRA+A E L N+ DA+FDLSV S
Sbjct: 130 YYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCS 189

Query: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
           LN D S ASIEPILERNLN+QA+ VLN ++    G   ++  LPS T+L SFFGIF PEL
Sbjct: 190 LNTDMSDASIEPILERNLNQQAMFVLNTKL----GVTDKKSQLPSNTALTSFFGIFKPEL 245

Query: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336
           +F NY++  + D ELL GL NL++ T +GY  AD +F KA+  F+++L++ P D+ + EK
Sbjct: 246 SFANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEK 305

Query: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396
           TAIALE+ GIF+FLKN+ L A  DI+KA+   PR+NSY+Y+ALI ADK  +  Y   ++K
Sbjct: 306 TAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEK 365

Query: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456
           A++L+  + ++YYHRGQ+YFITQ Y KA  +F+KAKELD  NIFPYIQLACL+YREN FD
Sbjct: 366 AMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFD 425

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516
            C+ LF E R+KFP   EVP FYAEILADKGDF  A+K+Y+ A  LEK Q  +HVGIAPL
Sbjct: 426 DCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPL 485

Query: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
           VGKAT+L R P + N  EAT L+E+A + DPRSEQA + L QLKLQ E++D AIELFE A
Sbjct: 486 VGKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESA 545

Query: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRS 621
           A L+RT +EK+QA TFAEAAKIQKRIRADP +SAK+ E +A+ R+
Sbjct: 546 ATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/622 (50%), Positives = 427/622 (68%), Gaps = 19/622 (3%)

Query: 3   SNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQ-QTHTSLEGEEDGNSTGRNPVN 61
           S+D+ + GF++RNR                +YYY  LQ Q   ++  +ED + +      
Sbjct: 2   SSDNSIKGFVSRNRTAIIATIAAGTTAVGAYYYYTQLQAQQQENVRPKEDTDKS------ 55

Query: 62  DEAHLSXXXXXXXXXXXXXXATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKI 121
                +                P + T T      Y  + + +P++  I SL  E + + 
Sbjct: 56  -----TATKKEKKKSKGKESKKPQEDTPTTKKPI-YLVDSNGEPNLSDIDSLTEETKNEW 109

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKA 181
           +M LKDKGN+ FK   + +AIKYY+ AL L  DPI+YSNISACY SL Q +KVIE +TKA
Sbjct: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169

Query: 182 LELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKV 241
           L+L P +SK L+RRA A E++ N+ DA+FD+S  SLNGD + ASIEPILER LNKQA  V
Sbjct: 170 LKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFV 229

Query: 242 LNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKR 301
           L E+++    +NKEQ L PS+T L SFF +F PE +F NY E+++AD EL+ GLTNL+K 
Sbjct: 230 LKEKIS----ANKEQNL-PSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKN 284

Query: 302 TDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDI 361
           +++G+  ADK+F+KA+ LF ++L++N  ++ + EKTAIALEY+GI  ++KN+ L A   I
Sbjct: 285 SEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSI 344

Query: 362 EKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDY 421
           + AI   PRVNSY+Y +LI +D +T+ EY + FDKALEL P++ ++YYHRGQ YFI Q Y
Sbjct: 345 KSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQY 404

Query: 422 PKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAE 481
            KA  +F+K KELDE NIF YIQLACLAYRE+ FD C+ LF E R+KFPT PEVP F+AE
Sbjct: 405 EKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAE 464

Query: 482 ILADKGDFALAIKQYDIATRLE-KAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLME 540
           +LAD+G+   A+K++D A  LE K  + IHVGIAPL+GKAT+L  +P + N  E  QL++
Sbjct: 465 VLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQ 524

Query: 541 KACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQK 600
           +AC+ DPRSEQA +GLAQLKLQ E++D AI+LFE+AA+L+++ +EK+QA TFAEAAKIQK
Sbjct: 525 EACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQK 584

Query: 601 RIRADPVISAKVDEALASYRSQ 622
           RIRADP + AK+ + +   RSQ
Sbjct: 585 RIRADPAMDAKIRQTIEQMRSQ 606

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  520 bits (1338), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 280/624 (44%), Positives = 387/624 (62%), Gaps = 42/624 (6%)

Query: 1   MSSNDHPVGGFLTRNRXXXXXXXXXXXXXXXXFYYYHHLQQTHTSLEGEEDGNSTGRNPV 60
           MSS+ + VG F  +N+                ++YY  +Q+   SL+   DGN  G    
Sbjct: 1   MSSDSNTVG-FWVKNKKAVVASVATVSAVVAAYFYYKQVQELKKSLD---DGNDVG---- 52

Query: 61  NDEAHLSXXXXXXXXXXXXXXATPDQTTATADVLTSY-PTNDSNDPDMIQITSLPLEEQK 119
                                      TA++ V   Y   ND  D +++++      E+ 
Sbjct: 53  ---------------------------TASSKVEYKYLMINDEPDIELMKLAETA--EKN 83

Query: 120 KISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESST 179
           + + +LK +GN YFK KDY NAI YY  AL L  DP+FYSN++ACY+SL    + IE+ +
Sbjct: 84  EYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACS 143

Query: 180 KALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAI 239
           KALELNP+YSK LL+RA+  E++  ++DAL DL+ +SLNGDY+ A+I+PI+ER LNKQA+
Sbjct: 144 KALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAM 203

Query: 240 KVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLF 299
             L + +     ++++ ++LPS TS+ +FFG+FD E     ++  +++D  L   LT+L+
Sbjct: 204 MALKDHLE----ASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLY 259

Query: 300 KRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQT 359
            +T +GY   D  F KA+ L+  +L  +  +    EK AIA E+  I  FLKND L A+ 
Sbjct: 260 SQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARE 319

Query: 360 DIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQ 419
            +++AI   PR  SY+YL L+ ADK   +EY   F KA++L+P+  ++YYHRGQ+ FI Q
Sbjct: 320 LVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQ 379

Query: 420 DYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFY 479
            Y KA  +F+KAKE D TNIFPYIQLAC++YRE  FD C+ LF E R+KFP  PEVP F+
Sbjct: 380 KYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFF 439

Query: 480 AEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLM 539
           AEIL+DKG+   A  +YD A  LE   +NIHVGIAPLVGKAT L + P + N  EA  L 
Sbjct: 440 AEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLF 499

Query: 540 EKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQ 599
           E+A   DPRSE+A +GLAQ KLQ E++D AI LFE+AA L RT+DEK+QA TFAEA K+Q
Sbjct: 500 EQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQ 559

Query: 600 KRIRADPVISAKVDEALASYRSQG 623
            R+RAD  + AK  +AL   R  G
Sbjct: 560 MRVRADERLQAKTMKALDEIRRNG 583

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 80/152 (52%), Gaps = 7/152 (4%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQLDKVIESSTK 180
           +++ KD+GNK+  +KDY  AI+ Y  A++L+    IF+SN +   + L +    +E S+K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVL--SLNGDYSGASIEPILERNLNKQA 238
           A+EL+ +  K   RR  A   L+++  A  DL V+     G+ +        ER + ++ 
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATAKRTLLACERMIRRER 128

Query: 239 IKVLNERMNKMTGSNKEQQLLPSTTSLVSFFG 270
                E+  + +G N+EQQ L  T SL  F G
Sbjct: 129 F----EKAIRASGGNEEQQRLCKTLSLEMFAG 156

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 99  TNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIF 157
           T+D+ +P       +  EE KK +  LK +GN+   AKDY  AI+ Y  A++ L  D ++
Sbjct: 73  TSDAGEP------KVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVY 126

Query: 158 YSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLS-VLS 216
           Y+N +A Y SL Q +K +E + KA +++ +YSK   R   A  +L  + +AL     VL 
Sbjct: 127 YANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLD 186

Query: 217 LNGD 220
           + GD
Sbjct: 187 IEGD 190

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           +LK KGN  F +KD+T AI+Y+  A+  +  P  + YSN SACY SL Q  + +  + + 
Sbjct: 6   ELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQC 65

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++NP++SK   R  +A+  L +  DA
Sbjct: 66  VKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 8/128 (6%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +    +D   YSN +A    L    + I+   KA+E +P
Sbjct: 396 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDP 455

Query: 187 NYSKALLRRASANESLENYSDALFDLSVLSLNGDY--SGASIEPILERNLNKQAIKVLNE 244
           N+ +A LR+A+A  +++++  AL  L       D   +GAS   I+     K  +K   E
Sbjct: 456 NFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIM-----KLQMKATQE 510

Query: 245 RMNKMTGS 252
           R    TG+
Sbjct: 511 RFQAPTGN 518

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           +GNK +K+  +  AI  YN A DL+KD  + +N SA     G  +  + +  +A+E
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVE 317

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 79/152 (51%), Gaps = 8/152 (5%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQLDKVIESSTK 180
           ++  K++GN++ KAKDY  A++ Y  A++ +    IF+SN +   + L +    +E S +
Sbjct: 38  ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSAR 97

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVL--SLNGDYSGASIEPILERNLNKQA 238
           A+EL+    KA  RR  A+  L  +  A  DL V+  +  GD +      + ER L ++ 
Sbjct: 98  AIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEVCERMLRRER 157

Query: 239 IKVLNERMNKMTGSNKEQQLLPSTTSLVSFFG 270
                ER  +  G ++EQ+ L  T SL SF G
Sbjct: 158 F----ERAIRADG-DEEQRRLCKTLSLASFAG 184

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 83/161 (51%), Gaps = 6/161 (3%)

Query: 110 ITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSL 168
           +++ P  E  + ++ LK++GNKY K K YT A++YY  A++L+    IF+SN +   + L
Sbjct: 1   MSTTPTTEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKL 60

Query: 169 GQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEP 228
                 ++    ALEL+P   KA  RR  +   L ++  A  DLS++ L    S A+ + 
Sbjct: 61  DNFQSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV-LKAKPSDATAKR 119

Query: 229 ILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFF 269
            L+  + ++ I+   ER  K  G +   ++ P     +S F
Sbjct: 120 ALD--MCEKVIR--EERFKKAIGGDDTDRVNPCQVLNLSSF 156

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 52/87 (59%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  AI  +  A+++++ P  + YSN SACY SL +    +  +T+ 
Sbjct: 7   EYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATEC 66

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++NP++SK   R  +A+  L +  DA
Sbjct: 67  VKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +  + +D   YSN +A    L    + I    KA+E +P
Sbjct: 399 EGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 458

Query: 187 NYSKALLRRASANESLENYSDALFDL 212
           N+ +A +R+A+A  +++ ++ AL  L
Sbjct: 459 NFVRAYIRKATAQIAVQEFAGALETL 484

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK++KA+ +  AI++YN A +L++D  + +N +A     G  +  I + T A+E
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVE 320

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GN  F AKD+  AI+ +  A+++++ P  + YSN SACY S  Q +K +E + + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 184 LNPNYSKALLRRASANESLENYSDA 208
           +NP +SK   R  +A+  L +  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 39/58 (67%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK++KA+ +  AI++Y+ A +L+KD  + +N +A     G+ +  I++ T+A+E
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +    +D   YSN +A    L    + I+    A+  +P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 187 NYSKALLRRASA 198
           N+ +A +R+A+A
Sbjct: 459 NFIRAYIRKATA 470

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 19/96 (19%)

Query: 357 AQTDIEKAIGFFPRV-------NSYLYLALISADKSTSQEYSKYFDKALE-------LNP 402
           A  D EKAI  F +        N  LY     +++S     +K F+KALE       +NP
Sbjct: 15  AAKDFEKAIELFTKAIEVSEKPNHVLY-----SNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 403 DSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETN 438
                Y   G  +F   D  +A+  ++KA ELD  N
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN 105

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  A + +  A+D+++ P  + YSN SACY SL +  + ++ + + 
Sbjct: 6   EYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEEC 65

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++NP +SK   R  +A   L N  DA
Sbjct: 66  VKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +  + +D   YSN +A    L    + I    +A+E +P
Sbjct: 388 EGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDP 447

Query: 187 NYSKALLRRASANESLENYSDALFDLSVL 215
           N+ +A +R+ASA  +++ ++ A+  L  +
Sbjct: 448 NFIRAYIRKASAQIAVKEFAAAVETLDTV 476

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 11/104 (10%)

Query: 84  PDQTTATADVLTSYPTNDSNDPDMIQI----TSLPLEEQKKISMQLKDKGNKYFKAKDYT 139
           P +    A+  T  P  ++N+P+ +++      +  EE+K        +GNK++KA+ + 
Sbjct: 213 PREEPKQAEAKTEEPLKENNEPEPMEVDEKGPQVAAEEEKA-------EGNKFYKARKFD 265

Query: 140 NAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
            AI++YN A +L+KD  + +N +A     G  +  I + T A++
Sbjct: 266 EAIEHYNKAWELHKDITYLNNRAAAEYEKGDYETAIATLTNAVD 309

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKV 174
           EEQK  +  LK +GNK    KDY +AIK Y+ A++ L  + ++Y+N +A Y SL + D  
Sbjct: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDA 146

Query: 175 IESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220
           +  +  A+++NP YSK   R   A  +     DAL     VL + GD
Sbjct: 147 VNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  AI  ++ A+++++ P  +FYSN SACY SL +  + +  + + 
Sbjct: 6   EYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEEC 65

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++NP +SK   R  +A+  L +  +A
Sbjct: 66  VKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G  YF   D+ NA+K Y   +    +D   YSN +A    L    + IE   KA+E +P
Sbjct: 396 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDP 455

Query: 187 NYSKALLRRASANESLENYSDALFDL 212
           N+ +A +R+A+A  +++ ++ A+  L
Sbjct: 456 NFIRAYIRKATAQIAVKEFAAAIETL 481

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 56/105 (53%), Gaps = 4/105 (3%)

Query: 83  TPDQTTATADVLTSYPTNDSN--DPDMIQITSLPLEEQKKISMQLKDK--GNKYFKAKDY 138
           TP+Q+  T     S P  ++   +P+ +++ S   EE  K     K+K  GNK +KA+ +
Sbjct: 213 TPEQSKETPAEQKSEPQAEATKAEPEPMEVDSAGNEETSKKEEAEKEKALGNKAYKARQF 272

Query: 139 TNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
             AI +Y+ A +L++D  + +N SA     G  +  +++  +A+E
Sbjct: 273 DEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVE 317

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 9/95 (9%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  AI+ +  A++++K P  + YSN SACY SL +    +  + + 
Sbjct: 7   EYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKEC 66

Query: 182 LELNPNYSKALLRRASA-------NESLENYSDAL 209
           + +NP++SK   R  +A       +E+  NY  AL
Sbjct: 67  ININPSWSKGYNRLGAAHLGLGDLDEAENNYKKAL 101

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G  YF   D+ NA+K Y   +    +D   YSN +A    L    + I    KA+E +P
Sbjct: 402 EGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 187 NYSKALLRRASANESLENYSDALFDL 212
           N+ +A +R+A+A  +++ Y+ AL  L
Sbjct: 462 NFVRAYIRKATAQIAVQEYAAALETL 487

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK++KA+ +  AI++YN A +L++D  + +N +A     G+    I +   A+E
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKTAIATLNDAVE 323

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKD+  A + ++ A++ ++ P  + YSN SACY SL +  + +E + + 
Sbjct: 5   EFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEEC 64

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++NP +SK   R  +A   L N  DA
Sbjct: 65  VKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 58/104 (55%), Gaps = 2/104 (1%)

Query: 82  ATPDQTTATADVLTSYPTND-SNDPDMIQITSL-PLEEQKKISMQLKDKGNKYFKAKDYT 139
           A P+ T    +   S   +D S D D +++    P ++ K  +   K +GNKY+KA+ + 
Sbjct: 225 AKPEATKPAPEAKKSTAESDLSADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFD 284

Query: 140 NAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
            AI++YN A DL++D  + +N SA     G  ++ I++ T+A++
Sbjct: 285 EAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVD 328

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G ++F   D+ +A+  Y   +    +D   YSN +A    L      I+    A+  +P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 187 NYSKALLRRASANESLENYSDALFDL 212
           N+ +A +R+ASA  ++  ++ A+  L
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETL 492

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 50/80 (62%), Gaps = 2/80 (2%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESST 179
           + + KD+GN  F AK+Y  AI+ +  A+++++ P  + YSN SACY S  Q  K +E + 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 180 KALELNPNYSKALLRRASAN 199
           + +++NP +SK   R  +A+
Sbjct: 65  ECVKINPTWSKGYNRVGAAH 84

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 128 KGNKYFKAKDYTNAIKYYN--LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELN 185
           +G +YF   D+ NA+K Y   +A D + D   YSN +A    L    + I     A+E +
Sbjct: 395 EGKEYFTKGDWPNAVKAYTEMIARDPS-DARGYSNRAAALSKLMSFPEAITDCNTAIEKD 453

Query: 186 PNYSKALLRRASANESLENYSDALFDL 212
           PN+ +A +R+A+A  +++++  A+  L
Sbjct: 454 PNFIRAYIRKATAQIAIKDFVPAIETL 480

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%)

Query: 98  PTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIF 157
           P      P+  +  S P +E K  +   K +GNK +KA  +  AI++YN A +L+ D  +
Sbjct: 231 PKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITY 290

Query: 158 YSNISACYVSLGQLDKVIESSTKALE 183
            +N SA     G     IE+  +A+E
Sbjct: 291 LNNRSAAEFEKGDYQTAIETLHEAVE 316

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 9/95 (9%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  AI+ +  A+++++ P  + YSN SACY SL +    +  + + 
Sbjct: 7   EYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANEC 66

Query: 182 LELNPNYSKALLRRASA-------NESLENYSDAL 209
           +++NP++SK   R  +A       +E+  NY  AL
Sbjct: 67  VKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKAL 101

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +    +D   YSN +A    L    + I    KA+E +P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 187 NYSKALLRRASANESLENYSDALFDL 212
           N+ +A +R+A+A  +++ Y+ AL  L
Sbjct: 462 NFVRAYIRKATAQIAVKEYASALETL 487

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK++KA+ +  AI++YN A +L+KD  + +N +A     G+ +  I +   A+E
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVE 323

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 54/91 (59%), Gaps = 2/91 (2%)

Query: 120 KISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIES 177
           K + + K +GN  F AKDY  AI  +  A+++++ P  + YSN SA Y S  Q ++ +  
Sbjct: 3   KTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 178 STKALELNPNYSKALLRRASANESLENYSDA 208
           + + +++NP+++K   R+ +A + L  Y +A
Sbjct: 63  ADECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +    D    YSN +A    L      I    KA+E +P
Sbjct: 391 EGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDP 450

Query: 187 NYSKALLRRASANESLENYSDALFDLSV 214
           ++ +A LR+A+   +++ ++ A+  L +
Sbjct: 451 SFIRAYLRKATCQIAVKEFAGAIETLDL 478

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK +KA+ +  AI +YN A +  KD  + +N SA     G  +  I++ T+A+E
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVE 312

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 111 TSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVS 167
            ++P+E  E K  +   K +GNK   AKDY  AI+ Y+ A+  L  + I+Y+N +A Y S
Sbjct: 86  VNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSS 145

Query: 168 LGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDAL-FDLSVLSLNGD 220
           + + D  I+ + KA+E++P YSK   R A A  +L    +AL +   VL + GD
Sbjct: 146 VKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  AI  ++ A+D+++ P  + YSN SACY SL +    ++ + + 
Sbjct: 7   EYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEEC 66

Query: 182 LELNPNYSKALLRRASAN 199
           +++NP++SK   R  +A+
Sbjct: 67  VKINPSWSKGYNRVGAAH 84

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G  YF   D+ NA+K Y   +    +D   YSN +A    L    + I+   KA+E +P
Sbjct: 403 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDP 462

Query: 187 NYSKALLRRASANESLENYSDAL 209
           N+ +A +R+A+A  ++  +S AL
Sbjct: 463 NFVRAYIRKATAQIAVREFSSAL 485

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%)

Query: 98  PTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIF 157
           P   +++P+ + + S   E  KK +   K +GNK +KA+ +  A+  YN A + + D  +
Sbjct: 239 PVVQADEPEQMDVDSNEDENAKKRAEAAKAEGNKLYKARQFDEAVAKYNEAWEAHNDITY 298

Query: 158 YSNISACYVSLGQLDKVIESSTKALE 183
            +N SA     G  +  I++  +A+E
Sbjct: 299 LNNRSAAEFEKGDYETSIKTLEEAVE 324

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           LK +GNK F AKD+  A+K Y  A++L   + +FY N +A Y S  + ++ +  +  A+ 
Sbjct: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158

Query: 184 LNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220
           +NP+YS+   R   A  +L    +A+     VL + GD
Sbjct: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           Q K +GN+ F +KDY  AI+ +  A+++++ P  + +SN SACY S     K ++ + + 
Sbjct: 5   QFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANEC 64

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++NP+++K   R  +A+  L +  +A
Sbjct: 65  VKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+  A++ Y   +  N  D   YSN +A    L      I    KA+E +P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 187 NYSKALLRRASANESLENYSDAL 209
           N+ +A +R+A+   ++++Y+ A+
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAI 477

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%)

Query: 113 LPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLD 172
           + +++ K  +   K +GNK +K + +  AI+ YN A + + D  + +N +A     G  +
Sbjct: 246 MEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYE 305

Query: 173 KVIESSTKALE 183
             IE+ TKA+E
Sbjct: 306 AAIETLTKAVE 316

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 46/121 (38%), Gaps = 27/121 (22%)

Query: 119 KKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISAC-------------- 164
           K IS      GN Y K  D   AI YY  +L  ++ P   + +                 
Sbjct: 326 KVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEAESYMD 385

Query: 165 -------------YVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFD 211
                        Y +     K +E+ T+ ++ NPN ++    RA+A   L +++DA+ D
Sbjct: 386 PEKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRD 445

Query: 212 L 212
            
Sbjct: 446 C 446

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 74/159 (46%), Gaps = 7/159 (4%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQ 170
           S P +   + +++ KD+GN Y K++DY  AI+ Y  A++L+    IFYSN +  ++ L  
Sbjct: 2   SNPSKPDAEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPIL 230
               +     A++L+ N  KA  RR  A   L  +  A  DL++L           +   
Sbjct: 62  FQSALHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL-----LKYKPNDATA 116

Query: 231 ERNLNKQAIKVLNERMNKMTGSNKEQQL-LPSTTSLVSF 268
           +R L      +  ER  K  G +   ++ L  T SL SF
Sbjct: 117 KRGLEMCESFIREERFKKAIGGDDHGKVKLCQTVSLSSF 155

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 53/90 (58%), Gaps = 2/90 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AK+Y  AI+ +  A+++++ P  + +SN SACY SL +    +  + + 
Sbjct: 7   EYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANEC 66

Query: 182 LELNPNYSKALLRRASANESLENYSDALFD 211
           +++NP++SK   R  +A+  L +  +A  D
Sbjct: 67  VKINPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +    +D   YSN +A    L    + I    KA+E +P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 187 NYSKALLRRASANESLENYSDALFDLSV 214
           N+ +A +R A+A  +++ ++ AL  L V
Sbjct: 462 NFVRAYIRMAAAQIAVKEFAAALETLDV 489

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK++KA  +  AI++YN A +L+KD  + +N +A     G  + VI +   A+E
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVE 323

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 55/104 (52%), Gaps = 14/104 (13%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLAL-DLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           LK +GNK    KDY  AIK Y  A+  L  + ++++N +A Y SL + D+ +E +  A++
Sbjct: 103 LKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162

Query: 184 LNPNYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220
           +NP YSK   R       +  A ++LE Y        VL + GD
Sbjct: 163 INPTYSKGYSRLGFAKFAQGKAEDALEAYK------KVLDIEGD 200

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 69/130 (53%), Gaps = 12/130 (9%)

Query: 92  DVLTSYPTNDSNDPDM-IQITSLPLEEQKKISMQ---LKDKGNKYFKAKDYTNAIKYYNL 147
           D  T+     S+  D+ + I+    EE K+++ +   LK +GNK   AKDY  A++ YN 
Sbjct: 69  DAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNA 128

Query: 148 ALDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLR-------RASAN 199
           A+ L     ++Y+N +A Y S  + D+ I+ +  A+++ PN+SK   R       +  + 
Sbjct: 129 AIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQ 188

Query: 200 ESLENYSDAL 209
           E+LE Y  AL
Sbjct: 189 EALEAYKKAL 198

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKV 174
           E++KK +  LK +GNK    K+Y +AI  Y+ A+++   +P +YSN +A Y  +      
Sbjct: 92  EDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA 151

Query: 175 IESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGDYS 222
           +  +  A++L+P YSKA  R  +A  +  N  DA+     VL L GD S
Sbjct: 152 VLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQ 170
           S+  EE  + +++ K++GN + K K Y  A++YY+ A++L +   IF+SN +   + L  
Sbjct: 2   SIVSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
               +E   K++EL+P   KA+ RR  +   L  +S A  DL  +
Sbjct: 62  FLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AK+Y  A+  ++ A++++ +P  + YSN SACY SL +    +  + + 
Sbjct: 7   EYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANEC 66

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
            ++NP +SK   R  +A+  L +  +A
Sbjct: 67  TKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYN-LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G  +F    + +A+K Y  +      D   YSN +A    L    + I    KALE +P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 187 NYSKALLRRASANESLENYSDALFDLSV 214
           N+ KA +R+A+A  +++ YS AL  L +
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDI 485

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 118 QKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIES 177
           QKK++   KD+GNK +KA  +  AI++Y+ A +L+ D  + +N +A     G  +  I++
Sbjct: 254 QKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKT 313

Query: 178 STKAL----ELNPNY---SKALLRRASANESLENYSDA 208
              A+    EL  +Y   +KA  R  +A E L +   A
Sbjct: 314 LEDAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (56%), Gaps = 9/93 (9%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GN  F AKD+  AI+ +  A+++++ P  + YSN SACY S+ +  + +  + + + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 184 LNPNYSKALLRRASA-------NESLENYSDAL 209
           + P++SK   R  +A       +E+ E+Y  AL
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEAEESYKKAL 100

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y   +    +D   YSN +A    L      I+    A++ +P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 187 NYSKALLRRASANESLENYSDALFDL 212
           N+ +A +R+A+A  +++ Y+ A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           + K KGN+ +K + +  AI  Y  A DL+KD  + +N +A     G  +  I++  KA+E
Sbjct: 256 EAKAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVE 315

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           LK +GNK   +KD+  AIK Y  A++ L  + ++Y+N +A Y SL + ++ ++ +  A++
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 184 LNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220
           +NP+YSK   R   A  +L    +AL    +VL + GD
Sbjct: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 2/107 (1%)

Query: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKV 174
           EE K  + +LK +GNK    KD+  AI  Y+ A+ ++  + I+Y+N +A Y SL   +K 
Sbjct: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKA 152

Query: 175 IESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220
            E +  A+ ++PNYSK   R   A  +L    +AL     VL L GD
Sbjct: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 17/178 (9%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQ 170
           S P  EQ   +++LK++GN + K +D+T AI  Y  A+ L+    I++SN +  ++ L  
Sbjct: 2   SNPTSEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL--SLNGDYSGASIEP 228
               +    +AL+L+P  +KA  RR  +   L  +  A  DL ++  +  GD + +    
Sbjct: 62  FQSSLNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALD 121

Query: 229 ILERNLNKQAIKVLNERMNKMTGSNKEQQL-LPSTTSLVSF-----FGIFD-PELTFQ 279
           + E+ + +       ER  K  G   E ++ L  T  L S+      G +D P+L F+
Sbjct: 122 VCEKFIRE-------ERFRKAIGGGDEIKVNLCETLRLESYDANADLGKYDGPKLEFE 172

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 53/95 (55%), Gaps = 9/95 (9%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F +KD+  AI+ +  A++++  P  + YSN SA Y S  Q  + +  +T+ 
Sbjct: 7   EYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATEC 66

Query: 182 LELNPNYSKALLRRASA-------NESLENYSDAL 209
           +++NP +SK   R  +A        E+ +NY +AL
Sbjct: 67  VKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEAL 101

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y+  +    +D   YSN +A    L    + I+    A++ +P
Sbjct: 395 EGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDP 454

Query: 187 NYSKALLRRASANESLENYSDAL 209
           N+ +A +R+A+A  +++ Y++AL
Sbjct: 455 NFVRAYIRKATAQIAIKEYANAL 477

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           + K +GNK +KA  +  AI+ YN A  LNKD  + +N SA     G  +  I +  +A++
Sbjct: 257 EAKVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVD 316

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  AI  +  A+++++ P  + YSN SACY S  + ++ ++ + + 
Sbjct: 5   EFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEEC 64

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           ++++P++SK   R  +A   L    +A
Sbjct: 65  VKISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYN-LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G ++F   D+ NA+K Y  +     +D   +SN +A    L    + IE   KA+ ++P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 187 NYSKALLRRASANESLENYSDALFDLSV 214
           N+ +A +R+A+A  +++ ++ A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           K +GNK +KA+ +  AI++YN A +L+KD  + +N SA     G  D  I++   A+E
Sbjct: 250 KAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVE 307

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (51%), Gaps = 16/120 (13%)

Query: 111 TSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVS 167
            ++P E  E K  +  LK +GNK    KD+  AI  Y+ A++ L  + I+Y+N +A + S
Sbjct: 80  VNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSS 139

Query: 168 LGQLDKVIESSTKALELNPNYSKALLRRASAN-------ESLENYSDALFDLSVLSLNGD 220
           L Q D+ +  + KA+E++P YSK   R   A        E+LE Y        V+ L GD
Sbjct: 140 LKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYK------KVMDLEGD 193

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +GNK   AK +  AI+ Y  A++++  + ++YSN +A Y SL Q ++ ++ + +A+E++P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 187 NYSKALLRRASANESLENYSDAL 209
            YSK   R   A  +L    +AL
Sbjct: 161 TYSKGFSRLGFAKYALNKPEEAL 183

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 9/95 (9%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKDY  A + +  A++ ++ P  + YSN SAC+ SL + ++ +  + + 
Sbjct: 5   EFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANEC 64

Query: 182 LELNPNYSKALLRRASA-------NESLENYSDAL 209
           +++NP +SK   R  +A       +E+ + Y  AL
Sbjct: 65  VKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKAL 99

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 7/103 (6%)

Query: 114 PLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDK 173
           P ++ KK +   K +GNK++KA+ +  AI++YN A DL+KD  + +N SA     G  ++
Sbjct: 259 PEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQ 318

Query: 174 VIESSTKAL----ELNPNY---SKALLRRASANESLENYSDAL 209
            I++ T+A+    E+  +Y   SK+  R  +A   LE++  A+
Sbjct: 319 AIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYN-LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ NA+K Y  +     +D   YSN +A    L    + I+    A+  +P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 187 NYSKALLRRASANESLENYSDAL 209
           N+ +A +R+A+A  ++  ++ A+
Sbjct: 467 NFIRAYIRKATAQIAVREFASAI 489

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 77/150 (51%), Gaps = 8/150 (5%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTK 180
           +++ K++GN   K +DY  AI+ Y+ A++L+    +++SN + C++ L       +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIK 240
           AL L+P   KA  RR  A   L  +  A  DL+V+ L    S A+ +  L+  + ++ I+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV-LKAKPSDAAAKRALD--ICEKVIR 125

Query: 241 VLNERMNKMTGS--NKEQQLLPSTTSLVSF 268
              ER  K  G   +  +  L ST +L SF
Sbjct: 126 --EERFRKAIGGGDSDSKPKLCSTLNLSSF 153

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 81/175 (46%), Gaps = 25/175 (14%)

Query: 120 KISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP---IFYSNISACYVSLGQLDKVIE 176
           +++   KD+GNK+ K +D+  A + Y  A++   DP   IFYSN +   + L      + 
Sbjct: 7   ELATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALN 64

Query: 177 SSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEP--ILERNL 234
             T A+ELN +  KA  RR  AN  L N+  A  D +++           +P  I+ +N 
Sbjct: 65  DCTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV--------LKYKPNDIIAKNG 116

Query: 235 NKQAIKVLN-ERMNKMTGSNKEQQ---LLPSTTSLVSFFGIFD------PELTFQ 279
                KV+  ER  K  G + E+     +  +TSL SF    D      PEL F+
Sbjct: 117 FDTCEKVIREERFKKAIGGSDEKTGGATICQSTSLSSFDANADLSKYAGPELEFK 171

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKV 174
           ++ K+I+   KD+GN+   ++DY  AI+ Y  A+     DPI+YSN S  Y+ +   +  
Sbjct: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190

Query: 175 IESSTKALELNPNYSKALLRRASANESLENYSDAL 209
           I  +   + ++ N+SKA +R A+       Y DAL
Sbjct: 191 INDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AK Y  A+  +  A+++++ P  + YSN SA Y S  + ++ ++ + + 
Sbjct: 7   EYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALEC 66

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
            ++NP+++K   R  +A+  + N  DA
Sbjct: 67  TKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 66/132 (50%), Gaps = 6/132 (4%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G +YF   D+ +A+K Y   +    +D   YSN +A    L      I    KA+E +P
Sbjct: 391 EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDP 450

Query: 187 NYSKALLRRASANESLENYSDALFDL-SVLSLNGDYSGASIEPILERNLNKQAIKVLNER 245
           N+ +A +R+A+A  +++++S A+  L +  + + + +G +      R +++  +K   +R
Sbjct: 451 NFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGAN----AREIDQLYMKAAQQR 506

Query: 246 MNKMTGSNKEQQ 257
               TG    +Q
Sbjct: 507 FQPATGDETPEQ 518

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%)

Query: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVI 175
           +E K  + + K +GNK +KA+++  AI  YN A +L+ +  + +N SA     G+ D  I
Sbjct: 245 DESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAI 304

Query: 176 ESSTKALE 183
            +  +A+E
Sbjct: 305 NTLNEAIE 312

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLAL---DLNKDPIFYSNISACYVSLGQLDKVIESS 178
           S +LK+ GNK +K K Y  A+ Y+  AL     NK  I YSN +A ++ L    + +E  
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKH-ILYSNRAAAHIGLKHYAEALEDG 66

Query: 179 TKALELNPNYSKALLRRASA-------NESLENYSDAL 209
              +EL PN+ K   R   A       +E+ EN+  AL
Sbjct: 67  KNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNP 186
           +G ++F  ++Y  A+K Y   +  N   P+ + N +A +  L    +VI+   KA+ ++P
Sbjct: 435 EGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDP 494

Query: 187 NYSKALLRRASANESLENYSDALFDL-SVLSLNGDYSGASIEPILE 231
           +Y KA +R+  A  +  +  +AL    S  + N  Y G     +LE
Sbjct: 495 SYIKAYVRKGFAQITERDLDEALETWESGDAANKKYHGNEKNELLE 540

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 8/112 (7%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIE 176
           E+K+ + + K  GN  +K +++  AI +Y  A +  +D  + +NI A     G    V++
Sbjct: 290 EKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFERGDYGNVLK 349

Query: 177 SSTKAL----ELNPN---YSKALLRRASANESLENYSDALFDLSV-LSLNGD 220
           S  +A+      NP     +K+ +R  +A   + ++  A+      L LNG+
Sbjct: 350 SLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGN 401

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 111 TSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVS 167
            ++P+E  E K  +   K +GNK    KD+  A++ Y  A+  L  + I+Y+N +A + S
Sbjct: 88  VNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSS 147

Query: 168 LGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGDYSGASI 226
           L + ++ I+ +  A++++P+YSK   R A A   L  + +AL     VL + GD + A +
Sbjct: 148 LKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGM 207

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 40/190 (21%)

Query: 105 PDMIQ-ITSLPLEEQKKIS--MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP------ 155
           P+ I+ IT +P+    +IS   + KD+G ++FKA DY +A + Y  +  LN  P      
Sbjct: 254 PERIKTITPVPIS-HLEISGYKEYKDRGTEFFKAGDYVSASQEYEKS--LNSLPQNHALR 310

Query: 156 -IFYSNISACYVSLGQLDKVIESSTKALELNPN---------------------YSKALL 193
            + YSN++A    +G+  + +     ALE+ P                      + K + 
Sbjct: 311 IVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVT 370

Query: 194 RRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSN 253
           RRA A E +ENY  AL D   L    +++   +         ++  KVLN    K T  N
Sbjct: 371 RRAEAFEHIENYERALQDYQSLIEKNNFNDKIM------GGKRRCQKVLNPTEPKATSPN 424

Query: 254 KEQQLLPSTT 263
           +    +P  +
Sbjct: 425 RSPTPVPKVS 434

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 62/111 (55%), Gaps = 3/111 (2%)

Query: 102 SNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFY 158
           S+ P      ++P+E  E K  +  LK +GNK   AKD+  A+  Y+ A+  L  + ++Y
Sbjct: 75  SSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYY 134

Query: 159 SNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDAL 209
           +N +A + SL + ++ ++ +  A+++NP+YSK   R   A  +L    +AL
Sbjct: 135 ANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 78/162 (48%), Gaps = 8/162 (4%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-----IFYSNISACYVSLGQL 171
           E  +++   K++GN+ +K K Y +A + YN  +++  D        +SN +AC + L   
Sbjct: 73  EPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNY 132

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILE 231
            + +    +AL+ NP   K   R A A   L+   DA   +    L  D   A+++ +L+
Sbjct: 133 RRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQ 191

Query: 232 RNLNKQAIKVLNE--RMNKMTGSNKEQQLLPSTTSLVSFFGI 271
           + + ++  K  +E  R+ + T   K + LL ++  L ++  I
Sbjct: 192 KVIKREEDKKAHEAKRLREETEKEKLKTLLEASLILRNYKSI 233

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (51%), Gaps = 14/112 (12%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVI 175
           E K  + +LK +GNK    K+Y  AIK Y  A+D L  + I+Y+N +A + SL + D+ I
Sbjct: 97  ETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAI 156

Query: 176 ESSTKALELNPNYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220
           + +  A+ ++P+Y +   R       +    E+LE Y        VL + GD
Sbjct: 157 KDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVI 175
           E K  +  LK +GNK   +KDY  A++ Y  A+  L  + ++++N +A Y +    D+ +
Sbjct: 96  ETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAV 155

Query: 176 ESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220
           + + +A++L+P YSK   R A A    EN+ ++L     VL + GD
Sbjct: 156 KDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-----PIFYSNISACYVSLGQL 171
           E  +I+   K++GN  +K K + +A + YN A+D+  D        Y+N +AC + L   
Sbjct: 69  EPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNY 128

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
            + I     AL LNP   K   R A A  ++E + D 
Sbjct: 129 RRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQ 170
           S P E  +  +++ K++GN + K K +  AI+ Y  A+DL+    I++SN +  +  +  
Sbjct: 2   SNPTEADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
               +    +AL+L+P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 62  FQSALNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 66/138 (47%), Gaps = 6/138 (4%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-PIFYSNISACYVSLGQLDKVIESSTK 180
           +++ K++GN   K +DY  AI+ Y  A+ L+    I++SN +  ++ +      I    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIK 240
           ALE++P   KA  RR  +   L  + +A  DL ++      +    +   +R L+     
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV-----LASKPNDATAKRGLDVCEKF 126

Query: 241 VLNERMNKMTGSNKEQQL 258
           +  ER  K  G  ++Q++
Sbjct: 127 IREERFKKAIGGEEQQKV 144

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 73/184 (39%), Gaps = 33/184 (17%)

Query: 408 YYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDF----DRCQKLFD 463
           + +RG     TQDYP A   + +A +LD+T    +   A    + ++F    + C K  +
Sbjct: 15  FKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALE 74

Query: 464 ETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVL 523
              +    Y      Y  +L                   + AQK++ +          VL
Sbjct: 75  IDPKNIKAYHRRGMSYIGLL-----------------EFKNAQKDLKI----------VL 107

Query: 524 ARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTM 583
           A +PN    K    + EK    + R ++AI G  Q K+ N  + L +E F+  ADL+   
Sbjct: 108 ASKPNDATAKRGLDVCEKFIR-EERFKKAIGGEEQQKV-NLYLTLNLETFDSNADLTNWT 165

Query: 584 DEKI 587
             K+
Sbjct: 166 GPKL 169

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP--IFYSNISACYVSLGQLDKVIESSTKA 181
           + K +GN  F AKD+  A++ +  A+  +++P  + YSN S  Y SL + D+ +  +T+ 
Sbjct: 6   EYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATEC 65

Query: 182 LELNPNYSKALLRRASANESLENYSDA 208
           +++  ++SK   R  +A+  L N  +A
Sbjct: 66  VKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 129 GNKYFKAKDYTNAIKYYN-LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G +YF   D+ +A+K Y+ + +    D   YSN +A    L      I+   KA+E++P+
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 188 YSKALLRRASANESLENYSDALFDLSV 214
           + +A +R+A+A  +++ YS A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 105 PDMIQITSLPLEEQ--KKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNIS 162
           P   Q    P+E    ++ + + K +GN+ +K + +  AI  Y  A +L KD  + +N +
Sbjct: 239 PGKTQTPPEPMEVDLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRA 298

Query: 163 ACYVSLGQLDKVIESSTKALE 183
           A     G  +  I++  +A+E
Sbjct: 299 AAEYEKGDYNSAIKTLNEAVE 319

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 69/154 (44%), Gaps = 11/154 (7%)

Query: 119 KKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP---IFYSNISACYVSLGQLDKVI 175
           K+ ++  K++GN Y K ++Y  AI+ Y+ A++L  DP   IF+SN +   + L      +
Sbjct: 9   KEQAVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCM 66

Query: 176 ESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLN 235
                AL L+P   KA  RR  ++  L     A  DL V+           +   +R L 
Sbjct: 67  NDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV-----LKAKPTDATAKRALA 121

Query: 236 KQAIKVLNERMNKMTGSNKEQQL-LPSTTSLVSF 268
                +  ER  K  G + + +L    T SL SF
Sbjct: 122 MCEKVIREERFKKAIGGDDQDKLNFCQTMSLKSF 155

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 111 TSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVS 167
            ++P E  E K  +  LK +GNK    KD+  AIK Y+ A++ L  + ++Y+N +A + S
Sbjct: 84  VNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSS 143

Query: 168 LGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220
           +   ++ I+ +  A++ +P YSK   R   A  +L    DAL     VL + GD
Sbjct: 144 MKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 1/101 (0%)

Query: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKV 174
           +E  + +++ K++GN Y K K Y  A++YY+ A++L +   I++SN +   + L      
Sbjct: 4   QEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTA 63

Query: 175 IESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
            E   KA+ L+P   KA+ RR  +   L  +  A  DL V+
Sbjct: 64  QEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALEL 184
           LK +GN+      Y  AIK Y  A+  +K+  +YSN S  Y  LG+ +  +  +T A+ +
Sbjct: 85  LKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINI 144

Query: 185 NPNYSKALLR 194
           +P++SKA  R
Sbjct: 145 DPSFSKAYSR 154

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQ 170
           S P +E    ++  K+KGN+Y K  DY +AI++Y+ A+ L+    I++SN +  ++    
Sbjct: 2   SSPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
               +     AL+L+P   KA  RR  +   +  +  A  DL+V+
Sbjct: 62  FYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 72/144 (50%), Gaps = 21/144 (14%)

Query: 91  ADVLTSYP----TNDSNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKY 144
           AD+L S      +N  +D + ++I ++P +  E K  +  LK +GNK    KDY  AI  
Sbjct: 66  ADILNSASRVPESNKKDDAENVEI-NIPEDDAETKAKAEDLKMQGNKAMANKDYELAINK 124

Query: 145 YNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLR-------RA 196
           Y  A+  L  + I+Y+N +A + SL + D+ ++ +  A+ ++P+Y +   R       + 
Sbjct: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQG 184

Query: 197 SANESLENYSDALFDLSVLSLNGD 220
              E+LE Y        VL + GD
Sbjct: 185 KPEEALEAYK------KVLDIEGD 202

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKAL 182
           Q K++GN+ FK   Y  A + Y   +D+  ++PI YSN +   + LG+  +V+E   K L
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGL 64

Query: 183 ELNPNYSKALLRR 195
              PN +  + ++
Sbjct: 65  TFTPNTTDTVYKK 77

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 21/144 (14%)

Query: 91  ADVLTSYP----TNDSNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKY 144
           ADVL S      +N+ +D   +++  +P E  E K  +  LK +GNK    KDY  AI  
Sbjct: 66  ADVLNSASKASESNEKDDAQNVEVN-IPEEDAETKAKAEDLKMQGNKAMANKDYELAINK 124

Query: 145 YNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLR-------RA 196
           Y  A+  L  + I+Y+N +A + SL + D+ ++ +  ++ ++P+Y +   R       + 
Sbjct: 125 YTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQG 184

Query: 197 SANESLENYSDALFDLSVLSLNGD 220
              E+LE Y        VL + GD
Sbjct: 185 KPEEALEAYK------KVLDIEGD 202

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 74/140 (52%), Gaps = 17/140 (12%)

Query: 91  ADVLTSYPTNDSNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLA 148
           A++L++     S+  + +++ ++P E  E K  +  LK +GNK    KDY  AIK Y+ A
Sbjct: 61  AELLSAGAGAPSSQGENVKV-NIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEA 119

Query: 149 LDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLR-------RASANE 200
           + +   + ++Y+N +A + SL   D+ I+ +  A++++ +YSK   R       +  + E
Sbjct: 120 ISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEE 179

Query: 201 SLENYSDALFDLSVLSLNGD 220
           +LE Y        VL + GD
Sbjct: 180 ALEAYK------KVLDIEGD 193

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQLDKVIESSTK 180
           +++ K++GN + K K+++ A + Y+ A++L+    I++SN +  ++ L      +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
           A+EL+P   KA  RR  +   L  ++ A  DL ++
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQ 170
           S P    +  +++ K++GN + K K +  AI+ Y  A+DL+    I++SN +  +  +  
Sbjct: 2   STPTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
               +    +A++L+P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 62  FQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 113 LPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQL 171
           + LE   + +  LK KGN +FK  DY  AI YY  A  L+  +PI++SN++   + L + 
Sbjct: 32  IVLESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERW 91

Query: 172 DKVIESSTKAL 182
            + + +  K L
Sbjct: 92  QEAVNACDKGL 102

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-----PIFYSNISACYVSLGQL 171
           E  +I+   K++GN+++K K Y +A + Y   +D+  D        Y+N +AC + L   
Sbjct: 69  EPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNF 128

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
            K IE   KAL  N    K   R   A  S++ + ++
Sbjct: 129 RKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP---IFYSNISACYVSLGQLDKVIESS 178
           +++LK++GNK+ K K Y  A +YY  A++   DP   I YSN +   + L      ++ +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIE--HDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 179 TKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
            +A+EL+ N  KA  RRA +   L  +  A  DL ++
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 29/146 (19%)

Query: 92  DVLTSYPTNDSNDPDMIQITSLPLEEQKKISM--QLKDKGNKYFKAKDYTNAIKYYNLAL 149
           D   S P  ++++ + + IT +P+    +IS   + K +G  YFK  DY +A++ Y  +L
Sbjct: 331 DNHASSPVVNTSNQNTVSITQIPIS-HIEISGYNEFKARGTDYFKNGDYASAVEEYEKSL 389

Query: 150 DL--NKDP---IFYSNISACYVSLGQLDKVIESSTKALELNPN----------------- 187
           +    K P   I YSNI A  + +GQ  + +  + +A++L P                  
Sbjct: 390 NTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRS 449

Query: 188 ----YSKALLRRASANESLENYSDAL 209
               + K +LR+A + E++E Y  AL
Sbjct: 450 YNDIWPKIILRQAESYEAIEKYKLAL 475

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 26/112 (23%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + K KG+ +FK  DY N+++ Y  +L+   +  P   I  SNI A  + +G+  K IE+S
Sbjct: 376 EFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENS 435

Query: 179 TKALELNP----NYS-----------------KALLRRASANESLENYSDAL 209
           + AL L P    N+S                 K ++RRA + E LE++S+AL
Sbjct: 436 SMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 98  PTNDSNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLAL-DLNKD 154
           PT    +P  + I   P+E  E K  +  LK +GNK    KD+ +AI  Y+ A+  L  +
Sbjct: 75  PTATQQEPVKVNI---PVEDAEIKAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSN 131

Query: 155 PIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDAL 209
            ++++N +A Y SL +  + +E +  A+++NP+YSK   R   A  +L    +AL
Sbjct: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEAL 186

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIF-----YSNISACYVSLGQL 171
           E  +I+   K +GN+ +KAK + +A + Y   L++  +  F     ++N +AC + L   
Sbjct: 78  EPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNY 137

Query: 172 DKVIESSTKALELNPNYSKALLRRASA----NESLENYSDALF 210
            + IE  +KAL +NP  +K   R + A    N+  E  S ALF
Sbjct: 138 RRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSAALF 180

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQ 170
           S P       +++ K++GN + K K +  AI+ Y  A+DL+    I++SN +  +  +  
Sbjct: 2   STPTASDCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
               +    +A++L+P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 62  FQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYN--LALDLNKDPI---FYSNISACYVSLGQL 171
           E  +I+   K +GN+ +KAK + +A + Y+  LA++     I    Y+N +AC + L   
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNY 137

Query: 172 DKVIESSTKALELNPNYSKALLRRASA 198
            + IE  +KAL +NP   K   R + A
Sbjct: 138 RRCIEDCSKALTINPKNVKCYYRTSKA 164

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 14/104 (13%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           LK +GNK    KDY  AI  Y  A+  L  + I+Y+N +A + SL   D+ +E +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 184 LNPNYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220
           ++P Y +   R       +    E+LE Y        VL + GD
Sbjct: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 65/146 (44%), Gaps = 13/146 (8%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI-----FYSNISACYVSLGQL 171
           E  +I+   K++GN  +KAK + +A + YN  +++  D        Y+N +AC + +   
Sbjct: 73  EPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNY 132

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILE 231
            + +     AL+ NP   K   R   A  +LE   +A   +    L  D S   ++ +L+
Sbjct: 133 RRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLD 191

Query: 232 RNLNKQAIKVLNERMNKMTGSNKEQQ 257
             L KQ  K       K   S KEQ+
Sbjct: 192 IVLKKQEAK-------KEQNSKKEQE 210

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 112 SLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-DPIFYSNISACYVSLGQ 170
           S P E  +  + + K++GN   K K +  AI+ Y  A+DL+    I++SN +  +  +  
Sbjct: 2   SNPTEADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDN 61

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215
               +    +A++L+P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 62  FQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 55/113 (48%), Gaps = 28/113 (24%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALD---LNKDP---IFYSNISACYVSLGQLDKVIES 177
           + K KG   FK  DY N+++ Y  +L+   LN  P   I  SNI A  + +G+  K IE+
Sbjct: 376 EFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNH-PLRIIALSNIIASQLKIGEYSKSIEN 434

Query: 178 STKALELNPN---------------------YSKALLRRASANESLENYSDAL 209
           S+ ALEL P+                     + K ++RRA + E LE++  AL
Sbjct: 435 SSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKAL 182
           +LK KGN  FK   Y+ AI +YN  + ++  +PI YSN +   +   + D+ I +  K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 183 EL 184
           +L
Sbjct: 65  QL 66

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 26/122 (21%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + + KG + FK  DY+ A+  Y  +L+    K P   I  SN+   Y+ +G+  K ++ +
Sbjct: 292 EFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLA 351

Query: 179 TKALELNPN---------------------YSKALLRRASANESLENYSDALFDLSVLSL 217
             ALEL P                      +SK ++R A A E  ENY+ A  +  +L  
Sbjct: 352 PLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVA 411

Query: 218 NG 219
           NG
Sbjct: 412 NG 413

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK-----DPIFYSNISACYVSLGQL 171
           E  +I+   K +GN  +K K + +A + Y+  +D+       +   Y+N +AC + +   
Sbjct: 76  EPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNY 135

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDAL 209
            + I    +AL+LNP   K   R A A  +LE   +AL
Sbjct: 136 RRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 5/98 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI-----FYSNISACYVSLGQL 171
           E  +I+   K++GN  +K K + +A   Y  ALD+  D +      Y N++AC + +   
Sbjct: 65  EPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNY 124

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDAL 209
              I    +AL+LN    KA  R   A   L  + D+L
Sbjct: 125 RSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 69/144 (47%), Gaps = 14/144 (9%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDPI---FYSNISACYVSLGQL 171
           E  +++   K++ N  +KAK +  A + Y   +++  N D +    ++N++AC + +   
Sbjct: 73  EPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNF 132

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA----LFDLSVLSLNGDYSGASIE 227
            + I    KAL+ NP   K   R A A   L    +A     F L++ S N   S  ++E
Sbjct: 133 RRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENK--SLQTLE 190

Query: 228 PILERN---LNKQAIKVLNERMNK 248
            +++R    L++  +K L E+  K
Sbjct: 191 GVIDRKQQELHEAEVKRLEEKQKK 214

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 6/126 (4%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-----PIFYSNISACYVSLGQL 171
           E  +I+   K +GN+ +K K Y NA   Y   +++N +      + + N +AC + +   
Sbjct: 69  EPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNY 128

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILE 231
              I    KAL  NP   K   R A A  ++E Y ++   +    L  D   +S+  +L+
Sbjct: 129 RSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVDSRNSSLLNLLK 187

Query: 232 RNLNKQ 237
             + KQ
Sbjct: 188 TIIKKQ 193

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 18/149 (12%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYY--NLALDLNKDPI---FYSNISACYVSLGQL 171
           E  +I+   K +GN+ +KAK + +A + Y   +A++     I    ++N +AC + L   
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNY 137

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGD---YSGASIEP 228
            + IE  +KAL +NP   K   R           S A F LS L        ++  SIEP
Sbjct: 138 RRCIEDCSKALTINPKNIKCYYR----------TSKAFFSLSKLEEAKSAAIFANQSIEP 187

Query: 229 ILERNLNKQAIKVLNERMNKMTGSNKEQQ 257
             +  LN  ++    E+  K+    K+Q+
Sbjct: 188 ENKSILNMLSVIERKEQELKIKEQKKQQE 216

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK------DPIFYSNISACYVSLGQLDKVI 175
           +++LK +GNK  + ++Y +AI  Y  A+DL K      D  + SN S      G+ ++  
Sbjct: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143

Query: 176 ESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGDYSGASIEPILERNL 234
           + +   ++++P +SK   R A A      Y DA+     VL L G+ +  +++   E  +
Sbjct: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE--I 201

Query: 235 NKQAIKVLNERMNKMTGS 252
            KQ  + LN   +  +GS
Sbjct: 202 TKQKFETLNFSTHIDSGS 219

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 63/143 (44%), Gaps = 33/143 (23%)

Query: 108 IQITSLPLEE-QKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYS 159
           I I ++P+   +    ++ K +G++ FK  DY +A++ Y  +L  N  P       I YS
Sbjct: 399 ITIATVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSL--NTLPQYHPLRIISYS 456

Query: 160 NISACYVSLGQLDKVIESSTKALELNPN-----------------------YSKALLRRA 196
           NI A  + +G+  K IE    AL L P                        +SK ++R+A
Sbjct: 457 NIIATQLKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQA 516

Query: 197 SANESLENYSDALFDLSVLSLNG 219
            + E LENY  AL     L  NG
Sbjct: 517 ESYEHLENYKLALDSYQKLIENG 539

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 26/104 (25%)

Query: 128 KGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESSTKAL 182
           +G+ +FK  DY +A++ Y  +L+      P   I YSNI+A  + +G+   +++ + KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 183 ELNPN---------------------YSKALLRRASANESLENY 205
           +L P                      +SK +LR+A A E LEN+
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 55/121 (45%), Gaps = 25/121 (20%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + K+ G KYF + DY NA+  +  + +    K P   I  SNI +C + LG+  K +ES 
Sbjct: 335 EFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKALESV 394

Query: 179 TKALELN---PNYS-----------------KALLRRASANESLENYSDALFDLSVLSLN 218
             AL+L+   PN S                 K  L+ A   E LENY  AL   + L  N
Sbjct: 395 KLALDLSDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKALSLYANLISN 454

Query: 219 G 219
           G
Sbjct: 455 G 455

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALD-LNK-DP---IFYSNISACYVSLGQLDKVIESS 178
           + KD+G +YFK  DY +A + Y  +L+ L+K  P   I  SN+ A  +  G    +I  S
Sbjct: 399 EFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIS 458

Query: 179 TKALELNPN---------------------YSKALLRRASANESLENYSDA 208
           T AL+L P                      +SK + RRA A E +ENY  A
Sbjct: 459 TSALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQA 509

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + K++G + FK  DY  A++ Y  +L+    K P   I  SNI A     G+  K IE S
Sbjct: 396 EFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIS 455

Query: 179 TKALELNPN---------------------YSKALLRRASANESLENYSDAL 209
           T ALE  P                      + K +L+RA A E +E+Y +AL
Sbjct: 456 TSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKAL 182
           +LK +GN  ++ +DY  A+++Y+  L+ +  +PI +SN + C + L +  +  ++    L
Sbjct: 6   RLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGL 65

Query: 183 EL 184
            L
Sbjct: 66  AL 67

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 34/131 (25%)

Query: 111 TSLPLEEQKKISM----QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYS 159
           +SLP+     I +    + +++G +YFK  DY ++ + Y  +L  N  P       I YS
Sbjct: 388 SSLPVIPISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSL--NTLPVNHPLRIIAYS 445

Query: 160 NISACYVSLGQLDKVIESSTKALELNPN---------------------YSKALLRRASA 198
           NI A  + +G+  K +++S+ ALE+ P+                     + K  LR+A A
Sbjct: 446 NIIASELKIGEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEA 505

Query: 199 NESLENYSDAL 209
            E +E++  AL
Sbjct: 506 LEHIESFKAAL 516

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           LK KGN +FK  DY  A+ YY  A+  +  +PI YSN +   + L +  + +++  K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 184 L 184
           +
Sbjct: 67  M 67

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 3/122 (2%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKVIESSTK 180
           +++ KD+GN + K +D+  A + Y  A++L +   IF+SN +  ++        +    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 181 ALELNPNYSKALLRRASANESLENYSDALFDLSVL--SLNGDYSGASIEPILERNLNKQA 238
           ALEL+    KA  RR  +   L  +  A  DL  +  S  GD +      I E+ + ++ 
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEKFIREER 131

Query: 239 IK 240
            K
Sbjct: 132 FK 133

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + K KG   FK  DY N+++ Y  +L+    K P   I  SNI A  + +G+  K IE+S
Sbjct: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 179 TKALELNPN---------------------YSKALLRRASANESLENYSDAL 209
             AL L P                      + K ++RRA + E LE++ +AL
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 64/150 (42%), Gaps = 8/150 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-----PIFYSNISACYVSLGQL 171
           E  +++   K++GN  +K K + +A   YN  +++  D      +   N +AC + L   
Sbjct: 72  EPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNY 131

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILE 231
            + I    +AL+LNP   KA  R   A   L+   +A   +    L  D    ++  +L 
Sbjct: 132 RRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVD-FGLRVDTENEALLSLLS 190

Query: 232 RNLNKQAIKVLNERMNKMTGSNKEQQLLPS 261
               KQ  K  +E   K+    KE + L S
Sbjct: 191 AISKKQ--KARHEHEQKLESRRKEMERLAS 218

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYY--NLALDLNKD----PIFYSNISACYVSLGQ 170
           E  +I+   K++GN  +KAK + +A   Y   + ++ NKD       ++N +AC + L  
Sbjct: 71  EPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKN 130

Query: 171 LDKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
             + I     AL+LNP   K   R   A  +L+   +A
Sbjct: 131 FRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 5/97 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-----PIFYSNISACYVSLGQL 171
           E  +++   K++GN  ++AK Y +A + YN  +D+  D        +SN +AC + L   
Sbjct: 73  EPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNY 132

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
            + +    +AL+ N    K   R A A   L    DA
Sbjct: 133 RRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 64/170 (37%), Gaps = 13/170 (7%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPT 471
           G+L++   +Y  A + F +  EL    I      + L +   D+ R   L D     +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 472 YPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLN 531
            PE        L+ K D   AI+ ++ AT+++           P    A  L       N
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKID-----------PKFAYAYTLQGHECSSN 598

Query: 532 --LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
                A +   KA   DPR   A  G+    ++    D A+  FEKA  +
Sbjct: 599 DSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 86/216 (39%), Gaps = 20/216 (9%)

Query: 345 GIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEY---SKYFDKALELN 401
           G +  LK D   A    EKA    P+  +Y Y  L   + S++  +    K F KA+  +
Sbjct: 558 GNYLSLKKDHEDAIEAFEKATKIDPKF-AYAY-TLQGHECSSNDSFDAAKKCFRKAIACD 615

Query: 402 PDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKL 461
           P   + YY  G        Y +A + FEKA+++   N    + + C        +   K 
Sbjct: 616 PRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINA---VLICCCGVALEKLEYQDKA 672

Query: 462 FDETRQKFPTYP--EVPTF-YAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVG 518
            +         P   +  F  A +L   G + LA++ ++  ++L   +  +H  +  L  
Sbjct: 673 LEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVLGQLY- 731

Query: 519 KATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIV 554
              ++ R+       EA +    A  +DP+  Q I+
Sbjct: 732 --QIMGRK------NEAIREFTVAMNLDPKGNQLIL 759

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 72/187 (38%), Gaps = 11/187 (5%)

Query: 395 DKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREND 454
           D  L   P+    +   G    + +D+  A   FEKA ++D    + Y          + 
Sbjct: 541 DYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDS 600

Query: 455 FDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIAT-RLEKAQKNIHVGI 513
           FD  +K F   R+     P     Y  +    G +++ +  YD A    EKA++   +  
Sbjct: 601 FDAAKKCF---RKAIACDPRHYNAYYGM----GIYSMKLGHYDEALLYFEKARQIYPINA 653

Query: 514 APLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELF 573
             +      L +   L    +A +  E AC + P S  A    A L       +LA++ F
Sbjct: 654 VLICCCGVALEK---LEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSF 710

Query: 574 EKAADLS 580
           E+ + L+
Sbjct: 711 EELSKLT 717

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKD-----PIFYSNISACYVSLGQL 171
           E  +I+   K++GN  ++A+ Y +A + YN  ++++ D        + N +AC + L   
Sbjct: 75  EPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNH 134

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILE 231
            + I    +AL  NP   K   R   A  SL    +A   +    L  D + A++  +L+
Sbjct: 135 RRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLD 193

Query: 232 RNLNK 236
           + + K
Sbjct: 194 KIVKK 198

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE++P+  + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 294 YLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 352

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 373 ISEVWYDLGTLYETCNNQLNDAL 395

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452
           Y  K+LE++P   + +YH G+++ +  DY  A   F++A   D  N   +  +  L Y+ 
Sbjct: 303 YLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 362

Query: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKG--------DFALAIKQYDIATRLEK 504
           + +      +    +  P       + +E+  D G            A+  Y  A RL+ 
Sbjct: 363 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP 415

Query: 505 AQKNIHV 511
             +NIH+
Sbjct: 416 --ENIHI 420

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 322 GRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 381

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 382 ISEVWYDLGTLYETCNNQLTDAL 404

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE+NP   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 267 KSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 322

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 283 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 342

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 343 ISEVWYDLGTLYETCNNQLTDAL 365

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 126 KDKGNKYFKAKDYTNAIKYYNLA-LDLNKDPIFYSNISACYVSLGQLDKVIESSTKAL 182
           K +GN+ FK  DYT A K+Y+L  ++   +PI YSN +   +     D+ I +    L
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           +  K+LE++P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 292 FLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 350

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 25/169 (14%)

Query: 394 FDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLAC------ 447
           + KAL  +P   + YY  G        Y +A + FEKA+ ++  N+   I + C      
Sbjct: 592 YRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICCCGVALE 648

Query: 448 -LAYRENDFDRCQKLFDETRQKFPTYPEVPTF-YAEILADKGDFALAIKQYDIATRLEKA 505
            L Y+E         + E   +      +  F  A +L   G +++A++ ++  T+L   
Sbjct: 649 KLQYQEKALS-----YYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPD 703

Query: 506 QKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIV 554
           +  +H  +  L     +L R+      K+A +    A  +DP+  Q I+
Sbjct: 704 EATVHFLLGQLY---QILGRK------KDAVKEFTIAMNLDPKGNQLII 743

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 72/181 (39%), Gaps = 13/181 (7%)

Query: 402 PDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREND-FDRCQK 460
           P++   +   G    + +D+  A   FEKA ++D    + Y  L    +  ND FD  + 
Sbjct: 532 PNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYT-LQGHEHSSNDSFDTAKN 590

Query: 461 LFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIAT-RLEKAQKNIHVGIAPLVGK 519
            +   R+     P+    Y  +    G   + + QYD A    EKA+    + +  +   
Sbjct: 591 CY---RKALACDPQHYNAYYGL----GMSCMKLGQYDEALLHFEKARSINPINVILICCC 643

Query: 520 ATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
              L +   L   ++A    E ACE+ P S  A    A L        +A++ FE+   L
Sbjct: 644 GVALEK---LQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKL 700

Query: 580 S 580
           +
Sbjct: 701 A 701

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%)

Query: 392 KYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K F+KA EL+P     Y  +G  Y   + +  A+  + KA   D  +   Y  L     +
Sbjct: 515 KAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQ 574

Query: 452 ENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLE 503
             + DR    F++ R   P    +       L    ++ LA+K YD A++L+
Sbjct: 575 NGNHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYDFASKLQ 626

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 74/166 (44%), Gaps = 17/166 (10%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAY-- 450
           ++ KAL  +    + YY  G       ++ ++ + FEKA+ ++  NI   + + C     
Sbjct: 550 FYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMINPVNI---VLICCCGVEL 606

Query: 451 -RENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNI 509
            +  +++   K +D   +  P         AE+L   G ++LA++ ++   +L+    N+
Sbjct: 607 EKVRNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNL 666

Query: 510 HVGIAPLVGKA-TVLARQPNLLNLKEATQLMEKACEIDPRSEQAIV 554
           H     ++GK    + R+      K+A +    A  +DP+  Q I+
Sbjct: 667 HY----MLGKIYQTMGRK------KDAVKEYTVAMNLDPKGNQYII 702

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 61/167 (36%), Gaps = 13/167 (7%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPT 471
           G+L++  Q+Y  A   FE+ + +  T +      + L +  +D  +   L +E    FP 
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNLANELIDNFPE 492

Query: 472 YPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLN 531
             +         + + D   AIK ++ AT L+           P    A  L       N
Sbjct: 493 AAQTWCVLGNHFSLQKDHDEAIKAFNKATELD-----------PRFAYAYTLQGHEYASN 541

Query: 532 --LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576
                A     KA   D +   A  GL     QN   D ++  FEKA
Sbjct: 542 ESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKA 588

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKAL 182
             K +GN+YFK  +Y +AIK Y   +++N ++PI YSN +   +   +  + + +    L
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE++P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 286 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 344

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 305 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 188 YSKALLRRASANESLENY-SDAL 209
            S+      +  E+  N  SDAL
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDAL 387

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYY--NLALDLNKDPI---FYSNISACYVSLGQL 171
           E  +I+   K +GN+ +KAK + +A + Y   +A++     I    ++N +AC + L   
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNY 137

Query: 172 DKVIESSTKALELNPNYSKALLR 194
            K +E   KAL +NP   K   R
Sbjct: 138 RKCVEDCGKALTINPKNIKCYYR 160

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE++P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 292 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 350

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 7/104 (6%)

Query: 478 FYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAP--LVGKATVLARQPNLLNLKEA 535
           + A   AD  ++ LA++  +   + EK++K +     P  ++G A +  +Q       E+
Sbjct: 644 YLARTYADATNWTLALEVSERLVKSEKSKKALRKVSWPYRILGVAYLEKQQD-----AES 698

Query: 536 TQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
            Q  + A  IDP   ++ +GL Q  L    V+ ++++FE+A DL
Sbjct: 699 IQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDL 742

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 80/387 (20%), Positives = 165/387 (42%), Gaps = 52/387 (13%)

Query: 119  KKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIES 177
            +K+S   +  G  Y + +    +I+++ LAL ++  D   +  +   Y++ G+++  ++ 
Sbjct: 676  RKVSWPYRILGVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKV 735

Query: 178  STKALELNPNYSKALLRRASANESLENYSDAL---------------FDLSVLSLNGDYS 222
              +AL+L+ ++S AL  +A  +  L  Y ++L               F +S  +L  +YS
Sbjct: 736  FERALDLDEHHSYALYYKAVCHSQLGEYEESLKLMYNLVGENPKTIPFKVSCATLISEYS 795

Query: 223  ------GASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276
                  G  ++ I E   +++AI ++++  N   G  + Q++  +  + ++ + +   E+
Sbjct: 796  KDLYSQGYLLKSISE---SQKAILLIDDINN--NGGLQSQEVWIALFTCINNYLLVQSEI 850

Query: 277  ----------TFQNYNENDQADVELL--TGLTNLFKRTDQGYLD-ADKNFVKAS--SLFM 321
                       FQN N    A V+ +    L ++   T    ++ A K  +  +  +L++
Sbjct: 851  DEMPIELLLNIFQNVNIKKVASVDAIDRLSLNDIIDNTSSSSIEIASKLLILCAKYALYL 910

Query: 322  --EELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLL-GAQTDIEKAIGFFPR-VNSYLYL 377
              E++++      L     +A E N    F + +    A    +K+I F    V S+  L
Sbjct: 911  TGEDISQATVGSSLWGNLGLA-ELNAYSLFDETEYRESAIMCFKKSIQFQSNYVESWFGL 969

Query: 378  ALISAD--KSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELD 435
            A+ + D     SQ     F KA+ L+P   ++ +    L     D   A     KA+ + 
Sbjct: 970  AVSTMDFNYRVSQHC---FIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINKAQTIS 1026

Query: 436  ETNIFPYIQLACLAYRENDFDRCQKLF 462
                 P++ LA L  ++N       LF
Sbjct: 1027 PAESSPWLGLALLNEKKNGSSNSVSLF 1053

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE +P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 286 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 344

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  SDAL
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDAL 387

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 320 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 379

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  SDAL
Sbjct: 380 ISEVWYDLGTLYETCNNQLSDAL 402

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 399 ELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           E++P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 359

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 72/184 (39%), Gaps = 36/184 (19%)

Query: 106 DMIQITSLPLEEQKKISMQLKDK----GNKYFKAKDYTNAIKYYNLALDLNKDP---IFY 158
           DM Q  +   E    ++ +L D     G+ Y    D   A   Y  AL    +P     +
Sbjct: 111 DMFQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLW 170

Query: 159 SNISACYVSLGQLDKVIESSTKALELNPNYSKA----------LLRRASANESLENYS-- 206
             I   Y   G L+   E+  K LEL+PN+ KA             +    ++LE +   
Sbjct: 171 HGIGILYDRYGSLEYAEEAFAKVLELDPNFEKANEIYFRLGIIYKHQGKWTQALECFRYI 230

Query: 207 -----------DALFDL-SVLSLNGDYSGA--SIEPILERNLNKQAIKVLNERMNKMTGS 252
                      D  F L SVL   G++ GA  + E +L +  N+   KVL +++  + G 
Sbjct: 231 LPQPPAPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLAQ--NEHHAKVL-QQLGCLYGM 287

Query: 253 NKEQ 256
           N  Q
Sbjct: 288 NNTQ 291

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALE 183
           LK +GN +F+  DY  A  YY+  + L   +PI YSN +   +  G     +E+  + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 184 LNPNYSK 190
              + +K
Sbjct: 66  YTSSSTK 72

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE +P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 284 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 342

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  SDAL
Sbjct: 363 ISEVWYDLGTLYETCNNQLSDAL 385

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKAL- 182
           +K++GN  F+  ++++A +YY   + L  ++PI YSN +   + L +  + I++  + L 
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 183 ------ELNPNYSKALLRRASANESLENY 205
                 +  P   K L R   A ESL  +
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE +P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 288 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 346

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 307 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 366

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  SDAL
Sbjct: 367 ISEVWYDLGTLYETCNNQLSDAL 389

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE +P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 278 YLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 336

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 297 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 356

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  SDAL
Sbjct: 357 ISEVWYDLGTLYETCNNQLSDAL 379

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 89/217 (41%), Gaps = 31/217 (14%)

Query: 353 DLLGAQTDIEKAIGFFPRVN----SYLYLALISADKSTSQEY----SKYFDKALELNPDS 404
           +L   Q D E AI +F +      ++ Y   +   + +S +        + +AL  +P  
Sbjct: 490 NLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQH 549

Query: 405 LSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLAC-------LAYRENDFDR 457
            + YY  G  Y     Y KA + FEKA+ ++  N+   I + C       L+Y+E     
Sbjct: 550 YNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVALEKLSYQEKAL-- 604

Query: 458 CQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLV 517
             + +++  +  P+        A +L     ++ A++ ++   +L   +  +H  +  L 
Sbjct: 605 --QYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVHFLLGQLY 662

Query: 518 GKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIV 554
               ++ R+      K+A +    A  +DP+    I+
Sbjct: 663 ---QIMGRK------KDAVKEFTVAMNLDPKGNPLII 690

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 81/196 (41%), Gaps = 13/196 (6%)

Query: 387 SQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLA 446
           S   S   ++ +E  P+    +   G LY + +D+  A   FEKA ++D    + Y  L 
Sbjct: 464 STRLSHLSNELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYT-LQ 522

Query: 447 CLAYREND-FDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKA 505
              +  ND  D  +  +   R+     P+    Y  +    G   + + QYD A    + 
Sbjct: 523 GHEHSSNDSIDTAKNCY---RRALACDPQHYNAYYGL----GMCYMKLGQYDKALLFFEK 575

Query: 506 QKNIH-VGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNE 564
            +NI+ V +  +      L +   L   ++A Q  E+ACE+ P S  A    A L     
Sbjct: 576 ARNINPVNVILICCCGVALEK---LSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMA 632

Query: 565 EVDLAIELFEKAADLS 580
               A+E FE+ A L+
Sbjct: 633 RYSAALENFEELAKLA 648

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQL---DKVIESSTKALELN 185
           G  Y K   Y  A+ ++  A ++N  P+    I  C V+L +L   +K ++   +A EL 
Sbjct: 557 GMCYMKLGQYDKALLFFEKARNIN--PVNVILICCCGVALEKLSYQEKALQYYEQACELQ 614

Query: 186 PNYSKALLRRASANESLENYSDAL 209
           P+ S A  ++A    S+  YS AL
Sbjct: 615 PSSSLAKFKKAHLLYSMARYSAAL 638

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 67/170 (39%), Gaps = 13/170 (7%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPT 471
           G+L++   +Y ++   F + + +  T        + L +  +D  R   L +E  +  P 
Sbjct: 421 GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN 480

Query: 472 YPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLN 531
            P+       + + + D   AIK ++ AT+++                A  L    +  N
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYN-----------FAYAYTLQGHEHSSN 529

Query: 532 --LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
             +  A     +A   DP+   A  GL    ++  + D A+  FEKA ++
Sbjct: 530 DSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKAL 182
           + K  GN YFK  +Y  A++YY   +++  ++PI YSN +   + L +  + +ES    L
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

Query: 183 E 183
           +
Sbjct: 65  K 65

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 5/97 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI-----FYSNISACYVSLGQL 171
           E  +I+   K++GN  +K K + +A + Y   +++  D        Y+N +AC + L   
Sbjct: 73  EPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNF 132

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
              I     AL  NP   K   R   A  ++  +  A
Sbjct: 133 RSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLNKD---PIFYSNISACYVSLGQLDKVIESSTKALELN 185
           G  +   KD+T A  Y +L   +N+D   PIF+ +I   Y  +GQ    +++ T+A+ LN
Sbjct: 421 GRIHMAKKDFTAA--YESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLN 478

Query: 186 PNYSKALLRRASANESL-ENYSDAL 209
           P  S+      +  E+  +  +DAL
Sbjct: 479 PYISEVWYNLGTLYETCNDQITDAL 503

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 122/322 (37%), Gaps = 46/322 (14%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLNKDP---IFYSNISACYVSLGQLDKVIESSTKALELN 185
           G+ Y    D   A   Y  AL+   DP     +  I   Y   G LD   E+  K L+L+
Sbjct: 239 GHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHGIGILYDRYGSLDFAEEAFKKVLDLD 298

Query: 186 PNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNER 245
           PN+ KA              ++  F L ++     + G   E I   N       +L   
Sbjct: 299 PNFEKA--------------NEIYFRLGIIY---KHKGRWNEAIESLNC------ILKRP 335

Query: 246 MNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQG 305
              +T S+   Q+     +   + G  D    +++ ++N+ ++ +LL  L  L+   +  
Sbjct: 336 PPPLTESDIWFQIGNILENKFDWNGAKD---AYEHVSKNNNSNPKLLKQLGCLYSMENVE 392

Query: 306 YLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAI 365
           + + D     A    ++ L  +P D       +    Y G     K D   A   +++A+
Sbjct: 393 FYNLDI----AMGHLVKSLELDPTD-------STTWYYLGRIHMAKKDFTAAYESLQQAV 441

Query: 366 GFFPRVNSYLYLALISADKSTSQEYSKY--FDKALELNPDSLSVYYHRGQLYFITQD-YP 422
               R N   + ++        Q +     + +A+ LNP    V+Y+ G LY    D   
Sbjct: 442 NRDSR-NPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQIT 500

Query: 423 KAKVEFEKAKELDETNIFPYIQ 444
            A   +E+A  LD  N  P IQ
Sbjct: 501 DALDSYERALSLDPEN--PVIQ 520

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 29/56 (51%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LEL+P   + +Y+ G+++   +D+  A    ++A   D  N   +  +  L Y+
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQ 460

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE++P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 351

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 312 GRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 371

Query: 188 YSK 190
            S+
Sbjct: 372 ISE 374

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 9/111 (8%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN--KDPI---FYSNISACYVSLGQL 171
           E  +++   K++GN  +K K Y +A   Y+  +++    D I    Y N +AC + L   
Sbjct: 74  EPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNF 133

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA----LFDLSVLSLN 218
              I    KAL  N    KA  R   A   L+   +A    LF L + S N
Sbjct: 134 RSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGLKLDSQN 184

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 83/185 (44%), Gaps = 13/185 (7%)

Query: 398 LELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREND-FD 456
           LE+N  +   +   G L+ + +D+ ++   F+++ +LD +  + Y  L    Y  ND FD
Sbjct: 402 LEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYT-LQGHEYSSNDAFD 460

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYD-IATRLEKAQKNIHVGIAP 515
                +   R+   + P+    +  +    G   L + QY+      EKA+    V +  
Sbjct: 461 TAMTCY---RKALGSNPQHYNAHYGL----GMCCLKLGQYEECLLHFEKARSINPVNVIL 513

Query: 516 LVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK 575
           +      L +   L + ++A Q  + ACE+ P S  A+   AQL L   + + A+E FEK
Sbjct: 514 ICCCGVALEK---LSHQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEK 570

Query: 576 AADLS 580
              ++
Sbjct: 571 LVTIA 575

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 7/104 (6%)

Query: 478 FYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAP--LVGKATVLARQPNLLNLKEA 535
           +  E   + G+++ A     I  + + A+K +     P  ++G A +  +Q +     +A
Sbjct: 633 YMVETYCNSGNWSAAESISKILVKTDGAKKYLRYTCWPFRVIGIANLERQQES-----DA 687

Query: 536 TQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
            +  + A  I+P + ++ VGL Q  L    ++ +I +FEKA +L
Sbjct: 688 IEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATEL 731

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 55/130 (42%), Gaps = 28/130 (21%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYSNISACYVSLGQLDKVIE 176
           + K+KG   F A DY  A  + N    +N  P       I  SN+  C + LG+  K IE
Sbjct: 306 EFKEKGTLSFSAGDYHTA--FQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIE 363

Query: 177 SSTKALEL-------------NPN------YSKALLRRASANESLENYSDALFDLSVLSL 217
            S+ AL+L             +P       + K +  +A A E +E+Y  AL +  +L  
Sbjct: 364 DSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIK 423

Query: 218 NGDYSGASIE 227
            G  S   +E
Sbjct: 424 RGAASRKVME 433

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIESSTKAL 182
           +LK+KGN+  KAK Y+ AI  Y+ A+ L      +Y+N +  Y+     D  I  + K++
Sbjct: 136 KLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSI 195

Query: 183 ELN----PNYSKALLRRASANESLENYSDAL 209
           E++    P   KA  R   A   + +Y  +L
Sbjct: 196 EIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 59/139 (42%), Gaps = 5/139 (3%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++P F+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 188 YSKALLRRA----SANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLN 243
            S+          + N  L +  DA    + L  N  +    +E + E+  N+    V+ 
Sbjct: 379 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNNVHIRERLEALTEQLANQSNGNVMA 438

Query: 244 ERMNKMTGSNKEQQLLPST 262
            +    T SN    +L  T
Sbjct: 439 HQPKAATASNPPPVMLQPT 457

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE++    + +YH G+++ +  DY  A   F+ A   D  N   +  +  L Y+
Sbjct: 303 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQ 358

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 28/112 (25%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYSNISACYVSLGQLDKVIE 176
           + K+KG   F+  DY  A + Y  +  LN  P       + +SNI  C + +G+  + + 
Sbjct: 327 EFKEKGANSFRTGDYHAAFQNYEKS--LNSLPLTHPLRVVSFSNIIICRLKVGEYREALS 384

Query: 177 SSTKALELNPN-------------------YSKALLRRASANESLENYSDAL 209
            ++ AL+L P                    +SK +  +A A E +ENY  AL
Sbjct: 385 DASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 61/148 (41%), Gaps = 1/148 (0%)

Query: 357 AQTDIEKAIGFFP-RVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLY 415
           A+    KAI   P   N+Y  L ++S      +E   +F+KA  +NP ++ +    G   
Sbjct: 581 AKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVAL 640

Query: 416 FITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEV 475
                  KA   +E A EL  ++     + A L Y    +    K F+E +   P    V
Sbjct: 641 EKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATV 700

Query: 476 PTFYAEILADKGDFALAIKQYDIATRLE 503
                +I +  G    AIK+Y IA  L+
Sbjct: 701 HFLLGQIYSILGRKKDAIKEYTIALNLD 728

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 26/108 (24%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + +  G ++FK  DY +A+  Y  +L+    K P   I YSNI A  + +G+  + ++  
Sbjct: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607

Query: 179 TKALELNPN---------------------YSKALLRRASANESLENY 205
             ALEL P                      + K +LR+A A E +E Y
Sbjct: 608 DVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 64/129 (49%), Gaps = 9/129 (6%)

Query: 478 FYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAP--LVGKATVLARQPNLLNLKEA 535
           +  E+ A   +++ A++  +   + EKA++ +     P  ++G   +  +Q +     ++
Sbjct: 630 YMTEVYAKSNNWSSAVQIAERLVKAEKAKRVLQTMNWPYRVIGIGNLERQQES-----DS 684

Query: 536 TQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL--SRTMDEKIQAMTFA 593
            +  + A  +DP   ++ +GL Q  L    ++ +I++FEKA +L  S T  +  +++  +
Sbjct: 685 IEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIALS 744

Query: 594 EAAKIQKRI 602
           E  +  + I
Sbjct: 745 EMGEFTESI 753

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYY-NLALDLNKDPIFYSNISACYVSLGQLDKVIESSTK 180
           S  L+ KGN  +   +Y  A+ YY N +L    +P+  +N+S   + L + +  + +  +
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 181 ALEL 184
           ALE+
Sbjct: 68  ALEI 71

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 5/97 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN--KDPI---FYSNISACYVSLGQL 171
           E  +++   K++GN  F  K +  A   YN  +++    D I    ++N +AC + L   
Sbjct: 75  EPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNY 134

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
              I     AL LNP   K   R   A   L N  +A
Sbjct: 135 RSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 13/185 (7%)

Query: 398 LELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREND-FD 456
           LE+N  +   +   G L+ + +D+ ++   F+++ +LD +  + Y  L    Y  ND FD
Sbjct: 403 LEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYT-LQGHEYSSNDAFD 461

Query: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYD-IATRLEKAQKNIHVGIAP 515
                +   R+   +  +    Y  +    G  +L + QY+      EKA+    V +  
Sbjct: 462 TAMTCY---RKALASNSQHYNAYYGL----GMCSLKLGQYEECLLHFEKARSINPVNVIL 514

Query: 516 LVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK 575
           +      L +   L + + A Q  + ACE+ P S  A+   AQL L   + + A+E FEK
Sbjct: 515 ICCCGVALEK---LSHQERALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEK 571

Query: 576 AADLS 580
              ++
Sbjct: 572 LVKIA 576

>SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G+ Y K  DY  A+  + + L+  N+D   Y  I   Y+ L +++K I+S   AL L P+
Sbjct: 583 GHTYRKMGDYERAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPS 642

Query: 188 --YSKALLRRA 196
              ++ LL++A
Sbjct: 643 NQIAQDLLKQA 653

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 367 FFPRVN-SYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAK 425
           FFP  +   L+L +     +T     +Y   A ++ P    +    G +YF   DYPKAK
Sbjct: 496 FFPGTHLPNLFLGMQYIVMNTLSLAEEYLTLAYDICPHDPLLLNEMGVIYFKKSDYPKAK 555

Query: 426 VEFEKAKE 433
             F+KA E
Sbjct: 556 KYFKKAWE 563

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 33.9 bits (76), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 126 KDKGNKYFKAKDYTNAIKYYN-LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALEL 184
           K++GN+ +K   Y +AI  Y+ L     ++P+ +SN +   + LG+  + IE+  + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 185 NPNYSKALLR 194
             +   A LR
Sbjct: 68  AASPQHAALR 77

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  K+LE++    + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 299 YLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 357

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 318 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 377

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 378 ISEVWYDLGTLYETCNNQLNDAL 400

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 48/123 (39%), Gaps = 27/123 (21%)

Query: 129 GNKYFKAKDYTNAIKYYNLAL-DLNKD--PIFYSNISACYVSLGQLDKVIESSTKALELN 185
           G+ Y    D T A   Y  AL  L     P  +  I   Y   G LD   E+  K LEL+
Sbjct: 136 GHCYLMLDDLTRAYNSYQQALYHLTNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELD 195

Query: 186 PNYSKA----------LLRRASANESLENYS-------------DALFDL-SVLSLNGDY 221
           P++ KA             +   N++LE +              D  F L SVL   G++
Sbjct: 196 PHFEKANEIYFRLGIIYKHQGKWNQALECFRYILNQPPAPLQEWDIWFQLGSVLESMGEW 255

Query: 222 SGA 224
           +GA
Sbjct: 256 TGA 258

>KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 395

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 37/80 (46%), Gaps = 16/80 (20%)

Query: 88  TATADVLTSYPTNDSN-DPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYN 146
           T   DV   YP +D N D D         E+  + S  +KD G+  FK+KDY NA   Y 
Sbjct: 214 TIGGDVFEEYPDDDLNFDKD-------SAEKAYEASCIIKDSGSLLFKSKDYQNAYFKYR 266

Query: 147 LAL--------DLNKDPIFY 158
            AL        D++ D +FY
Sbjct: 267 KALKYVNEFIPDIDMDKVFY 286

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT+A   +  A++ + ++P F+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 365 GRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPY 424

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 425 ISEVWYDLGTLYETCNNQVNDAL 447

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE++    + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 349 KSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQ 404

>KLTH0E15444g Chr5 complement(1369017..1370666) [1650 bp, 549 aa]
           {ON} conserved hypothetical protein
          Length = 549

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 423 KAKVEFEKAKEL-DETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAE 481
           K+KV  E+ K L  ET   P   L CL   E D +  ++LF+  +Q  PT P  P+F  +
Sbjct: 454 KSKV-LERQKLLRSETRPMPRGPLLCLNTAEKDVE-FERLFNSAKQISPTSPHGPSFGTK 511

Query: 482 ILADK 486
             AD+
Sbjct: 512 TEADQ 516

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           Y  ++LE++ +  + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 274 YLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQ 332

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DY  A + +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDAL 375

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 53/102 (51%), Gaps = 1/102 (0%)

Query: 119 KKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIES 177
           K +S   +  G  + + +    +I+++  AL ++K+ I  +  +   YV  G+++  I+ 
Sbjct: 695 KSLSWPYRVVGISHLERQQEAESIEWFQSALRIDKEDIESWVGLGQAYVGCGRIEASIKV 754

Query: 178 STKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNG 219
             KA+EL+ N+  A L  A +  ++  Y D++  L  L+L+ 
Sbjct: 755 FEKAIELDSNHLYAKLFLAESLSNIGEYEDSILLLKELTLSS 796

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 94/220 (42%), Gaps = 23/220 (10%)

Query: 362 EKAIGFFPRVNS-YLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQD 420
           EK+ G   + N  Y  L +   +K    E  ++F  AL ++ + +  +   GQ Y+    
Sbjct: 668 EKSKGALQKANWPYRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGR 727

Query: 421 YPKAKVEFEKAKELDETNIFP-YIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFY 479
              +   FEKA EL   ++F  Y +   LA    ++++C ++     +K P         
Sbjct: 728 LEASIKVFEKATELAPDHLFAGYFKAISLA-GIGEYEQCIEIIAALLEKLPNEESFQVSM 786

Query: 480 AEILAD-------KGDFALAIKQ---------YDIATRLEKAQKNIHVGIAPLVGKATVL 523
             IL D       +G  A A+ Q         Y I+    K Q N+ + ++  +    ++
Sbjct: 787 VNILIDYSVELFSQGYLAKAVAQAVDSIKRIEYIISNISHKVQ-NVWISLSKALKLFILV 845

Query: 524 ARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQN 563
             + ++L ++    + E ACE+  ++  ++  L ++ L+N
Sbjct: 846 QSKVDMLPIESLVNIFE-ACEL--KNTDSVDTLDEINLEN 882

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++P F+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  SDAL
Sbjct: 379 ISEVWYDLGTLYETCNNQLSDAL 401

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE +    + +YH G+++ +  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 303 KSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ 358

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 80/188 (42%), Gaps = 13/188 (6%)

Query: 395 DKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREND 454
           ++ LE  PD    +   G LY + +D+ +A   FEKA E+D    + Y  L    +  ND
Sbjct: 499 NELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYT-LQGHEHSSND 557

Query: 455 -FDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIA-TRLEKAQKNIHVG 512
             D  +  +   R+   + P+    Y  +    G   + + QY+ A    EKA+    V 
Sbjct: 558 SIDMAKTCY---RKAIASDPQHYNAYYGL----GMCCMKLGQYEEALLYFEKARSINPVN 610

Query: 513 IAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIEL 572
           +  +      L +   +   ++A Q  E A E+ P S  A    A L        +A+E 
Sbjct: 611 VILICCCGVALEK---MSYQEKALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALEN 667

Query: 573 FEKAADLS 580
           FE+ A+L+
Sbjct: 668 FEELAELA 675

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 75/177 (42%), Gaps = 24/177 (13%)

Query: 394 FDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLAC------ 447
           + KA+  +P   + YY  G        Y +A + FEKA+ ++  N+   I + C      
Sbjct: 566 YRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV---ILICCCGVALE 622

Query: 448 -LAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQ 506
            ++Y+E    +  + ++   +  P+        A +L     +++A++ ++    L   +
Sbjct: 623 KMSYQE----KALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALENFEELAELAPDE 678

Query: 507 KNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIV-GLAQLKLQ 562
             +H  +  L     ++ R+      K+A +    A  +DP+  Q I+  L +  LQ
Sbjct: 679 ATVHFLLGQLY---QIMGRK------KDAVKEFTIAMNLDPKGNQLIIDALEKCHLQ 726

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 126 KDKGNKYFKAKDYTNAIKYYN-LALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALEL 184
           K++GN  FK   Y  A+  Y+ L     ++P+ YSN +   + LG+  + I+   + L  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 185 NPNYSKALLR 194
                   +R
Sbjct: 68  TSTAEHVAIR 77

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 69/168 (41%), Gaps = 15/168 (8%)

Query: 394 FDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREN 453
           + KA+  +P   + YY  G        Y KA + FEKA+ ++  N    I + C  +   
Sbjct: 578 YRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA---ILICCCGHSLE 634

Query: 454 DFDRCQK--LFDETRQKFPTYPEVPTF-YAEILADKGDFALAIKQYDIATRLEKAQKNIH 510
             +   +   + E  +K      +P +  A++L   G F+ A+  ++  T+L   +  +H
Sbjct: 635 KLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVH 694

Query: 511 VGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQ 558
             +  +      + R+      K+A +    A  +DP   Q I+   Q
Sbjct: 695 FMLGQIY---QTMGRK------KDAIKEYTIALNLDPMGNQVIIDALQ 733

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++P F+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 374

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 375 ISEVWYDLGTLYETCNNQLTDAL 397

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE++    + +YH G+++ +  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ 354

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query: 117 EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLAL-----DLNKDPIFYSNISACYVSLGQL 171
           E  +I+   K++ N  +K K + +A + Y   +     D + +   ++N +AC + L   
Sbjct: 80  EPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNY 139

Query: 172 DKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
              +    KA+E+NP   K   R   A  +L  + +A
Sbjct: 140 RSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDF 455
           KA+E+NP +L  +Y  G+ +     + +A        ++DE N+     LA +A RE + 
Sbjct: 148 KAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENVPLKNLLAVIAKRETE- 206

Query: 456 DRCQKLFDETRQK 468
              +K +DE + K
Sbjct: 207 ---RKEYDEKKLK 216

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 364 AIGFFPRVN-SYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422
           A  FFP  +  +LYL +  +   T     +YF  A ++ P    +    G +YF   DYP
Sbjct: 492 AARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYP 551

Query: 423 KAKVEFEKAKE 433
           +AK  F++A E
Sbjct: 552 RAKKFFKRACE 562

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 364 AIGFFPRVN-SYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422
           A  FFP  +  +LYL +  +   T     +YF  A ++ P    +    G +YF   DYP
Sbjct: 482 AARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYP 541

Query: 423 KAKVEFEKAKE 433
           +AK  F++A E
Sbjct: 542 RAKKFFKRACE 552

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 49/111 (44%), Gaps = 19/111 (17%)

Query: 478 FYAEILADKGDFALA-------IKQYDIATRLEKAQKNIHV-GIAPLVGKATVLARQPNL 529
           +   I  D G++A A       IK  +  T L KA     V GI+ L  +          
Sbjct: 649 YICTIYTDCGNWATASQIAERLIKSENAKTELRKANWPYRVMGISFLEDQ---------- 698

Query: 530 LNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLS 580
            N  ++ +  + A  +DP   ++ VGL Q       V+ +I++FEKA +LS
Sbjct: 699 -NETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELS 748

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 5/101 (4%)

Query: 392 KYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELD-ETNIFPYIQLACLAY 450
           ++F  AL ++P+ +  +   GQ YF       +   FEKA EL  + N   Y     LA 
Sbjct: 705 EWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYFNSVALA- 763

Query: 451 RENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFAL 491
                D  ++  D  R      PE   F  E+     D++ 
Sbjct: 764 ---QMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDYSF 801

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 46/112 (41%), Gaps = 2/112 (1%)

Query: 374 YLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKE 433
           Y  + +   ++    E  ++F  AL ++P+ +  +   GQ YF       +   FEKA E
Sbjct: 688 YRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIE 747

Query: 434 LDETNIFP-YIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILA 484
           +D  +++  Y     LA     F+ C ++     Q  P        Y+ IL 
Sbjct: 748 IDPLHLYAQYFNSLSLA-EMGCFEECIEILKNITQLNPEELAFQVSYSSILV 798

>ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} similar
           to uniprot|P89105 Saccharomyces cerevisiae YOL145C CTR9
           Component of the Paf1p complex which is a large complex
           that binds to and modulates the activity of RNA
           polymerase II and is required for expression of a subset
           of genes including cyclin genes contains TPR repeats
          Length = 1096

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNY 188
           G  +++ KDY  AI  +  AL+LN  P+  +N +A  V+LG     + +S        NY
Sbjct: 224 GMCFWQLKDYKLAIAAWKRALELN--PV--NNNAAVLVTLGNFHNSLTASENDESFRENY 279

Query: 189 SKAL 192
           SKAL
Sbjct: 280 SKAL 283

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSN----ISACYVSLGQLDKVIES 177
           SM L  +    ++ K+Y  +++ +   L +N  P+ Y +    I  C+  L      I +
Sbjct: 182 SMFLLLRAKLLYQKKNYMASLRAFQELLVIN--PVMYPDPRIGIGMCFWQLKDYKLAIAA 239

Query: 178 STKALELNP--NYSKALLRRASANESL----------ENYSDALFDLSVL 215
             +ALELNP  N +  L+   + + SL          ENYS AL DL  L
Sbjct: 240 WKRALELNPVNNNAAVLVTLGNFHNSLTASENDESFRENYSKALQDLDGL 289

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++P F+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDAL 405

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE++    + +YH G+++ +  DY  A   F+ A   D  N   +  +  L Y+
Sbjct: 307 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQ 362

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++PIF+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 292 GRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 351

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 352 ISEVWYDLGTLYETCNNQLTDAL 374

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 399 ELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           E +P   + +YH G+++ I  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 331

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 26/112 (23%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + KD+  + FK  DY  A++ Y  + +   +  P   I YSN+ A  +  GQ  + +  +
Sbjct: 347 EFKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVA 406

Query: 179 TKALELNPN---------------------YSKALLRRASANESLENYSDAL 209
           + AL+L P                      + K + RRA A E  EN+ +A 
Sbjct: 407 SMALKLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAF 458

>NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3.5
           YOL145C
          Length = 1087

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 121/556 (21%), Positives = 209/556 (37%), Gaps = 123/556 (22%)

Query: 133 FKAKDYTNAIKYYNLALD----LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNY 188
           F+ K+Y  ++K +   L     L  DP     I AC+  L      I+S  +A +L+ N 
Sbjct: 198 FRKKNYVASLKLFQELLVSNPVLKPDPRI--GIGACFWHLKDYKMAIKSWERATQLDANS 255

Query: 189 SKALLR-----RASANES------LENYSDALFDLSVLSLNGDYSGASIEPIL------- 230
           S ++L        S  ES       ENY+ +L DL+ L  + ++      P+L       
Sbjct: 256 SASILCLLGKFHNSLTESENDTQFKENYTASLMDLNTLYNDTNHPENKENPVLLTLLQSY 315

Query: 231 --ERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSL-VSFFGIFDPELTFQNYNENDQA 287
              +N  +  +K+ +E++  ++    +  L  ST     +++ + D    F  + E+   
Sbjct: 316 FYYKNDFENVLKIYDEKIKPISTLVADSILSESTLWCGRAYYALDDYRKAFAMFQES--- 372

Query: 288 DVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLE---------KTA 338
              L T   NL  +   G      N ++ S L  E L K+      L          K  
Sbjct: 373 ---LKTNEENLLAKLGLGQAQLKTNLLEESILTFENLYKSHAGIQELNYILGMLYAGKCF 429

Query: 339 IALEYNGIFRFLKNDLLGAQTDI--EKAIGFFPRVNSYLYLALISADK----------ST 386
            A   N         + G +  I   KA+ F  +     Y+ L +A K          + 
Sbjct: 430 AAAGQNHESTSTTTTMSGKEISILNAKALQFLEK-----YIKLTTAKKNQLVIPRAYLTI 484

Query: 387 SQEYSK---------YFDKALE----LNPDS--LSVYYHRGQLYFITQDYPKAKVEFEKA 431
           SQ Y K         Y  KALE    +N D+  L +  + G  YFI  D  KAK  F+ A
Sbjct: 485 SQLYEKTNQYKQSLDYLTKALEEIQFINKDNVPLELLNNIGSFYFINGDADKAKEYFDLA 544

Query: 432 KEL---DETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTY--PEVPTFYAEI---- 482
           K     D +++              D ++ Q L+ +   + P Y   ++ T + +     
Sbjct: 545 KSKLSNDSSSLTTINYNIARTLETKDLEKSQVLYQDILNEHPNYIAAKIRTLFFKFVNGN 604

Query: 483 ---------LADKGDFALAIKQY------DIATRLEKAQKNIH-------------VGIA 514
                    LA   D  L ++ +      +   + EK ++  +               + 
Sbjct: 605 ESIKDEMTNLAKMNDSDLEVRSFYAWYLKNTTLKNEKEKETSYNKDTLVKYDSHDLYALI 664

Query: 515 PLVGKATVLARQ--PNLLNLKE----------ATQLMEKACEIDPRSEQAIVGLAQLKLQ 562
            L     ++AR+   N+ +LKE          A QL +K  +IDP +  A  G+A +  +
Sbjct: 665 SLGNLYCLIAREGRKNVKSLKEQEKSKHSYLKAIQLFQKVLQIDPFNVFAAQGIAIIFAE 724

Query: 563 NEEVDLAIELFEKAAD 578
           ++ +  A+E+  K  D
Sbjct: 725 SKRLGAAVEILRKVRD 740

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 374 YLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKE 433
           Y  L + + +K +  E  ++F  AL ++P  L  +   GQ Y+       +   FEKA E
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 434 LDETNIFPY 442
           ++ T+ + +
Sbjct: 743 VEPTSAYAH 751

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 100/248 (40%), Gaps = 42/248 (16%)

Query: 332 HLLEKTAIALEYNGIFRFLKN---------DLLGAQTDIEKAIGFFPRVN----SYLYLA 378
           HL +K   +   NG+   + N         +LL  Q D + AI  F +      ++ Y  
Sbjct: 523 HLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY 582

Query: 379 LISADKSTSQEYS----KYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKEL 434
            +   + +S + S      + KAL  +P   + YY  G        Y +A + FEKA+ +
Sbjct: 583 TLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

Query: 435 DETNIFPYIQLAC-------LAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKG 487
           +  N+   + + C       L Y+E    +  + ++   Q  PT         ++L    
Sbjct: 643 NPVNV---VLICCCGGSLEKLGYKE----KVLQYYELACQLQPTSSLSKYKMGQLLYSMT 695

Query: 488 DFALAIKQYDIATRLEKAQKNIHVGIAPLVGKA-TVLARQPNLLNLKEATQLMEKACEID 546
            + +A++ ++   +L       H     L+G+   ++ R+      K+A + +  A  +D
Sbjct: 696 RYNVALQTFEELVKLVPDDATAHY----LLGQTYRIVGRK------KDAVKELTVAMNLD 745

Query: 547 PRSEQAIV 554
           P+  Q ++
Sbjct: 746 PKGNQVVI 753

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 118 QKKISM---QLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDK 173
           Q K++M     KD GN++FK  +Y  AI+ Y   + L   + + YSN++  Y+     ++
Sbjct: 28  QDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLK----NR 83

Query: 174 VIESSTKALELNPNYSK 190
             + +  A E+  +Y K
Sbjct: 84  CPDEAKTACEMGLSYCK 100

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 52/134 (38%), Gaps = 8/134 (5%)

Query: 362 EKAIGFFPRVNS-YLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQD 420
           EK+      VN  Y  L +   +K    E  ++F  AL + P  L  +   GQ Y+    
Sbjct: 671 EKSKSILQNVNWPYRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGR 730

Query: 421 YPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFP-------TYP 473
              +   FEKA E+   N + +   A    +   +D   ++F E   + P       +  
Sbjct: 731 VEASVKVFEKALEVSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMV 790

Query: 474 EVPTFYAEILADKG 487
           EV   +  +L  +G
Sbjct: 791 EVLVEHCNVLCSQG 804

>SAKL0C02816g Chr3 complement(264072..267428) [3357 bp, 1118 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1118

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 377 LALISADKSTSQEYSKYFDKALELNP-DSLSVYYHRGQLYFITQDYPKAKVEFEKAKELD 435
           +AL  A+K   QE  ++F   LEL+    L +Y    + Y   +DYP+A+V +EK   L 
Sbjct: 543 VALTKAEKY--QEAIEFFTPLLELDDYRGLELYKPLSKCYKEVEDYPRARVIYEKLVALS 600

Query: 436 ETNIFPYIQLACLAYRENDFDRCQKLFDET 465
             N+   + LA + Y   D +   +L  E 
Sbjct: 601 PANLETKLTLAEIHYHLGDHETFNRLLLEV 630

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187
           G  +    DYT A   +  A++ + ++P F+ +I   Y  + Q    +++ T+A+ LNP 
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 444

Query: 188 YSKALLRRASANESLEN-YSDAL 209
            S+      +  E+  N  +DAL
Sbjct: 445 ISEVWYDLGTLYETCNNQLNDAL 467

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 396 KALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYR 451
           K+LE++    + +YH G+++ +  DY  A   F++A   D  N   +  +  L Y+
Sbjct: 369 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ 424

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 100/248 (40%), Gaps = 42/248 (16%)

Query: 332 HLLEKTAIALEYNGIFRFLKN---------DLLGAQTDIEKAIGFFPRVN----SYLYLA 378
           HL +K   +   NG+   + N         +LL  Q D + AI  F +      ++ Y  
Sbjct: 511 HLHDKVKSSNLANGLMDTMPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY 570

Query: 379 LISADKSTSQEYS----KYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKEL 434
            +   + +S + S      + KAL  +P   + YY  G        Y +A + FEKA+ +
Sbjct: 571 TLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

Query: 435 DETNIFPYIQLAC-------LAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKG 487
           +  N+   + + C       L Y+E    +  + ++      PT         ++L    
Sbjct: 631 NPVNV---VLICCCGGSLEKLGYKE----KALQYYELACHLQPTSSLSKYKMGQLLYSMT 683

Query: 488 DFALAIKQYDIATRLEKAQKNIHVGIAPLVGKA-TVLARQPNLLNLKEATQLMEKACEID 546
            +++A++ ++   +L       H     L+G+   ++ R+      K+A + +  A  +D
Sbjct: 684 RYSVALQTFEELVKLVPDDATAHY----LLGQTYRIVGRK------KDAIKELTVAMNLD 733

Query: 547 PRSEQAIV 554
           P+  Q I+
Sbjct: 734 PKGNQVII 741

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 65/170 (38%), Gaps = 13/170 (7%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPT 471
           G+L+F   +Y  +   F + K+L    +      + L +  +D  +   L +      P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 472 YPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLN 531
            PE       +L+ + D   AIK ++ AT+L+           P    A  L    +  N
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 580

Query: 532 --LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
                A     KA   DP+   A  GL    ++  + + A+  FEKA  +
Sbjct: 581 DSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 69/175 (39%), Gaps = 11/175 (6%)

Query: 407 VYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREND-FDRCQKLFDET 465
            +   G L+ + +D+ +A   F KA +LD    + Y  L    Y  ND FD  +  F + 
Sbjct: 494 AWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYT-LQGHEYSNNDAFDNAKSCFRKA 552

Query: 466 RQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLAR 525
                T+              G F  A+  ++ A    +A   ++V +    G A    +
Sbjct: 553 LTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKA----RALNPVNVILNCCCGVALERLQ 608

Query: 526 QPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLS 580
           QP     + A    E A E+ P S  A+   +QL L   +   A+  FE+   L+
Sbjct: 609 QP-----ERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLT 658

>Kpol_354.6 s354 complement(11315..12757) [1443 bp, 480 aa] {ON}
           complement(11315..12757) [1443 nt, 481 aa]
          Length = 480

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 84  PD-QTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAI 142
           PD + TA  D + + PT  SNDP++  + +L  +   K+ ++   K    F   D  + I
Sbjct: 363 PDPRFTAMLDFVKARPTEFSNDPNVTLMKNLS-DITPKVLLE-HGKTKNPFPNVDSASGI 420

Query: 143 KYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALEL 184
            +Y+  L   K+ +F++ I  C  S+G L +++      L +
Sbjct: 421 LFYHYGL---KELLFFTVIFGCSRSMGPLTQLVWDRIYGLPI 459

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 49/110 (44%)

Query: 394 FDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREN 453
           FDKA +L+P+ +  Y  +G  Y     Y  AK  + KA   D  +   Y  +   + +  
Sbjct: 613 FDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLG 672

Query: 454 DFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLE 503
           ++++    F++ R   P+   +       +   G+   A+  Y++A +++
Sbjct: 673 EYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQ 722

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 70/173 (40%), Gaps = 17/173 (9%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDET----RQ 467
           G L+ + +D+ +A   FEK  +LD T  + Y   A     ++ FD  +  F +      Q
Sbjct: 572 GNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQ 631

Query: 468 KFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQP 527
            +  Y  +     ++    G+F  A+  ++ A  +  +    +V +    G A      P
Sbjct: 632 HYNAYYGIGMCSMKL----GEFEHALLYFEKARSINPS----NVILICCCGVAFEKLSYP 683

Query: 528 NLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLS 580
                ++A    E AC++ P S  A    A L        LA+E FE+   L+
Sbjct: 684 -----EKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLA 731

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 160 NISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNG 219
           N +AC+  +G+L+K +  +TK   + P   K  +R+    + L    DA         N 
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALRNA 158

Query: 220 DYSGASIEPILERNLNKQAIKVLNERMN 247
           +++  S    L+ N++K  I ++  + N
Sbjct: 159 NFATDS----LKINVSKTFIDIIVHQKN 182

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 70/173 (40%), Gaps = 33/173 (19%)

Query: 132 YFKAKD-YTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIESSTKALELNPNYS 189
           YF AK  +  AI Y+  AL LNK     ++ +   +V +      IE   +A+++NP   
Sbjct: 393 YFSAKQQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDF 452

Query: 190 KALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKM 249
           KA      A E L+ +  AL+ L            S++P     L+K+  + L    +K+
Sbjct: 453 KAWYGLGQAYEVLDRHLYALYYLQ--------KACSLKP-----LDKRMWQALANCYDKL 499

Query: 250 TGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRT 302
              N+  +     + L                  NDQ D+ +L  L  L++R 
Sbjct: 500 DRPNQAIKCFQRASQL-----------------SNDQ-DITILYYLATLYERV 534

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 478 FYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAP--LVGKATVLARQPNLLNLKEA 535
           +  E+  +  ++  A++  +   + EKA++ +     P  ++G A +  +Q +      +
Sbjct: 634 YITEMYTNNANWEAAVQISERLVKAEKAKRILQSTSWPYRVLGIAYLQNQQES-----SS 688

Query: 536 TQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL--SRTMDEKIQAMTFA 593
            +  + A  +DP   ++ VGL Q  L    ++ ++++FEKA +L  S    +  +A+  A
Sbjct: 689 IEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSHLHAQYFKALALA 748

Query: 594 EAAKIQKRI 602
           +  +    I
Sbjct: 749 DMGEFSASI 757

>NDAI0H02660 Chr8 (657972..659459) [1488 bp, 495 aa] {ON} Anc_7.103
           YAL010C
          Length = 495

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452
           YFD  +E + D+LS+YY  G++Y     YP + +E    K L+  N      L+  AY  
Sbjct: 123 YFDNGIEKSKDNLSLYY--GRMY-----YPSSDLEAMIIKRLNRNNQMTLKWLSSSAYNF 175

Query: 453 N 453
           N
Sbjct: 176 N 176

>Skud_13.179 Chr13 (308649..309785) [1137 bp, 378 aa] {ON} YMR024W
           (REAL)
          Length = 378

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 77/194 (39%), Gaps = 37/194 (19%)

Query: 185 NPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEP-----ILERNLNKQAI 239
           NP+   A +     N+ L+N+   +   ++LS +   S   I P     +L   +N    
Sbjct: 121 NPSIGAAFINTVPTNKYLDNHGLNILGKNLLSFHVTKSIIQIYPRLPTVVLNAAVNAYIS 180

Query: 240 KVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDP------ELTFQNYNENDQADVELLT 293
           + +   + K  G   E      TTS++S +   +P       L F N + N +  +EL+T
Sbjct: 181 EAVLAHIAKYWGIEVE------TTSIISRYLKLEPFEFTLGRLRFFNNSLNSEDGIELIT 234

Query: 294 GLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKND 353
           G                KNF + S+L M   +       + E+     +   +++F+ N 
Sbjct: 235 G----------------KNFSETSALAMSVRSIIAAVWAVTEQK----DSQAVYKFIDNH 274

Query: 354 LLGAQTDIEKAIGF 367
           ++  + DI K   F
Sbjct: 275 IMSRKLDITKMFQF 288

>KAFR0F01380 Chr6 complement(272714..273889) [1176 bp, 391 aa] {ON}
           Anc_1.456 YJR032W
          Length = 391

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 77/189 (40%), Gaps = 43/189 (22%)

Query: 92  DVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNA-------IKY 144
           DV   YP +D+         S    E    +  +K+ G   FK+KDY NA       +KY
Sbjct: 214 DVYEEYPDDDT------HFDSENFGEAFNATNIIKESGTLLFKSKDYQNAFFKYKKSLKY 267

Query: 145 YN---LALDLNKDP---------IFYSNISACYVSLGQLDKVIESSTKALELNP----NY 188
            N     LD++K+            Y N+S    +L ++D+ I  ST  LE++     + 
Sbjct: 268 VNEFLPELDVDKENNIKFNNLKMKLYLNLSLVLFNLQRIDESINYSTYLLEMDDVPDLDK 327

Query: 189 SKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNK 248
           +KA  RR + + S +   +AL D  +                E N N + I    E + +
Sbjct: 328 AKAYYRRGNCHLSKKRLDEALDDYKLCK--------------EHNPNDEVIDQKIEYVEQ 373

Query: 249 MTGSNKEQQ 257
           +    KE+Q
Sbjct: 374 LIEQKKEKQ 382

>KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}
           Anc_2.665 YKL022C
          Length = 780

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 121 ISMQLKDKGNKYFKAKDYTNAIKYYNLAL-DLNKDPIFYSNISACYVSLGQLDKVIESST 179
           IS+Q  + G+ Y K  DY +AIK +   L D  +D   Y  +   Y+   QL K ++   
Sbjct: 620 ISIQ-TNLGHTYKKLGDYEHAIKCFKYILEDSERDVDTYCTLGFLYLKTNQLQKAVDILH 678

Query: 180 KALELNP---NYSKALLRRASANESLENYSD 207
           +AL + P   N ++ L+R    N + E  SD
Sbjct: 679 RALAIEPSNQNANEMLVRALELNVAKELDSD 709

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 99/248 (39%), Gaps = 42/248 (16%)

Query: 332 HLLEKTAIALEYNGIFRFLKN---------DLLGAQTDIEKAIGFFPRVN----SYLYLA 378
           HL +K   +   NG+   + N         +LL  Q D + AI  F +      ++ Y  
Sbjct: 518 HLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY 577

Query: 379 LISADKSTSQEYS----KYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKEL 434
            +   + +S + S      + KAL  +P   + YY  G        Y +A + FEKA+ +
Sbjct: 578 TLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

Query: 435 DETNIFPYIQLAC-------LAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKG 487
           +  N+   + + C       L Y+E    +  + ++      PT         ++L    
Sbjct: 638 NPVNV---VLICCCGGSLEKLGYKE----KALQYYELACHLQPTSSLSKYKMGQLLYSMT 690

Query: 488 DFALAIKQYDIATRLEKAQKNIHVGIAPLVGKA-TVLARQPNLLNLKEATQLMEKACEID 546
            + +A++ ++   +L       H     L+G+   ++ R+      K+A + +  A  +D
Sbjct: 691 RYNVALQTFEELVKLVPDDATAHY----LLGQTYRIVGRK------KDAIKELTVAMNLD 740

Query: 547 PRSEQAIV 554
           P+  Q I+
Sbjct: 741 PKGNQVII 748

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 71/180 (39%), Gaps = 13/180 (7%)

Query: 402 PDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKL 461
           P+    +   G L  + +D+  A   FEKA +LD    + Y  L    +  ND     K 
Sbjct: 537 PNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT-LQGHEHSSNDSSDSAKT 595

Query: 462 FDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIAT-RLEKAQKNIHVGIAPLVGKA 520
               R+     P+    Y  +    G  A+ + QY+ A    EKA+    V +  +    
Sbjct: 596 C--YRKALACDPQHYNAYYGL----GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCG 649

Query: 521 TVLARQPNLLNLKE-ATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
             L +    L  KE A Q  E AC + P S  +   + QL       ++A++ FE+   L
Sbjct: 650 GSLEK----LGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKL 705

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 65/170 (38%), Gaps = 13/170 (7%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPT 471
           G+L+F   +Y  +   F + K+L    +      + L +  +D  +   L +      P 
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 538

Query: 472 YPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLN 531
            PE       +L+ + D   AIK ++ AT+L+           P    A  L    +  N
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 587

Query: 532 --LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADL 579
                A     KA   DP+   A  GL    ++  + + A+  FEKA  +
Sbjct: 588 DSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 69/163 (42%), Gaps = 15/163 (9%)

Query: 394 FDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYREN 453
           + KAL +NP+  + +Y  G        Y +A + FEKA+ ++  N+   I   C      
Sbjct: 514 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV---ILNCCCGVALE 570

Query: 454 DFDRCQKLFDETRQKFPTYP--EVPTF-YAEILADKGDFALAIKQYDIATRLEKAQKNIH 510
              R +K  D  +      P   +  F  +++L + G ++ A++ ++   +L   +  IH
Sbjct: 571 RLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPIH 630

Query: 511 VGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAI 553
             +  L     ++ R+      K+A      A  +DP+  Q +
Sbjct: 631 FLLGQLY---QIVGRK------KDAITQFTIAMNLDPKGIQLV 664

>CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} similar
           to uniprot|P35187 Saccharomyces cerevisiae YMR190c SGS1
           DNA helicase
          Length = 1371

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 546 DPRSEQAIVG-LAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRA 604
           D RS + I G +  LK Q E       L EK  DL++TM  KI  M     ++  KR + 
Sbjct: 159 DKRSNKTIDGSIPVLKAQKE-------LIEKLKDLNKTMTSKIDIMESTSLSEDYKRTQI 211

Query: 605 DPVISAKV 612
           + VI+ K+
Sbjct: 212 NTVINPKI 219

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 11/121 (9%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIESSTKALELNPN 187
            N Y   +++  +I Y+  AL LNK+    ++ +   +V L      IES  +A+++NP 
Sbjct: 405 ANYYSAKQEHEKSIMYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIESYRRAVDINPR 464

Query: 188 YSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMN 247
             KA      A E L        D+ + SL       +++P+ +R    QA+    E+++
Sbjct: 465 DFKAWYGLGQAYEVL--------DMHLYSLYYFQKACALKPLDKRMW--QALASCYEKLS 514

Query: 248 K 248
           K
Sbjct: 515 K 515

>TDEL0F00970 Chr6 (168428..170716) [2289 bp, 762 aa] {ON} Anc_8.136
           YGL178W
          Length = 762

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 94  LTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAK 136
           +TS     SN+P M++ITSLPLEE   + +     G ++ + K
Sbjct: 110 ITSNDQGMSNNPPMLEITSLPLEELDYVKLATDQFGCRFLQKK 152

>Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON}
           (58546..61800) [3255 nt, 1085 aa]
          Length = 1084

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 125/317 (39%), Gaps = 56/317 (17%)

Query: 161 ISACYVSLGQLDKVIESSTKALELNP------------NYSKALLRRASANESLENYSDA 208
           I  C+  L      I+S  +ALELNP            ++ K+L   ++ N+  + Y++A
Sbjct: 224 IGLCFWQLKDYKMAIKSWKRALELNPKDKSAEILVLLGDFHKSLTESSNDNQFSDYYTEA 283

Query: 209 LFDLSVLSLNGDYSGASIEPILERNLN---------KQAIKVLNERMNKMTGSNKEQQLL 259
           L +L+ L     YS     P+L   L          K  + +   +++K+        L 
Sbjct: 284 LKNLNNL-----YSNNKENPVLLTLLQSYFYFKGDYKAVLDIHENKISKVASITTNSVLS 338

Query: 260 PSTTSLV-SFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASS 318
            S      + + + D    F  + E+      L     NL  +   G      N ++ S 
Sbjct: 339 DSAFWCARAHYSLHDYRKAFTMFQES------LRKNEDNLLAKFGLGQTQFKTNLLEESI 392

Query: 319 LFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTD--IEKAIGFFPRV----- 371
           L  E L K+ +    L    + L Y+G    L N L  +++   I K+I +  +      
Sbjct: 393 LTFENLYKSFEGIQEL-NYILGLLYSGKVLNLSNILPHSESQKLIAKSIQYLEKYVKLTT 451

Query: 372 ---------NSYLYLALISADKSTSQEYSKYFDKALE----LNPDSL--SVYYHRGQLYF 416
                     +YL L+ +   ++  ++  +Y  KA+E    +N D +   +  + G  YF
Sbjct: 452 TKKNQLVIPKAYLILSELYEIQNNYKQSLEYLTKAMEDAKAINKDEIPFEILNNIGCFYF 511

Query: 417 ITQDYPKAKVEFEKAKE 433
           IT D  KA   FE AKE
Sbjct: 512 ITGDSNKAIEYFEFAKE 528

>SAKL0D02684g Chr4 (221650..223746) [2097 bp, 698 aa] {ON} conserved
           hypothetical protein
          Length = 698

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESSTKALEL 184
           G  Y K  D   + ++Y +AL  N K P+ + ++ A Y+  GQL   + + ++A+ L
Sbjct: 298 GRFYSKLDDSQKSYEHYQIALQHNQKSPLPWISVGAVYLKTGQLHDSLTAYSQAVSL 354

>KLLA0A07579g Chr1 complement(679469..681631) [2163 bp, 720 aa] {ON}
           weakly similar to uniprot|Q7LGN4 Saccharomyces
           cerevisiae YOR080W DIA2 Protein of unknown function
           involved in invasive and pseudohyphal growth
          Length = 720

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 6/149 (4%)

Query: 405 LSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDE 464
           L+  Y  G  +   ++Y KA   F KA ++  +  +P   +  +  R     RC   +DE
Sbjct: 13  LTRTYELGLKWMQCREYSKALGLFSKAMKVSRS--YPMEMVENIRIRAGMPKRCA--YDE 68

Query: 465 TRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKN--IHVGIAPLVGKATV 522
           ++   P Y ++       L   GD+A A+K+     ++E +     + +G +  +     
Sbjct: 69  SKAYHPLYVKLLDSRISCLMKVGDYARAVKESQYFCKIEPSSTRALLRLGKSYELADKGD 128

Query: 523 LARQPNLLNLKEATQLMEKACEIDPRSEQ 551
            ARQ      K   +L E+   + P  E+
Sbjct: 129 RARQVYKSGRKLVKELKERGVLVSPVHEK 157

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 394 FDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLAC------ 447
           + KAL +NP+  + +Y  G        Y +A + FEKA+ ++  N+   +   C      
Sbjct: 495 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCCGVALER 552

Query: 448 LAYRENDFD 456
           L  RE   D
Sbjct: 553 LGRREKALD 561

>ZYRO0D12364g Chr4 (1037070..1039499) [2430 bp, 809 aa] {ON} similar
           to Q12309 YDR416W uniprot|Q04048 Saccharomyces
           cerevisiae CLF1 sssential splicesome assembly factor
          Length = 809

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 10/93 (10%)

Query: 395 DKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFP-------YIQLAC 447
           D  L  NP+S+  + HR  L+   +D  K  V  E    +D + +F        + + A 
Sbjct: 374 DLRLRQNPNSVETWRHRATLFQTIKD--KCNVYAEAILAIDASKVFVPGSLATIWCEHAA 431

Query: 448 LAYRENDFDRCQKLFDET-RQKFPTYPEVPTFY 479
           L +    FD  ++++D   R  FP   ++ T +
Sbjct: 432 LYWNAKAFDTAKEIWDRALRVPFPHLKDLETIW 464

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 160 NISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208
           NI ACY  L  L   +  S K+L+L+P+ +K  +R       L+++  A
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIRCTRTLIKLKDWKRA 131

>ZYRO0G12562g Chr7 complement(992906..994966) [2061 bp, 686 aa] {ON}
           conserved hypothetical protein
          Length = 686

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 62/141 (43%), Gaps = 17/141 (12%)

Query: 120 KISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKVIESS 178
           +I +QL    N Y        A  YY  AL+LN   P  + +I + Y+ LGQ++  + + 
Sbjct: 293 RILLQLDPVHNVY-------GAYGYYQRALNLNISKPYTWISIGSLYLRLGQINDALSAY 345

Query: 179 TKALELNPNYSKALLRRASANES-LENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQ 237
           T+   L    S+A  + ++AN   L N++     L+   +   Y       I  R+L   
Sbjct: 346 TQGSVLALESSQAAEQTSNANSKFLINFNHLFGALAWFGIAQTY-------IFSRDL-AS 397

Query: 238 AIKVLNERMNKMTGSNKEQQL 258
           A++ L+        +N  QQ+
Sbjct: 398 AVEALSRSAQLFAKANNPQQV 418

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 68/165 (41%), Gaps = 11/165 (6%)

Query: 412 GQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPT 471
           G ++ + +D+ +A   F+KA +LD    + Y  L    Y  ND       FD  +  +  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYT-LQGHEYSSND------AFDTAKTCYRK 473

Query: 472 YPEVPTFYAEILADKGDFALAIKQYDIAT-RLEKAQKNIHVGIAPLVGKATVLARQPNLL 530
                + +       G   L + QY+ +    +KA     V +  +     V  +   L 
Sbjct: 474 ALATNSQHYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNVILICCCGVVFEK---LG 530

Query: 531 NLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK 575
           + ++A +  E ACE+ P S  A+   +QL L     + A+  FEK
Sbjct: 531 HQQDALKYYELACELQPTSSLALFKKSQLLLSMGSYNSALVNFEK 575

>TBLA0A10010 Chr1 complement(2461989..2463617) [1629 bp, 542 aa]
           {ON} Anc_6.120 YBR222C
          Length = 542

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 281 YNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIA 340
           Y  N +A+ E  T   N F+  DQGY+D ++NFV  +    E + +  +    +E   I 
Sbjct: 395 YANNPKANKENFTKRENFFRTGDQGYID-NENFVVLTGRIKELINRGGEKISPVELDGIM 453

Query: 341 LE 342
           LE
Sbjct: 454 LE 455

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASA 198
            Y N+SA Y  L +LDK  ESS++ + + P   K  +R    
Sbjct: 73  LYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKV 114

>Kwal_56.24487 s56 (1016327..1017439) [1113 bp, 370 aa] {ON} YLR216C
           (CPR6) - cyclophilin related to the mammalian CyP-40
           [contig 161] FULL
          Length = 370

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 65/148 (43%), Gaps = 23/148 (15%)

Query: 125 LKDKGNKYFKAKDYTNAIKYYNLA---------LDLNKDPI---------FYSNISACYV 166
           +K+ G   FK K+YT A+  Y  A          DL +D I            N++ C +
Sbjct: 221 VKEIGTAQFKVKNYTTALAKYEKASSMLKQYQPQDLPEDDIKKIDQLRLSILLNVALCAL 280

Query: 167 SLGQLDKVIESSTK----ALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYS 222
                 KV+ S+T+    A   + + +KAL RR  A  +L++   AL DL   +      
Sbjct: 281 KTTDYQKVLASTTEVVHDAAADDKSKAKALYRRGLAYYNLKDPQMALTDLEFATTYQQND 340

Query: 223 GASIEPILE-RNLNKQAIKVLNERMNKM 249
            A ++ I + R L K+ +    + ++KM
Sbjct: 341 AAILKAINDARKLQKEQVAKQKKSLSKM 368

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 24/110 (21%)

Query: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178
           + K KG + F   +Y++A+  Y  +L+   +  P   I  SNI    + LG+    +++ 
Sbjct: 291 EFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSNIITTQLKLGESSSALQNI 350

Query: 179 TKALEL-------------NPN------YSKALLRRASANESLENYSDAL 209
             AL L             NP       + K  +R+A A E +ENY  AL
Sbjct: 351 ETALRLIGEDELQLTIPASNPPKSYREFWGKITMRKAEALEHVENYVSAL 400

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa]
           {ON} similar to uniprot|P40450 Saccharomyces cerevisiae
           YIL159w BNR1
          Length = 1294

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 84/211 (39%), Gaps = 39/211 (18%)

Query: 220 DYSGASIEPILERNLNKQAIKVLNER--------MNKMTGSNKEQQLLPSTTSLVSFF-G 270
           DY  A +EP++   L+ + +   N +        +  +  S++ + L+     LV++   
Sbjct: 131 DYVTALLEPLVTVILDLEQMHGHNSKFLYIHLRCIKTIMNSSEGRLLVLKNDVLVTYLRD 190

Query: 271 IFDPELTFQ-NYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLF--------- 320
           I   +L F  N+ +N    +E+L  L+         YLD D+ F      F         
Sbjct: 191 IVTTDLEFSINFVKNKCQAMEVLLLLS---------YLDMDRGFQVIYETFEPYMDEWMD 241

Query: 321 -----MEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKA---IGFFPRVN 372
                 +EL        L+  T I +EY  +F F+ N ++      EK    I  F  V 
Sbjct: 242 STLCNCDELQHYESSSSLINPTKILVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVE 301

Query: 373 SYLYLALISA---DKSTSQEYSKYFDKALEL 400
            +  L  +     D++TS +  KY D  LE+
Sbjct: 302 KFTPLITLIENLDDENTSTQIKKYRDVKLEI 332

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 18/97 (18%)

Query: 133 FKAKDYTNAIKYYNLALD----LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN- 187
           F+ K++  ++K +   L     L  DP     I AC+  L      I +  ++LEL+P  
Sbjct: 208 FRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPTN 265

Query: 188 -----------YSKALLRRASANESLENYSDALFDLS 213
                      + K L+   + +E  +N+ DA+ DLS
Sbjct: 266 KNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELD----ETNIFPYIQLACL 448
           YF KA  L P    ++   G+ YFI  +   A   +++A +L     + +I  Y +LA L
Sbjct: 543 YFQKACALKPLDKRMWQALGECYFIVDNTDSALKCYKRALQLSDLALQDSIILY-KLAIL 601

Query: 449 AYRENDFDRCQKLFDET 465
             + +D + C+K+  +T
Sbjct: 602 YEKMDDIENCKKMMIQT 618

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 129 GNKYFKAKDYTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIESSTKALELNPN 187
            N Y   +++  +I Y+  AL LNK     ++ +   +V L      IE   +A+++NP 
Sbjct: 427 ANYYSARQEHEKSIMYFRRALTLNKSCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPK 486

Query: 188 YSKALLRRASANESLENYSDALF 210
             KA      A E LE +  +LF
Sbjct: 487 DFKAWYGLGQAYEVLEMHLYSLF 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,824,905
Number of extensions: 2814055
Number of successful extensions: 9599
Number of sequences better than 10.0: 316
Number of HSP's gapped: 9530
Number of HSP's successfully gapped: 475
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)