Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B062602.284ON72372332900.0
NDAI0B035602.284ON75676017270.0
Suva_9.1042.284ON80582317040.0
YIL095W (PRK1)2.284ON81083216700.0
Smik_9.842.284ON80882616360.0
Skud_9.782.284ON80983216200.0
KAFR0J013702.284ON78079915240.0
SAKL0E07722g2.284ON79180414900.0
KLTH0G10318g2.284ON79080614330.0
TDEL0G021502.284ON66131513890.0
ZYRO0A01848g2.284ON70446913391e-175
KAFR0H033302.284ON36936113051e-175
NCAS0G038102.284ON66145013201e-173
NDAI0G006402.284ON62131513121e-172
TPHA0C033802.284ON69735113171e-172
Kwal_27.115422.284ON79137313101e-170
KLLA0E08405g2.284ON77769813011e-169
CAGL0G02607g2.284ON68831512871e-168
Kpol_1003.352.284ON71332212851e-167
TBLA0B059302.284ON71733812721e-165
YNL020C (ARK1)2.284ON63830912571e-164
Skud_14.3092.284ON63930912491e-163
Suva_14.3272.284ON63230612431e-162
Smik_14.3112.284ON63732312381e-161
Kpol_1039.332.284ON70138012361e-160
KNAG0H020202.284ON59231112221e-159
ADL217W2.284ON75036112151e-156
Ecym_33232.284ON74834512071e-155
KNAG0A054302.284ON78832911811e-151
TBLA0B069402.284ON144332511831e-144
CAGL0J03432g2.284ON62232011231e-144
TPHA0D015402.284ON70734010301e-129
Kpol_251.43.273ON8383127961e-93
CAGL0H10208g3.273ON10273208042e-93
SAKL0D03234g3.273ON8583157919e-93
KNAG0J008203.273ON10913287905e-91
NCAS0A105903.273ON10953187905e-91
ZYRO0E06864g3.273ON11153197872e-90
TBLA0E025903.273ON10613247833e-90
KAFR0A010403.273ON9123237754e-90
YBR059C (AKL1)3.273ON11083257801e-89
Skud_2.1793.273ON10903197774e-89
Smik_2.1913.273ON11083197766e-89
NDAI0A057003.273ON11573267751e-88
Suva_4.2973.273ON11073197696e-88
Kpol_1052.223.273ON11013207686e-88
KLTH0C07260g3.273ON9013087536e-87
Ecym_26503.273ON8943077519e-87
TDEL0D035203.273ON10493167561e-86
TPHA0M011203.273ON7883337432e-86
KNAG0H012203.273ON9133247492e-86
Kwal_27.109453.273ON9353087451e-85
KAFR0C004303.273ON9493227461e-85
KLLA0F18612g3.273ON8143177372e-85
CAGL0K11990g3.273ON9913217435e-85
TPHA0A040303.273ON10543337342e-83
TBLA0I019303.273ON13613167379e-83
AGR027C3.273ON9613097199e-82
KNAG0F001701.24ON5433222681e-23
SAKL0A03344g6.262ON3643542522e-22
SAKL0H06754g8.668ON8842042541e-21
TPHA0G016308.668ON8712012389e-20
ABL034W2.479ON14252252343e-19
Kwal_56.242746.262ON3463292263e-19
Kpol_431.92.479ON15522052319e-19
Kpol_1072.198.668ON8962882282e-18
KLTH0H03080g6.262ON3463322202e-18
KLTH0D11044g8.668ON8492052244e-18
ACL006W6.31ON7083252244e-18
TDEL0A067506.262ON3721522185e-18
NCAS0C016708.668ON8962052235e-18
Smik_1.793.177ON9742682235e-18
ZYRO0F07194g8.668ON9382902237e-18
CAGL0K08514g2.479ON14892032221e-17
KLTH0G05214g5.591ON6531942201e-17
YAR019C (CDC15)3.177ON9742682211e-17
KAFR0A050906.31ON6682422201e-17
KNAG0J016708.668ON10092042201e-17
TPHA0F024306.31ON7982152192e-17
YPL150W8.668ON9012872192e-17
KNAG0D048107.86ON14401772202e-17
CAGL0M02299g8.668ON8932922182e-17
Ecym_30356.31ON7403272172e-17
Skud_1.723.177ON9742672183e-17
Suva_16.1608.668ON9182862173e-17
Suva_11.1232.479ON15262342183e-17
TDEL0A061408.668ON8612902164e-17
Kpol_2002.241.24ON4872002134e-17
Kpol_1023.266.31ON7392902154e-17
Skud_16.426.262ON3643232104e-17
Ecym_73922.479ON14342012164e-17
KNAG0B053502.496ON8362332155e-17
TPHA0E038501.24ON4822012126e-17
NCAS0D021006.31ON7264172147e-17
ZYRO0D05500g7.86ON12621822148e-17
KLTH0F16676g5.406ON8782542138e-17
Kwal_47.183075.591ON6212712121e-16
KLTH0D05566g2.479ON11282072131e-16
CAGL0K02673g2.496ON9152292121e-16
Suva_16.706.262ON3643292061e-16
KAFR0G012001.24ON5072322091e-16
Kwal_26.87518.668ON8481972111e-16
NDAI0K021002.496ON9092352111e-16
SAKL0C00946g1.24ON5642222092e-16
Kwal_55.215455.406ON8652752112e-16
NDAI0E023908.668ON8832012102e-16
Skud_16.1328.668ON9242862102e-16
TBLA0A047207.86ON12621852103e-16
KAFR0G026906.31ON7132922083e-16
TDEL0A025502.479ON13692052103e-16
KAFR0D032002.479ON14482032093e-16
KLTH0D10714g8.654ON8722332083e-16
NDAI0H024707.86ON14111862093e-16
NDAI0F045201.24ON4891942064e-16
TPHA0I009201.271ON14342592094e-16
Sklu_YGOB_Anc_2.4962.496ON6192322074e-16
TPHA0G032002.479ON15342062085e-16
KLLA0F13552g2.479ON12672072085e-16
TDEL0A027202.496ON9152312075e-16
Smik_6.3478.668ON9172872075e-16
Kwal_26.77882.479ON12672072085e-16
KAFR0C014403.92ON10952272075e-16
Kpol_1055.242.496ON9372282075e-16
TBLA0I011502.479ON17452052076e-16
KLLA0B13607g2.496ON9892342067e-16
ZYRO0B01166g2.496ON9632292067e-16
TDEL0H036407.86ON12371872067e-16
YKL101W (HSL1)2.479ON15182182067e-16
KAFR0D012207.86ON10551912067e-16
Kwal_26.71547.86ON12131832068e-16
Kwal_33.131121.24ON5053002038e-16
NCAS0A057702.479ON14611962069e-16
Kwal_26.78612.496ON9552342059e-16
YPL236C (ENV7)6.262ON3643231999e-16
Smik_8.422.496ON9391762041e-15
Kpol_463.81.271ON14472592051e-15
KAFR0A017602.496ON8852302041e-15
Ecym_10301.24ON4401932011e-15
Kpol_1037.206.31ON7042912031e-15
KLTH0D06006g2.496ON9542302041e-15
Kpol_1072.298.654ON8932072041e-15
CAGL0J03872g8.654ON6612032031e-15
KLLA0F11319g8.668ON8432032031e-15
CAGL0L03520g1.271ON14472602041e-15
Smik_11.1392.479ON15342062041e-15
TBLA0I002802.496ON13162292041e-15
Suva_6.1691.271ON14842562041e-15
KLTH0C10912g6.31ON6972942022e-15
TPHA0H026307.86ON13671862032e-15
NCAS0A050502.496ON8932312032e-15
KLTH0D02486g7.86ON12231832032e-15
KAFR0D033902.496ON7982862022e-15
CAGL0L11550g5.406ON10721942022e-15
Suva_1.863.177ON9742672022e-15
KAFR0D049505.406ON10082372022e-15
Skud_8.392.496ON9231762022e-15
YDR523C (SPS1)1.24ON4902001992e-15
NCAS0A002801.24ON5352361992e-15
Skud_13.1546.31ON7052942003e-15
Skud_11.1262.479ON15182212023e-15
YMR001C (CDC5)6.31ON7053492003e-15
Ecym_55055.406ON10031942013e-15
KAFR0A083603.60ON8292462013e-15
KLTH0F00946g1.24ON5121981993e-15
KNAG0D008306.262ON3873401963e-15
ZYRO0F18062g1.24ON4712131983e-15
ACR133C8.668ON8512022003e-15
SAKL0E01584g6.31ON6953082003e-15
KLLA0A07403g3.60ON8792402003e-15
TBLA0E022907.86ON13001872013e-15
Smik_6.4416.262ON3643261953e-15
SAKL0C01716g1.52ON12152332003e-15
TBLA0A035705.406ON9752002003e-15
NCAS0F015807.86ON13821872003e-15
TPHA0J004206.31ON7072921994e-15
TBLA0B004906.31ON7872911994e-15
TPHA0D011408.654ON6222371984e-15
ACL104C5.406ON9471942004e-15
YHL007C (STE20)2.496ON9391762004e-15
Suva_13.1636.31ON7052941994e-15
KLLA0E21693g5.406ON10162302004e-15
TBLA0B039708.654ON12082092004e-15
KNAG0E008506.31ON7112941994e-15
CAGL0K05709g1.52ON11032361994e-15
NDAI0J012508.279ON11761971994e-15
SAKL0H16632g8.279ON10622301995e-15
KLLA0C06138g6.31ON7083421985e-15
SAKL0H07084g8.654ON9192061995e-15
NDAI0C026806.31ON7502921985e-15
AFR724C1.24ON4401931955e-15
Suva_8.472.496ON9801761985e-15
NDAI0E012908.654ON7292321976e-15
YJL095W (BCK1)1.271ON14782591996e-15
Smik_13.1596.31ON7052921976e-15
Kwal_56.224766.31ON6972921976e-15
TPHA0G032902.496ON9731801986e-15
TBLA0A071501.52ON13912931987e-15
KLLA0F07623g7.86ON12291961987e-15
Ecym_26407.86ON13251811978e-15
TBLA0H016605.406ON9962421978e-15
CAGL0F00913g7.86ON12061861978e-15
KAFR0H025108.668ON8792051978e-15
KLLA0E03587g5.591ON6472961959e-15
CAGL0I07513g3.92ON10762321979e-15
TBLA0A074601.24ON5161951949e-15
Smik_4.8031.24ON4902001941e-14
KNAG0K023703.60ON8831811961e-14
NCAS0B086001.52ON11172331961e-14
Skud_4.7971.24ON4852041931e-14
Skud_3.1656.371ON7161961951e-14
AFR696C1.52ON11422331951e-14
KNAG0A030408.654ON6442011941e-14
ZYRO0A06446g5.406ON9432371951e-14
Kwal_26.87098.654ON8292341941e-14
Suva_2.7031.24ON4852041921e-14
CAGL0M10153g2.496ON8671801951e-14
TDEL0G043806.31ON7222941941e-14
ZYRO0D06776g8.279ON12042141951e-14
NCAS0H019405.406ON10152291952e-14
CAGL0H06259g7.86ON13361801952e-14
ABR014W2.496ON9711801942e-14
TBLA0B085203.60ON9342451942e-14
ZYRO0F06842g8.654ON8432011942e-14
YDR507C (GIN4)1.52ON11422921952e-14
TBLA0C029401.271ON16432821952e-14
NCAS0C041208.140ON9153321942e-14
KLLA0C01650g1.52ON11123001942e-14
TDEL0C064901.52ON11532251942e-14
Skud_8.1635.406ON10762361942e-14
Suva_15.2975.406ON10742371942e-14
Skud_4.7831.52ON11352911942e-14
ZYRO0G03366g2.479ON16161981942e-14
TPHA0P012703.60ON8851811932e-14
KNAG0B043205.406ON10272371932e-14
Kpol_1072.318.652ON5262151912e-14
TBLA0B023103.92ON8192551932e-14
ACR281C7.86ON12591811932e-14
SAKL0E02860g2.479ON13772061932e-14
CAGL0M02519g8.654ON7562041922e-14
KLTH0D03454g1.271ON14332581932e-14
NCAS0A094701.271ON15152591933e-14
TDEL0A060008.654ON7902001923e-14
NDAI0D027502.479ON15152031933e-14
KNAG0F002901.52ON11252251933e-14
SAKL0D05522g1.271ON14742591933e-14
KLLA0C12485g3.92ON9252321923e-14
TBLA0B082503.92ON13472191933e-14
Kwal_26.73551.271ON14462361923e-14
TPHA0G017108.654ON8052061923e-14
Skud_16.1408.654ON8652091923e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B06260
         (723 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...  1271   0.0  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   669   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   660   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   647   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   634   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   628   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   591   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   578   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   556   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   539   0.0  
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   520   e-175
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   507   e-175
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   513   e-173
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    509   e-172
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   511   e-172
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   509   e-170
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   505   e-169
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   500   e-168
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   499   e-167
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   494   e-165
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   488   e-164
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   485   e-163
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   483   e-162
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   481   e-161
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   480   e-160
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   475   e-159
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   472   e-156
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   469   e-155
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   459   e-151
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   460   e-144
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   437   e-144
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   401   e-129
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   311   1e-93
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   314   2e-93
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   309   9e-93
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   308   5e-91
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   308   5e-91
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   307   2e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   306   3e-90
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   303   4e-90
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   305   1e-89
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   303   4e-89
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   303   6e-89
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   303   1e-88
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   300   6e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   300   6e-88
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   294   6e-87
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   293   9e-87
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   295   1e-86
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   290   2e-86
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   293   2e-86
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   291   1e-85
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   291   1e-85
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   288   2e-85
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   290   5e-85
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   287   2e-83
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   288   9e-83
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   281   9e-82
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   107   1e-23
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...   101   2e-22
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   102   1e-21
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    96   9e-20
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    95   3e-19
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    92   3e-19
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    94   9e-19
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    92   2e-18
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    89   2e-18
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    91   4e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    91   4e-18
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    89   5e-18
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    91   5e-18
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    91   5e-18
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    91   7e-18
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    90   1e-17
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    89   1e-17
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    90   1e-17
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             89   1e-17
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    89   1e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    89   2e-17
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    89   2e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    89   2e-17
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    89   2e-17
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    88   2e-17
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    89   3e-17
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    88   3e-17
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    89   3e-17
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    88   4e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    87   4e-17
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    87   4e-17
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    86   4e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    88   4e-17
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    87   5e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   6e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      87   7e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    87   8e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    87   8e-17
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    86   1e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    87   1e-16
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    86   1e-16
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    84   1e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    85   1e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    86   1e-16
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    86   1e-16
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    85   2e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   2e-16
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    86   2e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    86   2e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    86   3e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    85   3e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    86   3e-16
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    85   3e-16
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    85   3e-16
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    85   3e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    84   4e-16
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    85   4e-16
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    84   4e-16
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    85   5e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    85   5e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    84   5e-16
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    84   5e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    85   5e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    84   5e-16
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    84   5e-16
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    84   6e-16
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    84   7e-16
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    84   7e-16
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    84   7e-16
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    84   7e-16
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    84   7e-16
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    84   8e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    83   8e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    84   9e-16
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    84   9e-16
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    81   9e-16
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    83   1e-15
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    84   1e-15
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    83   1e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    82   1e-15
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    83   1e-15
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    83   1e-15
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    83   1e-15
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    83   1e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    83   1e-15
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    83   1e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    83   1e-15
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    83   1e-15
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    83   1e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    82   2e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    83   2e-15
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    83   2e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    83   2e-15
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    82   2e-15
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    82   2e-15
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    82   2e-15
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    82   2e-15
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    82   2e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    81   2e-15
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        81   2e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    82   3e-15
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    82   3e-15
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    82   3e-15
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    82   3e-15
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    82   3e-15
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    81   3e-15
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    80   3e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    81   3e-15
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    82   3e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    82   3e-15
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    82   3e-15
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    82   3e-15
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    80   3e-15
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    82   3e-15
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    82   3e-15
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    82   3e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    81   4e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    81   4e-15
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    81   4e-15
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    82   4e-15
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    82   4e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    81   4e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    82   4e-15
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    82   4e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    81   4e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    81   4e-15
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    81   4e-15
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    81   5e-15
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    81   5e-15
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    81   5e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    81   5e-15
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    80   5e-15
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    81   5e-15
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    80   6e-15
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    81   6e-15
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    80   6e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    80   6e-15
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    81   6e-15
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    81   7e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    81   7e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    80   8e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    80   8e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    80   8e-15
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    80   8e-15
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    80   9e-15
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    80   9e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    79   9e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    79   1e-14
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    80   1e-14
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    80   1e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    79   1e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    80   1e-14
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    80   1e-14
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    79   1e-14
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    80   1e-14
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    79   1e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    79   1e-14
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    80   1e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    79   1e-14
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    80   1e-14
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    80   2e-14
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    80   2e-14
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    79   2e-14
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    79   2e-14
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    79   2e-14
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    80   2e-14
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    80   2e-14
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    79   2e-14
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    79   2e-14
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    79   2e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    79   2e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    79   2e-14
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    79   2e-14
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    79   2e-14
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    79   2e-14
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    79   2e-14
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    78   2e-14
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    79   2e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    79   2e-14
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    79   2e-14
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    79   2e-14
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    79   2e-14
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    79   3e-14
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    79   3e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    79   3e-14
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    79   3e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    79   3e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    79   3e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   3e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    79   3e-14
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    79   3e-14
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    79   3e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    79   3e-14
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    79   3e-14
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    79   3e-14
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    79   3e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    79   3e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    79   3e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    79   3e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    79   4e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    79   4e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    78   4e-14
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    78   4e-14
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    78   4e-14
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    78   4e-14
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    78   4e-14
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    78   4e-14
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    78   4e-14
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    78   4e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    78   5e-14
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    78   5e-14
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    78   5e-14
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    78   5e-14
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    78   5e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    78   5e-14
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    78   5e-14
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     78   5e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    78   6e-14
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     77   6e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    77   6e-14
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    77   6e-14
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    78   6e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     77   6e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    78   7e-14
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    77   7e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    77   7e-14
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    77   7e-14
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    77   7e-14
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    77   7e-14
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    77   7e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    77   8e-14
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    77   8e-14
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    77   8e-14
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    77   9e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    77   9e-14
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    77   1e-13
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    77   1e-13
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    77   1e-13
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               77   1e-13
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    77   1e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    77   1e-13
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    77   1e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    76   1e-13
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    77   1e-13
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    75   1e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    77   1e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   1e-13
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    76   1e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    77   1e-13
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    77   1e-13
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     76   1e-13
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    76   2e-13
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    76   2e-13
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    77   2e-13
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    75   2e-13
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    76   2e-13
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    76   2e-13
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    76   2e-13
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    76   2e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    76   2e-13
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    76   2e-13
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    76   2e-13
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    76   2e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    75   2e-13
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    75   2e-13
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    75   3e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   3e-13
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    75   3e-13
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    75   3e-13
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    75   3e-13
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    75   3e-13
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    75   3e-13
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    75   3e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    75   4e-13
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    75   4e-13
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    75   4e-13
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    74   4e-13
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    75   4e-13
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    75   4e-13
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    73   4e-13
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    75   4e-13
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    75   5e-13
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    75   5e-13
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    75   5e-13
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    74   5e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    75   5e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    75   5e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    74   5e-13
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    74   6e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    74   6e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    75   6e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    74   6e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    74   6e-13
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    73   6e-13
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    74   6e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    73   6e-13
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               74   7e-13
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    74   7e-13
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    74   7e-13
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    74   7e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    74   7e-13
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    74   8e-13
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    74   8e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    74   8e-13
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    74   8e-13
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    74   9e-13
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    74   9e-13
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    74   1e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    74   1e-12
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    74   1e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    72   1e-12
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    74   1e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    73   1e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    72   1e-12
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    74   1e-12
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    74   1e-12
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    72   1e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    74   1e-12
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    73   1e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    73   1e-12
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              74   1e-12
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    73   1e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    73   1e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    73   1e-12
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       73   1e-12
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    73   1e-12
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    73   1e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    73   1e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    73   1e-12
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    73   2e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    73   2e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    73   2e-12
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    72   2e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    72   2e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    73   2e-12
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    72   2e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    73   2e-12
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    72   2e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     72   2e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     72   2e-12
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    72   2e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    72   2e-12
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    72   3e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    72   3e-12
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    72   3e-12
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    72   3e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    72   3e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    72   3e-12
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    72   3e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    72   3e-12
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    72   3e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    72   3e-12
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    70   3e-12
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    72   3e-12
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              72   3e-12
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    71   3e-12
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    72   3e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   3e-12
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     72   4e-12
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    72   4e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    72   4e-12
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    72   4e-12
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    72   4e-12
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    72   4e-12
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    72   4e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    71   4e-12
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    71   5e-12
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    71   5e-12
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    70   5e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    72   5e-12
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    70   5e-12
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    71   5e-12
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    70   5e-12
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    71   5e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    71   5e-12
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    72   5e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    71   6e-12
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    71   6e-12
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    71   6e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    71   6e-12
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    70   6e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    70   6e-12
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    71   6e-12
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    71   7e-12
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    71   7e-12
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    71   7e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    71   7e-12
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    71   7e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    71   7e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    71   7e-12
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    71   7e-12
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    71   7e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    70   7e-12
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    71   7e-12
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    70   8e-12
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    71   8e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   8e-12
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    70   8e-12
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    70   8e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    71   9e-12
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    70   9e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    70   9e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    70   1e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    69   1e-11
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    69   1e-11
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    70   1e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    69   1e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   1e-11
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    69   1e-11
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    70   1e-11
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    70   1e-11
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    70   2e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    69   2e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    69   2e-11
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    70   2e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    69   2e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    69   2e-11
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    70   2e-11
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    70   2e-11
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    69   2e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    70   2e-11
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    70   2e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    69   2e-11
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    70   2e-11
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    70   2e-11
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    69   2e-11
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    69   2e-11
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    69   2e-11
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    69   2e-11
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    69   2e-11
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    69   2e-11
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    69   2e-11
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    69   3e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    69   3e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    69   3e-11
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    69   3e-11
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    69   3e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    69   3e-11
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    69   3e-11
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    68   3e-11
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    69   3e-11
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     68   3e-11
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    69   3e-11
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    69   3e-11
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    67   3e-11
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    69   3e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    68   3e-11
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    68   4e-11
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    68   4e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    68   4e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    67   4e-11
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    69   4e-11
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    68   4e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    67   4e-11
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    69   4e-11
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    68   4e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    69   4e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    68   4e-11
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    68   5e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    67   5e-11
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    68   5e-11
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    68   5e-11
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    68   5e-11
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    68   5e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    68   5e-11
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    68   5e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    68   6e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    68   6e-11
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    68   6e-11
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    68   6e-11
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    68   6e-11
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    68   6e-11
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    68   6e-11
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    68   6e-11
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    67   7e-11
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    67   7e-11
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    68   7e-11
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    68   7e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    68   7e-11
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    67   7e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    67   7e-11
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      68   7e-11
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    67   8e-11
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    67   8e-11
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   8e-11
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    67   8e-11
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              68   8e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    67   9e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    67   9e-11
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    67   9e-11
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    67   9e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    66   9e-11
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    67   9e-11
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    67   1e-10
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     66   1e-10
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    67   1e-10
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    67   1e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    67   1e-10
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    67   1e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     67   1e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    67   1e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    67   1e-10
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    67   1e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    67   1e-10
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    67   1e-10
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    67   1e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    67   1e-10
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    66   1e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       66   1e-10
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    67   1e-10
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    66   1e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    66   1e-10
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    67   1e-10
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    67   1e-10
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    66   1e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    67   1e-10
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    67   1e-10
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    67   1e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    67   1e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    65   1e-10
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    67   1e-10
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    67   1e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    67   1e-10
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    66   1e-10
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    67   1e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    66   1e-10
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    67   2e-10
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    67   2e-10
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    65   2e-10
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    65   2e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    66   2e-10
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    66   2e-10
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    65   2e-10
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    66   2e-10
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    66   2e-10
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    65   2e-10
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    66   2e-10
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    67   2e-10
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    66   2e-10
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    66   2e-10
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    65   2e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    65   2e-10
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    66   2e-10
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    66   2e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    66   2e-10
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    65   2e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    65   2e-10
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    66   2e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    65   2e-10
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    65   3e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    65   3e-10
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    66   3e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    65   3e-10
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    65   3e-10
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              65   3e-10
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    66   3e-10
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    65   3e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    65   3e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    65   3e-10
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    64   3e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    66   3e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    66   3e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    65   3e-10
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    65   3e-10
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    65   3e-10
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               65   3e-10
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    65   4e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    65   4e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    65   4e-10
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    65   4e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    65   4e-10
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    65   4e-10
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    65   4e-10
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    65   4e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    65   4e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    65   4e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    65   4e-10
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    65   4e-10
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    65   4e-10
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    65   4e-10
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    64   4e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    65   4e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    65   4e-10
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    65   4e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    65   4e-10
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    65   5e-10
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    65   5e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   5e-10
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    65   5e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    65   5e-10
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    64   5e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    64   5e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    65   5e-10
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    65   5e-10
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     64   5e-10
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    65   5e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    65   6e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    64   6e-10
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    65   6e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    65   6e-10
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    64   6e-10
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    65   6e-10
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    65   6e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    64   6e-10
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    64   6e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    64   6e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    64   6e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    65   6e-10
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    65   6e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    65   6e-10
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    65   6e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    65   6e-10
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    65   6e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    64   6e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    64   7e-10
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    64   7e-10
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    65   7e-10
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    64   7e-10
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    64   7e-10
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    65   7e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    65   7e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    64   7e-10
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              64   7e-10
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    65   7e-10
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    64   7e-10
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    64   7e-10
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    64   8e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    64   8e-10
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    64   8e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    64   8e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    63   8e-10
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    64   8e-10
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    64   8e-10
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    64   8e-10
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    64   8e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    64   8e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               64   8e-10
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    64   8e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    64   8e-10
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    64   8e-10
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    63   9e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    63   9e-10
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    64   9e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    64   9e-10
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    64   9e-10
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    64   9e-10
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    64   1e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    64   1e-09
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    64   1e-09
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    64   1e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    63   1e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    63   1e-09
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    64   1e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    64   1e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    64   1e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    63   1e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    63   1e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    64   1e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    64   1e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    64   1e-09
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    63   1e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    63   1e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    64   1e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    63   1e-09
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    63   1e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    63   1e-09
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    64   1e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    63   1e-09
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              64   1e-09
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    63   1e-09
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    63   1e-09
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    63   1e-09
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    63   1e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    62   1e-09
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    64   1e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    63   1e-09
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    64   2e-09
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    64   2e-09
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    63   2e-09
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    63   2e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               63   2e-09
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    64   2e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   2e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    62   2e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   2e-09
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    63   2e-09
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    62   2e-09
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    62   2e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    62   2e-09
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    62   2e-09
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    63   2e-09
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    63   2e-09
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    63   2e-09
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    62   2e-09
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    63   2e-09
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               62   2e-09
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    63   2e-09
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    62   2e-09
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    63   2e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    62   2e-09
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    63   2e-09
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    63   2e-09
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    62   2e-09
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    63   2e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    63   2e-09
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    63   2e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    63   2e-09
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    62   2e-09
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    62   2e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    62   2e-09
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    62   2e-09
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     62   2e-09
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    62   2e-09
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    62   3e-09
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    62   3e-09
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    62   3e-09
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    62   3e-09
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    62   3e-09
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    62   3e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    62   3e-09
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               63   3e-09
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    63   3e-09
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    62   3e-09
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     62   3e-09
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    62   3e-09
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    62   3e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    62   3e-09
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    62   3e-09
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    62   3e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    62   3e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    61   3e-09
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    62   3e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    62   3e-09
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    62   3e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    62   3e-09
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    62   3e-09
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              62   3e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    62   3e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    60   3e-09
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               62   3e-09
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    62   4e-09
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    61   4e-09
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    61   4e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    62   4e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    61   4e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    61   4e-09
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    62   4e-09
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    62   4e-09
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    62   4e-09
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    62   4e-09
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    62   4e-09
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    62   5e-09
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               61   5e-09
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    62   5e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    62   5e-09
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    62   5e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    61   5e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    61   5e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    62   5e-09
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    61   5e-09
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    61   5e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    61   5e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    62   5e-09
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    61   5e-09
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    60   5e-09
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    62   5e-09
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    60   5e-09
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    62   5e-09
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    62   5e-09
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    61   5e-09
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    61   5e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    61   5e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    61   5e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    61   5e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    62   5e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    61   6e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    62   6e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    60   6e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    61   6e-09
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    61   6e-09
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    61   6e-09
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    61   6e-09
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    61   6e-09
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    61   6e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    61   7e-09
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    61   7e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    61   7e-09
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    61   7e-09
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    61   7e-09
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    61   7e-09
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    60   7e-09
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    61   7e-09
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    60   7e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    60   7e-09
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    61   7e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    60   7e-09
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    61   7e-09
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    60   8e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    61   8e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    60   8e-09
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    61   8e-09
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    61   8e-09
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    61   8e-09
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    60   8e-09
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    61   9e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    60   9e-09
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    60   9e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    60   9e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     60   9e-09
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    60   9e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              61   1e-08
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    60   1e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    59   1e-08
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    61   1e-08
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    60   1e-08
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    60   1e-08
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   1e-08
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    60   1e-08
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    60   1e-08
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    60   1e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    59   1e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    59   1e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    60   1e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    60   1e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    60   1e-08
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    60   1e-08
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    60   1e-08
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    60   1e-08
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    60   1e-08
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    60   1e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    59   1e-08
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    60   1e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    60   1e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    60   1e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    60   1e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    60   2e-08
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    60   2e-08
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    60   2e-08
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    60   2e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    59   2e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    60   2e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    60   2e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    60   2e-08
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    59   2e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    59   2e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    59   2e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    59   2e-08
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    59   2e-08
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    60   2e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              58   2e-08
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    60   2e-08
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    59   2e-08
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    59   2e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    59   2e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    59   2e-08
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    59   2e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    59   2e-08
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    59   2e-08
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    59   2e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    59   2e-08
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    59   2e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    59   2e-08
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               59   2e-08
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    59   2e-08
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    59   2e-08
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    59   3e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    59   3e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    59   3e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    59   3e-08
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    59   3e-08
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    59   3e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    59   3e-08
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    59   3e-08
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    59   3e-08
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    59   3e-08
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    59   3e-08
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    59   3e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    59   3e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    58   3e-08
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    59   3e-08
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    58   3e-08
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    59   3e-08
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    59   3e-08
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    59   3e-08
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    59   3e-08
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    59   3e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    59   3e-08
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    59   3e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    59   3e-08
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    59   3e-08
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    59   3e-08
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    59   3e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    59   3e-08
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    59   4e-08
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    59   4e-08
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    59   4e-08
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    59   4e-08
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    59   4e-08
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    59   4e-08
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    59   4e-08
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    58   4e-08
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    59   4e-08
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    59   4e-08
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    59   4e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    58   4e-08
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    59   4e-08
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    59   4e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    58   4e-08
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    59   4e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    59   4e-08
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    59   4e-08
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    58   4e-08
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    59   4e-08
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    59   4e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    59   4e-08
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    58   4e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    58   4e-08
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              59   4e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    59   5e-08
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    59   5e-08
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    58   5e-08
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    58   5e-08
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    59   5e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    58   5e-08
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    58   5e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    58   5e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    57   5e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    58   5e-08
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    58   5e-08
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    58   5e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    58   5e-08
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    57   5e-08
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    58   5e-08
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    58   5e-08
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    58   5e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    58   5e-08
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     57   5e-08
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    58   5e-08
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    58   5e-08
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    57   6e-08
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    58   6e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    57   6e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    58   6e-08
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    58   6e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    58   6e-08
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    57   6e-08
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    58   6e-08
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    57   6e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    57   6e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    57   6e-08
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    57   6e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    58   6e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    58   6e-08
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    58   7e-08
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    57   7e-08
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    58   7e-08
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    57   7e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    57   8e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    57   8e-08
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    58   9e-08
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   9e-08
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    57   9e-08
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    57   9e-08
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    57   9e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    58   9e-08
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    57   9e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    57   9e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    57   9e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    57   1e-07
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    57   1e-07
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    57   1e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    56   1e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    57   1e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    56   1e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    57   1e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    57   1e-07
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    57   1e-07
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    57   1e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    57   1e-07
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    57   1e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    57   1e-07
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    57   1e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    56   1e-07
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    57   1e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    57   1e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    55   1e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    56   1e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    57   1e-07
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    57   1e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    57   1e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    55   1e-07
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    57   1e-07
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    57   1e-07
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    57   1e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    57   1e-07
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    57   1e-07
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    57   1e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    57   1e-07
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    56   1e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    57   2e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    57   2e-07
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    57   2e-07
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    56   2e-07
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    57   2e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   2e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    56   2e-07
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    56   2e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     57   2e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    57   2e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    57   2e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    55   2e-07
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      57   2e-07
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    57   2e-07
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    56   2e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    56   2e-07
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    57   2e-07
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    56   2e-07
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    56   2e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    56   2e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    56   2e-07
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    55   2e-07
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    57   2e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    56   2e-07
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    56   2e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    55   2e-07
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    56   2e-07
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    56   2e-07
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    57   2e-07
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    56   2e-07
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    56   2e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    56   2e-07
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    56   3e-07
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    56   3e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     55   3e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    55   3e-07
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    56   3e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    56   3e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    56   3e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    56   3e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    55   3e-07
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    56   3e-07
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    56   3e-07
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    56   3e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    55   3e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    55   3e-07
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    56   3e-07
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    55   3e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    56   3e-07
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    55   3e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    55   3e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    55   3e-07
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    55   3e-07
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    55   3e-07
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    55   3e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    55   3e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    56   3e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    55   4e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    55   4e-07
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    55   4e-07
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    55   4e-07
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    55   4e-07
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    55   4e-07
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    56   4e-07
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    55   4e-07
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    55   4e-07
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               55   4e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    55   4e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    55   4e-07
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    55   4e-07
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    55   4e-07
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    56   4e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    55   4e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   4e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    55   4e-07
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    55   4e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    55   4e-07
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    55   4e-07
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    55   4e-07
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    55   4e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    55   4e-07
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              55   5e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    55   5e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    55   5e-07
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    55   5e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    54   5e-07
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    55   5e-07
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    54   5e-07
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    55   5e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    55   5e-07
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    55   5e-07
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    55   5e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    55   5e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    54   5e-07
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    55   5e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   5e-07
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    55   5e-07
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    55   5e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    55   5e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    54   5e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    54   5e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    55   5e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    55   5e-07
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    55   6e-07
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    55   6e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    54   6e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    54   6e-07
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    55   6e-07
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    51   6e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    54   6e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   6e-07
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    55   6e-07
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    54   6e-07
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    55   6e-07
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     54   6e-07
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    55   6e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    54   6e-07
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    55   6e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    54   6e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    55   7e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    54   7e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    55   7e-07
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    55   7e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    55   7e-07
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    55   7e-07
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    54   7e-07
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    54   7e-07
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    55   7e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    55   7e-07
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    55   7e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    55   8e-07
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    54   8e-07
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    55   8e-07
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    54   8e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    54   8e-07
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    54   8e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    54   8e-07
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    54   8e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    55   8e-07
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    54   8e-07
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    54   8e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    54   8e-07
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    54   8e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    54   8e-07
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    54   9e-07
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    54   9e-07
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    54   9e-07
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    53   9e-07
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    54   9e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    54   9e-07
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    54   9e-07
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    54   9e-07
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    54   9e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    54   1e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    54   1e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    53   1e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    53   1e-06
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    54   1e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    54   1e-06
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    54   1e-06
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    54   1e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     54   1e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    53   1e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    54   1e-06
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    54   1e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    54   1e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    54   1e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    53   1e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     54   1e-06
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    54   1e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    53   1e-06
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    54   1e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    54   1e-06
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    53   1e-06
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    54   1e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    54   1e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    54   1e-06
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    54   1e-06
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    54   1e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    54   1e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    54   1e-06
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    54   1e-06
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    54   1e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    54   1e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    53   2e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   2e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    53   2e-06
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    52   2e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    52   2e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   2e-06
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    54   2e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       54   2e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    53   2e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    53   2e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    53   2e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    53   2e-06
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    53   2e-06
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    53   2e-06
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    54   2e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    52   2e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    53   2e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    53   2e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    53   2e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   2e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    53   2e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    52   2e-06
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    53   2e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    53   2e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               53   2e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    53   2e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    53   2e-06
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    53   2e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    53   2e-06
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    53   2e-06
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    52   2e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    53   2e-06
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    53   2e-06
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               53   2e-06
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    53   2e-06
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    53   2e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    53   3e-06
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    52   3e-06
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    53   3e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    53   3e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    52   3e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    53   3e-06
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    52   3e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    52   3e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    53   3e-06
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    52   3e-06
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    52   3e-06
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    53   3e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    52   3e-06
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    52   3e-06
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    52   3e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     52   3e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   3e-06
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    52   3e-06
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    52   3e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    52   4e-06
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    52   4e-06
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    52   4e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    52   4e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    52   4e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    52   4e-06
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    52   4e-06
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    52   4e-06
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    52   4e-06
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    52   4e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    52   4e-06
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     52   4e-06
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    52   4e-06
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    52   4e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    52   4e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    52   4e-06
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    52   4e-06
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    51   4e-06
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     52   5e-06
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    52   5e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    52   5e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    52   5e-06
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    52   5e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    52   5e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             52   5e-06
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    52   5e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    52   5e-06
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    52   5e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    52   5e-06
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    52   5e-06
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    51   5e-06
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    52   5e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    52   5e-06
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    52   5e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   5e-06
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    52   5e-06
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    52   6e-06
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    52   6e-06
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    51   6e-06
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    52   6e-06
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    52   6e-06
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    52   6e-06
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    52   6e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    52   6e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     51   6e-06
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    52   7e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    52   7e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    51   7e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    52   7e-06
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    51   7e-06
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    50   7e-06
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    51   7e-06
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    52   7e-06
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    51   7e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    51   7e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    51   7e-06
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    51   8e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    51   8e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    51   8e-06
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    51   8e-06
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    51   8e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    50   8e-06
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    51   8e-06
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    50   8e-06
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    50   8e-06
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      51   8e-06
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    51   8e-06
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    51   8e-06
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    51   8e-06
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    51   8e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    50   9e-06
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    51   9e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    51   9e-06
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    51   9e-06
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      51   9e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    50   9e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    50   1e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    49   1e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    50   1e-05
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    51   1e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    51   1e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    50   1e-05
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    50   1e-05
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    50   1e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    50   1e-05
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    50   1e-05
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    50   1e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    50   1e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    50   1e-05
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    50   1e-05
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    50   1e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    50   1e-05
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    50   1e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    50   1e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    50   1e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    50   1e-05
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    50   1e-05
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    50   1e-05
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    50   1e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    50   1e-05
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    50   1e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    50   2e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    50   2e-05
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    50   2e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    50   2e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    50   2e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    50   2e-05
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    50   2e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    50   2e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   2e-05
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    49   2e-05
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    50   2e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    49   2e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    50   2e-05
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    50   2e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    49   2e-05
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    49   2e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    49   3e-05
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    49   3e-05
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    49   3e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    50   3e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   3e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    49   3e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    49   3e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    50   3e-05
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    49   3e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    49   3e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    49   3e-05
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    49   3e-05
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    49   3e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    49   3e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    49   3e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    49   3e-05
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    49   3e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    49   3e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   3e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    49   3e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    49   3e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    49   4e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    49   4e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    49   4e-05
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    49   4e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    49   4e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    49   4e-05
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    49   4e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    49   4e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    49   4e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     49   4e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    49   4e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    49   4e-05
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    49   4e-05
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    49   4e-05
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    49   4e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    49   4e-05
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    49   4e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    48   4e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    48   4e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    49   4e-05
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    49   4e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    48   4e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    49   4e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               49   4e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    49   4e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    49   4e-05
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    49   5e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    49   5e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    49   5e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    49   5e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    49   5e-05
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    48   5e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    49   5e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    48   5e-05
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    48   5e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    48   5e-05
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    49   5e-05
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    48   6e-05
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    49   6e-05
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    48   6e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    48   6e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    48   6e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    49   6e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    48   6e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    48   6e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    48   6e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    48   6e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    48   7e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    48   7e-05
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    47   7e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    47   7e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    48   7e-05
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    48   7e-05
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    47   7e-05
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    47   7e-05
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    48   7e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    48   7e-05
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    48   8e-05
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    48   8e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               48   8e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    48   8e-05
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    47   8e-05
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    48   8e-05
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    48   8e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    48   9e-05
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    48   9e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    48   9e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    48   9e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    48   9e-05
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    48   9e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    47   1e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    48   1e-04
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    47   1e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    47   1e-04
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    46   1e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    47   1e-04
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    47   1e-04
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    47   1e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    47   1e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    47   1e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    47   1e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    47   1e-04
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    47   1e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    47   1e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    47   1e-04
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    47   1e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   1e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    47   1e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    47   1e-04
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   1e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    47   1e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    47   1e-04
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    47   1e-04
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    47   1e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    47   1e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    47   1e-04
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    47   1e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     47   1e-04
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    47   2e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    47   2e-04
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    47   2e-04
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    46   2e-04
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    47   2e-04
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    47   2e-04
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    47   2e-04
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    47   2e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    47   2e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    47   2e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    46   2e-04
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    47   2e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    46   2e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    47   2e-04
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    47   2e-04
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    47   2e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    47   2e-04
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    47   2e-04
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    45   2e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    46   2e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    46   2e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    46   2e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    46   2e-04
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    47   2e-04
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    46   2e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    46   2e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    46   2e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    47   2e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    46   2e-04
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    46   2e-04
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    46   3e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    46   3e-04
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    45   3e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    46   3e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    45   3e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    46   3e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    45   3e-04
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    46   3e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    46   3e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    45   3e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    46   3e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    46   3e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    46   3e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    46   3e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    46   3e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    45   3e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    46   3e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    46   3e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    46   3e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    46   4e-04
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    45   4e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    46   4e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   4e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    46   4e-04
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    46   4e-04
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    45   4e-04
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    46   4e-04
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    45   5e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    45   5e-04
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    45   5e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    45   5e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    45   5e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    45   5e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    45   6e-04
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    45   6e-04
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    45   6e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    45   6e-04
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    45   6e-04
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    45   6e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    45   6e-04
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    45   6e-04
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    45   6e-04
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    45   6e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    45   7e-04
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    45   7e-04
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    45   7e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    45   7e-04
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    45   7e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    44   8e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    45   8e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    45   8e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   8e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    45   8e-04
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    45   8e-04
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    45   8e-04
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    45   8e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    44   8e-04
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    45   8e-04
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    45   8e-04
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    45   9e-04
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    45   9e-04
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    44   0.001
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    44   0.001
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    44   0.001
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    44   0.001
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    44   0.001
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    44   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    44   0.001
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    44   0.001
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   0.001
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    44   0.001
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    44   0.001
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    44   0.001
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    44   0.001
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    44   0.001
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    44   0.001
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    44   0.001
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    44   0.002
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    44   0.002
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    44   0.002
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    44   0.002
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    43   0.002
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    44   0.002
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    44   0.002
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    44   0.002
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    44   0.002
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    43   0.002
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    44   0.002
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    43   0.002
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    43   0.002
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    43   0.002
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    43   0.002
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    44   0.002
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    44   0.002
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    43   0.002
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    43   0.002
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    43   0.002
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       43   0.002
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    44   0.002
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    43   0.002
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    43   0.002
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    43   0.002
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    43   0.002
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    43   0.002
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    43   0.002
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    43   0.002
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    43   0.002
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    43   0.002
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     43   0.003
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    43   0.003
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    43   0.003
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    43   0.003
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    43   0.003
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    43   0.003
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    43   0.003
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    43   0.003
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    43   0.003
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    43   0.003
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             42   0.003
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    42   0.004
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    42   0.004
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    42   0.004
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    42   0.004
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    43   0.004
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    42   0.004
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    42   0.004
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    42   0.004
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    42   0.004
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.004
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    42   0.004
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    42   0.004
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    42   0.005
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    42   0.005
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    42   0.005
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    42   0.005
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.005
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    42   0.005
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    42   0.005
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    42   0.005
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.006
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    42   0.006
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    42   0.006
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    42   0.006
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    42   0.006
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    42   0.006
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    42   0.006
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    42   0.006
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    42   0.006
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    42   0.006
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    42   0.006
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               42   0.007
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    41   0.007
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    41   0.007
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     41   0.007
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    42   0.007
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    41   0.007
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    41   0.007
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    42   0.007
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    42   0.007
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    42   0.007
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    41   0.008
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    41   0.008
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    42   0.008
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    42   0.008
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    41   0.008
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    41   0.008
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    41   0.008
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    41   0.009
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    41   0.009
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 41   0.009
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    41   0.009
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    41   0.009
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    41   0.010
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    41   0.010
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    41   0.010
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    41   0.010
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    41   0.010
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    41   0.010
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    41   0.010
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    41   0.011
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    41   0.011
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    40   0.011
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    40   0.011
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    40   0.012
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    41   0.012
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    41   0.012
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    41   0.012
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    41   0.012
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    41   0.012
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.012
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    41   0.013
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    40   0.013
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    40   0.013
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    40   0.014
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    40   0.014
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.014
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    40   0.014
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    40   0.015
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    40   0.015
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    41   0.015
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    40   0.015
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    41   0.016
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    40   0.016
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    40   0.016
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.018
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    40   0.018
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    40   0.018
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    40   0.018
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    40   0.020
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    40   0.020
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    40   0.020
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.020
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    40   0.020
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    40   0.021
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    40   0.021
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    40   0.021
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    40   0.022
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    40   0.022
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    40   0.024
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    40   0.025
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    40   0.026
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    40   0.026
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    40   0.026
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    40   0.026
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    39   0.028
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.031
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    39   0.031
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    39   0.031
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    40   0.031
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    39   0.034
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    39   0.034
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    39   0.035
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      39   0.036
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    39   0.036
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    39   0.036
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    39   0.036
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    39   0.039
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    39   0.039
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    39   0.041
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    39   0.041
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    39   0.042
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    39   0.046
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    39   0.047
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    39   0.048
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    39   0.055
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    39   0.056
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    38   0.061
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    39   0.062
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               38   0.063
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    39   0.068
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    38   0.068
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    38   0.068
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    38   0.071
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    38   0.071
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    38   0.074
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    38   0.075
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               38   0.078
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    38   0.078
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    38   0.079
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    38   0.082
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    38   0.085
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    38   0.087
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    38   0.088
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    38   0.088
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    38   0.095
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    38   0.098
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    38   0.098
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    37   0.11 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    37   0.12 
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    37   0.13 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    37   0.13 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    37   0.13 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      37   0.14 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.14 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    37   0.15 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    37   0.15 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.16 
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    37   0.17 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    37   0.17 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    37   0.17 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    37   0.20 
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    37   0.21 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    37   0.22 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    37   0.23 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    37   0.25 
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    36   0.25 
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    36   0.26 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    36   0.27 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    37   0.28 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.28 
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    36   0.29 
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    37   0.29 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    36   0.30 
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    36   0.31 
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    36   0.33 
Kwal_23.3867 s23 (466415..467458) [1044 bp, 347 aa] {ON} YBR129C...    36   0.35 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    36   0.36 
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    36   0.37 
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    36   0.38 
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    36   0.38 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    36   0.41 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    36   0.41 
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    35   0.43 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    36   0.44 
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    36   0.44 
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    36   0.49 
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    35   0.52 
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    35   0.52 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    35   0.53 
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    35   0.53 
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    35   0.55 
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    35   0.55 
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    35   0.56 
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    34   0.56 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    35   0.57 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    35   0.57 
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    35   0.58 
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    35   0.61 
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    35   0.62 
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    35   0.66 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    35   0.66 
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    35   0.66 
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    35   0.71 
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    35   0.73 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    35   0.84 
KLTH0E07546g Chr5 (692912..694801) [1890 bp, 629 aa] {ON} some s...    35   0.85 
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    35   0.86 
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    34   0.93 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    35   0.96 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    35   1.00 
KNAG0A01660 Chr1 complement(92179..95433) [3255 bp, 1084 aa] {ON...    35   1.0  
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    35   1.0  
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    34   1.0  
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    35   1.1  
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    34   1.1  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    35   1.1  
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    34   1.2  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    35   1.2  
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    34   1.2  
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    34   1.4  
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    34   1.5  
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    34   1.5  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     34   1.5  
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    34   1.5  
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    34   1.5  
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    34   1.5  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    34   1.6  
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    33   1.8  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    33   1.8  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    33   1.9  
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    33   2.2  
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     33   2.2  
Kpol_388.4 s388 complement(7814..17200) [9387 bp, 3128 aa] {ON} ...    34   2.2  
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    33   2.3  
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    33   2.4  
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    33   2.4  
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    33   2.7  
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    33   2.7  
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    33   2.9  
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     33   3.0  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    33   3.1  
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    33   3.4  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    33   3.8  
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    33   3.9  
KLLA0D15224g Chr4 (1294983..1296014) [1032 bp, 343 aa] {ON} simi...    32   3.9  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    32   4.1  
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    33   4.3  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    32   4.9  
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    32   5.3  
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    32   5.3  

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score = 1271 bits (3290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/723 (87%), Positives = 634/723 (87%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSSTT 360
           GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSSTT
Sbjct: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSSTT 360

Query: 361 TGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQXXXXXXX 420
           TGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQ       
Sbjct: 361 TGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQKSTSSNS 420

Query: 421 XXXXXXXHYVDSETQTFXXXXXXXXXXXXXXXXXXXXXDQLKEHRTGGSITQFFTSTLKR 480
                  HYVDSETQTF                     DQLKEHRTGGSITQFFTSTLKR
Sbjct: 421 NTSGNKSHYVDSETQTFSTSSRRLSRSSSVRSASSRSSDQLKEHRTGGSITQFFTSTLKR 480

Query: 481 VVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXXXXXXXX 540
           VVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNT                       
Sbjct: 481 VVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTNSRVSSLASSVRNVSSSSKHSKH 540

Query: 541 XXXXDEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPKLYSSNSPVKLKSLSTQRESIQN 600
               DEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPKLYSSNSPVKLKSLSTQRESIQN
Sbjct: 541 SDADDEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPKLYSSNSPVKLKSLSTQRESIQN 600

Query: 601 RVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIPTPTNKRYSSVIINPVTE 660
           RVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIPTPTNKRYSSVIINPVTE
Sbjct: 601 RVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIPTPTNKRYSSVIINPVTE 660

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXXXXXKIYPDERISSTATERIVNLDVESLEKDFKRRFP 720
                                      KIYPDERISSTATERIVNLDVESLEKDFKRRFP
Sbjct: 661 PISIRPSPPPKPKHLRPIPPPKPTRLSKIYPDERISSTATERIVNLDVESLEKDFKRRFP 720

Query: 721 SRI 723
           SRI
Sbjct: 721 SRI 723

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/760 (49%), Positives = 465/760 (61%), Gaps = 44/760 (5%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQPNIP YP GTLLTVG+H   I KYLTSGGFAQIY  EI+P++ Y+ S  ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           P K+GLNTLRAEVDAMKLLKNNRHVVSYIDS+A +S    G+YEV LLMEYC+GGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MN+RLQNRL+E EILNILSQT QGV+ MHALQP L+HRDIKIENVL S  GEFK+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC YIRPPRN QEL+YVQHD+LKNTTAQYR PEMLDLYRGLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GE AILHS++QYPAFPIY+D+LKNLIR  L E+P+KRPNIC+LLEEIS IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GIPCPINNFYLSRTINV--QASLMNPIITPTQQTALKHSQSSA---------TISDQSYA 349
           G+PCPI NFYL R   +  Q  L      P   TA    Q +A         T ++ S  
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPIINTKANTSLV 360

Query: 350 VPLASSRSSTTTGNKPILIETEIPDMSQGSD-DVYSRIHPFQKSQTLRTPSRSSS--PIK 406
            P+     S  T    + ++ ++P  S   D D+Y ++HPFQKS TL TPS+++S  PI+
Sbjct: 361 TPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASVSPIR 420

Query: 407 -YTGTLLQXXXXXXXXXXXXXXHYVDSETQTFXXXXXXXXXXXXXXXXXXXXXDQLKEHR 465
            Y                     Y   + Q+                        L+ + 
Sbjct: 421 RYISRSPSRDNTNYDIQRRRTSQYDHDQNQSNYMGRSLSRTSSIKSTSALSFEGNLQGNN 480

Query: 466 TGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTXXXXXXXX 525
           TG S  Q FT+ +KRVVTGESRN SPIRSRQ+TGGS+RSAF A+R   TG+         
Sbjct: 481 TGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGSMRAPSLDNN 540

Query: 526 XXXXXXXXXXXXXXXXXX-----------XDEPNKIKIRMKKAHRRSVPPNLYSDF---- 570
                                         +E ++   + K A R ++PP +  D     
Sbjct: 541 TNNSMHNNSNNNTSRNSSYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLE 600

Query: 571 YANE--DTPKLYSSNSPVKLKSLSTQRESIQNRVKALLETFEE--EPSTIKTASGYGKYT 626
             NE     + Y S+SP K     T R++IQ RV+ LL   E+  E + I T      +T
Sbjct: 601 IENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERNNIDT-----HHT 655

Query: 627 DSEFITSPVPERGGRIPTPTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXXXXXX---XX 683
           ++  ++  +  R        + RYSSV+INP+ +                          
Sbjct: 656 NA--VSHSMIPRNLNSREKDSLRYSSVVINPLEDIGSSPKKAPPLPFKPHHLRPKPPPKP 713

Query: 684 XXXXKIYPDERISSTATERIVNLDVESLEKDFKRRFPSRI 723
               K++  ERISSTATE++V LDV++LE+DF++RFPS +
Sbjct: 714 TYLSKMFSKERISSTATEQLVTLDVDTLERDFRKRFPSTL 753

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/823 (47%), Positives = 477/823 (57%), Gaps = 118/823 (14%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P I  Y PGT+LTVGSH+ KIIKYLTSGGFAQ+Y+ EISP +PY+++  ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK GLNTLRAEVDAMKLLKNN+HVVSYIDSHAA+S V   AYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRL+NRL E EIL+I+ QTVQG++AMHALQP LIHRDIKIENVLIS +G +K+CDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPP+NPQE  YVQHD+L NTTAQYR+PEM+DLYRGLPI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEAAILH+RYQYP+FP Y+D+LKNLIR  LME PS+RPNICQ+LEE+SR+Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPINNFYLSRTINVQASL----MNPIITPTQQTALKHSQSSATISDQSYAVPLAS-- 354
             PCPI NFYL R +N  A       +   TP QQ  L   QS   I      VPL++  
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQ--LVSPQSFQNIQAMPNIVPLSNIK 357

Query: 355 ------SRSSTTTGNKPI--LIETEIPDMSQG---------------SDDV----YSRIH 387
                 S S+    N  +  +++     +  G               SDD     Y  +H
Sbjct: 358 TTPNLDSASNFVNNNNKMEAMLQLRTQKLETGPNFSIPLTKTKSVPLSDDFTSLYYKELH 417

Query: 388 PFQKSQTLRTPSRSSSP----IKYTGTLLQXXXXXXXXXXXXXXHYVDSETQTFXXXXXX 443
           PFQK  T ++   S SP    I ++ T +               +YVDSETQT       
Sbjct: 418 PFQKPHTFKSVEGSQSPQRKSIPFSPTPVNSNNYDRVSTINRPNNYVDSETQTLDSIATL 477

Query: 444 XXX---XXXXXXXXXXXXDQLKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGG 500
                               + E+ TGG I +  +S LKRV+TGESRN SPI+SRQNTG 
Sbjct: 478 KLKPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGD 537

Query: 501 SIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXXXXXXX--------XXXXXDEPNKIKI 552
           SIRSAF  LR G TG++                                   D   K ++
Sbjct: 538 SIRSAFGMLRHGFTGSSINNSRSTSFDNNNANSVNRRLTSSSSNPSSSNLNSDTKRKEEL 597

Query: 553 RMKKA--HRRSVPPNLYSDFYANE------DTPKLYSSNSPVK-------------LKSL 591
             K+   HRRS+PP++ SDF  +E       +   Y S+SPVK             LKS 
Sbjct: 598 DKKRKLEHRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQTTPTTTTRPSLKSS 657

Query: 592 ST-------QRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIPT 644
           ++       ++ESIQ RV  LL   E+  S  K+ASGYGKYTD+E               
Sbjct: 658 NSDINIDQEKKESIQRRVHNLLNNSEDSLS-YKSASGYGKYTDTE--------------A 702

Query: 645 PTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXXXXXXXXXXX-----------XKIY--- 690
            +  R SSV I P+TE                                      KI+   
Sbjct: 703 ESTNRQSSVRITPITEERFNNYHSSNTMNDHTSSKDKPKSRPPRPPPKPLHLRTKIHNTR 762

Query: 691 ----------PDERISSTATERIVNLDVESLEKDFKRRFPSRI 723
                     P ERISS ATE IV+++V+ LE DF++RFPS++
Sbjct: 763 CSSNLQSRKPPMERISSEATETIVDVNVDELEADFRKRFPSKV 805

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/832 (46%), Positives = 474/832 (56%), Gaps = 131/832 (15%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P I  Y PGT+LTVGSH+ KIIKYLTSGGFAQ+YT EISP +PY+N+  ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           P K GLNTLRAEVDAMKLL+NN+HVVSYIDSHAARS V   AYEVF+LME+C+ GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL I+SQTVQG++AMHALQP LIHRDIKIENVLIS  G +K+CDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPPRN QE  YVQHD+L NTTAQYR+PEM+DLYRGLPI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEA ILH+RYQYP+FP Y+D+LKNLIR  LME PS+RPNICQ+LEE+SR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPINNFYLSRTINVQASLM------NPIITPTQQTALKHSQSSATISDQSYAVPLAS 354
             PCPI NFYL R +N  A+        +    PTQ+      QS  +I+     +P+  
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQK--FIPVQSLQSINQPPNMMPVTH 357

Query: 355 SRSSTTTGNKPILI----ETEI----------------PDMSQG----SDDV----YSRI 386
             ++   G  PI I    +TE+                P M       SD+     Y  +
Sbjct: 358 VSTTPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPLSDEFASLYYKEL 417

Query: 387 HPFQKSQTLR------TPSRSSSPIKYTGTLLQXXXXXXXXXXXXXXHYVDSETQTFXXX 440
           HPFQKSQT +      +P R S P   + T +               +YVDSETQT    
Sbjct: 418 HPFQKSQTFKSVESFQSPQRKSMP-PLSLTPVNNDIFDRVSAINRPNNYVDSETQTIDNM 476

Query: 441 XXXXXXXXXXXXXXXXXXDQ---LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQN 497
                              +     ++  G  I +  +S LK+V+TGESR  SPI+SRQN
Sbjct: 477 AVPNLKLSPTITSKSLSSTKEIAAPDNINGSKIVRSLSSKLKKVITGESRGNSPIKSRQN 536

Query: 498 TGGSIRSAFDALRSGITGNTXXXXXXXX----------------XXXXXXXXXXXXXXXX 541
           TG SIRSAF  LR G TGN+                                        
Sbjct: 537 TGDSIRSAFGKLRHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSSSTSSFPKFNSDT 596

Query: 542 XXXDEPNKIKIRMKKAHRRSVPPNLYSDFYANE------DTPKLYSSNSPVKLKSLST-- 593
              +E +K + R++K  RRS+PP++ SDF  +E       +   Y S+SPVK    S   
Sbjct: 597 KRKEESDKNQ-RLEK--RRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQASAKT 653

Query: 594 ------------------QRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPV 635
                             ++ESIQ RV  LL++  ++P T K+ASGYGKYTD        
Sbjct: 654 TSKPTLIPDNGNVNINQEKKESIQRRVHNLLKS-SDDPVTYKSASGYGKYTD-------- 704

Query: 636 PERGGRIPTPTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXXXXXXXXXX---------- 685
                 I T T+ R+SSV I P+TE                                   
Sbjct: 705 ------IGTETSNRHSSVRITPITEEKFKKTLKDGVLDIKTKSNGKDKSRPPRPPPKPLH 758

Query: 686 --------------XXKIYPDERISSTATERIVNLDVESLEKDFKRRFPSRI 723
                           K  P ERISS ATE IV+++V+ LE DF++RFPS++
Sbjct: 759 LRTEIQKIRNFSRLQSKKLPIERISSEATETIVDVNVDDLEADFRKRFPSKV 810

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/826 (45%), Positives = 473/826 (57%), Gaps = 121/826 (14%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P I  Y PGT+LTVGSH+ KIIKYLTSGGFAQ+YT EISP +PY N+  ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK GLNTLRAEVDAMKLLKNN+HVVSYIDSHAA+S V   AYEVF+LME+C+ GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL I+SQTVQG++AMHALQP LIHRDIKIENVLIS  G +K+CDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPPRN QE  YVQHD+L NTTAQYR+PEM+DLYRGLPI+EKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEA ILH+RYQYP FP Y+D+LKNLIR  LME PSKRPNICQ+LEE+SR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GIPCPINNFYLSRTINVQASLMN--PII--TPTQQTALKHSQSSATISDQSYAVPLASSR 356
             PCPI NFYL R ++  A L +  P +   PTQ+     +Q   ++   S  +P++  R
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQK--FLPAQGLQSMKPISNMIPVSHVR 357

Query: 357 SSTTTGNKPILIE-TEIPDMSQG-----------------------SDDV----YSRIHP 388
           ++      P  I+   + D+++                        SDD     Y  +HP
Sbjct: 358 TTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHP 417

Query: 389 FQKSQTLRTPSRSSSPIKYT---GTL--LQXXXXXXXXXXXXXXHYVDSETQTFXXXXXX 443
           FQKSQT ++     SP + +    +L                  +YVDSETQT       
Sbjct: 418 FQKSQTFKSVENFQSPQRRSMPPSSLPPANSIILDKTPTMNRPNNYVDSETQTTDIITMS 477

Query: 444 XXXXXXXXXXXXXXXDQ---LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGG 500
                           +     E+ +GG+I +  +S LK+V+TGESR +SPI+SRQNTG 
Sbjct: 478 GSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGD 537

Query: 501 SIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXXXXXXXXXX-------------XXDEP 547
           S RSA   LR G TG++                                           
Sbjct: 538 STRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRRLGSSSTSSLSVFNPDTKRQ 597

Query: 548 NKIKIRMKKAHRRSVPPNLYSDFYANE------DTPKLYSSNSPVKLKSLST-------- 593
            +I  + K  +RRS+P ++ SDF  +E       +   Y S+SPVK    ++        
Sbjct: 598 EEIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPIT 657

Query: 594 ------------QRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGR 641
                       ++ESIQ RV  LL++  E+P T K+ASGYGKYTD++            
Sbjct: 658 KPVIGDININQEKKESIQRRVHNLLKS-SEDPLTYKSASGYGKYTDTD------------ 704

Query: 642 IPTPTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXX--------------------XXXX 681
             T T+ R+SSV I P+TE                                         
Sbjct: 705 --TETSNRHSSVRITPITEEKFKSRNKNGLSNNKTKDNDRHKSRPPRPPPKPLHLRAEIQ 762

Query: 682 XXXXXXKIYPDE----RISSTATERIVNLDVESLEKDFKRRFPSRI 723
                 +++  E    RISS ATE IV ++V+ LE DF++RFPS++
Sbjct: 763 KVRSSSRLHSGELSSERISSDATETIVEVNVDDLEADFRKRFPSKV 808

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/832 (46%), Positives = 471/832 (56%), Gaps = 132/832 (15%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P I  Y PGT+LTVGSH+ KIIKYLTSGGFAQ+YT EISP +PY+N+ TACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK GLNTLRAEVDAMKLLKNN+HVVSYIDSHAA+S V   AYEVF+LME+C+ GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQ+RL E EIL I+SQTVQG++AMH LQP LIHRDIKIENVLIS  G +K+CDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPPRN QE  YVQHD+L NTTAQYR+PEM+DLYR  PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEAAILHSRYQYP+FP Y+D+LK LI   LME PS+RPNICQ+LEE+SR+Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPINNFYLSRTINVQASLMN--PIIT--------PTQQ-TALKHSQSSATISDQSYA 349
             PCPI NFYL R +   A L +  P +T        P Q    +KH QS   ++     
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTT 359

Query: 350 VPLASSRSSTTTGNK-----PILIETEIPDMSQG-----------SDDV----YSRIHPF 389
             L +   + T  N+     P+  + E  D++ G           SDD     Y  +HPF
Sbjct: 360 PNLGTLTKAITNNNQTESILPVRTQPE-SDLNLGNPLMKTKSVPLSDDFASLYYRELHPF 418

Query: 390 QKSQT-------------LRTPSRSSSPIKYTGTLLQXXXXXXXXXXXXXXHYVDSETQT 436
           QKSQT             L TPS SSSP+       +              +YVDS TQT
Sbjct: 419 QKSQTFKSVESFQSPQRKLSTPS-SSSPVNS-----KNNDRASTSTVDRPNNYVDSVTQT 472

Query: 437 FXXXXXXXXXXXXXXXXXXXXXDQ---LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIR 493
                                  +   + E+ TGGSI +  +S LK+V+TGESR++SPI+
Sbjct: 473 IDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIK 532

Query: 494 SRQNTGGSIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXXXXXXXXXXX---------- 543
           SRQNTG SIRSAF  LR G+TG++                                    
Sbjct: 533 SRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNGNGNGNSVNRRLASSSSSSSNFN 592

Query: 544 --XDEPNKIKIRMKKAHRRSVPPNLYSDFYANE------DTPKLYSSNSPVK-------- 587
                 + +  + K  +RRS+PP++ SDF  +E       +   Y S+SPVK        
Sbjct: 593 FDTKRQDDLDKKQKLENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKT 652

Query: 588 -----LKSLST-------QRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPV 635
                LKS S+        +ESIQ RV  LL    E+P   K+ASGYGKYTD        
Sbjct: 653 ASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNN-SEDPLAHKSASGYGKYTD-------- 703

Query: 636 PERGGRIPTPTNKRYSSVIINPVTEXX-----XXXXXXXXXXXXXXXXXXXXXXXXXKIY 690
                 +    + R+SSV I P+TE                                 ++
Sbjct: 704 ------VNAEASNRHSSVRITPITEGKFNKYYNSGTLKGETSRNDKHKSRPPRPPPKPLH 757

Query: 691 PDERISST-----------ATERI--------VNLDVESLEKDFKRRFPSRI 723
               I +T             ERI        V+++V+ LE DF++RFPS++
Sbjct: 758 LRTEIQNTRNFSRLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSKV 809

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/799 (43%), Positives = 459/799 (57%), Gaps = 96/799 (12%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P I T+P G +LTVGSH+ K+IKYLTSGG+AQ+Y  EISP +PY NS  ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAMKLLKNNRHVVSYIDSHA++S +  GAYEVF+LME+C+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MN+RLQ+RLTE EIL I+S T QG++AMH LQPAL+HRDIKIENVLIS   E+K+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  +RPP+N QE  +V HD++KNTTAQYR+PEMLDL +GLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-GGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299
           YYTTPFEK GGEAAIL +R+QYP++P+Y+D+LKNLIR  L ++PS RPN+CQ+LEE+SR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGIPCPINNFYLSRTI-NVQASLMNPIIT---------PTQQ------------TALKHS 337
           QGIPCPI NFYL R + N + ++  P+           P+ Q             ALK +
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360

Query: 338 QSSATISDQ-------SYAVPL-------------------------ASSRSSTTTGNKP 365
           Q++   ++Q       +  +PL                         + S  ST T NK 
Sbjct: 361 QTTIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTSNKN 420

Query: 366 ILIETEIPD-------MSQGSDDVYSRIHPFQKSQTLRTP--SRSSSPIKYTGTLLQXXX 416
           + I+T  PD        S+ +D  Y  +     S     P  + SSSP K   ++     
Sbjct: 421 V-IDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKSWKSI----- 474

Query: 417 XXXXXXXXXXXHYVDSETQTFXXXXX--XXXXXXXXXXXXXXXXDQLKEHRTGGSITQFF 474
                      +YVD ETQT+                         ++E+ TG S+ +  
Sbjct: 475 NDNYDVSKRPTNYVDEETQTYTGQSTFLRRTSSNRSNRSISSQYSGVQENTTGSSLVRKL 534

Query: 475 TSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXX 534
           +  LK V+TGES     I+SRQNTG SIRSA +++RSG TGN                  
Sbjct: 535 SVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNN-NNTRSASYDNGKRLSS 588

Query: 535 XXXXXXXXXXDEPNKIKIRMKKAHRRSVPPNLYSDFYANE------DTPKLYSSNSPVKL 588
                     ++ +  +  M + +  SV  N   D   +E       + + Y S SPV++
Sbjct: 589 VNLHMHSAILEQDDSDEFEMPRYN--SVSSNTLKDVEEHERRTVNTSSREYYRSQSPVRM 646

Query: 589 KSLSTQRESIQNRVKALLETFEEE-PSTIKTASGYGKYTD---SEFITSPVPERGGRIPT 644
                 + SIQ RV+ LL+  EE   +T++TASGYGKYTD   ++   SP   R  +   
Sbjct: 647 SVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQF-- 704

Query: 645 PTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYPDERISSTATERIV 704
                 S+  +  ++                            +     R+SS AT+ +V
Sbjct: 705 ----NQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFLSSRPVASSRVSSNATDMLV 760

Query: 705 NLDVESLEKDFKRRFPSRI 723
           +L V+ +EKD +RRFPS +
Sbjct: 761 DLSVDDIEKDIRRRFPSTV 779

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/804 (43%), Positives = 439/804 (54%), Gaps = 94/804 (11%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           M+QP + TYP GT+LTVGSH  +IIKYLTSGGFA IY+ EISP +P N+S  ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LN+LRAEVDAMKLLK ++ VVSYIDSHAA+S++  G+YEVFLLMEYC  GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E E+L I+SQ  QGV+AMHALQP LIHRDIKIENVLIS  G FK+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP+NPQEL YVQHD+LKNTTAQYR+PEM+DLYRGLP++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GE AILHS++Q+PA+P Y+D+LKNLI A L E+P +RPNICQLL E+SRIQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GIPCPINNFYLSRTI-----------------NVQASLMNPIITPTQQTALKHSQSSATI 343
           G+PCP+ NFYL R +                 +V    M  I  P   T   H Q     
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPI--TLQPHPQKVLAS 357

Query: 344 SDQSYA-----------VPLASSRSSTTTG-NKPIL-----------IETEIPDMSQGSD 380
           +  SYA             L  SRS      N P L            + E P++    +
Sbjct: 358 AQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKE 417

Query: 381 DVYSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQXXXXXXXXXXXXXXHYVDSETQTFXX- 439
               +++    +    T  RS SP++     +                YVDSETQTF   
Sbjct: 418 ----QLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETI 473

Query: 440 ---XXXXXXXXXXXXXXXXXXXDQLKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQ 496
                                 D ++E  TGGS T+     LKR+++ E RNTSPIRSRQ
Sbjct: 474 EPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQ 533

Query: 497 NTGGSIRSAFDALRSGITGN-----TXXXXXXXXXXXXXXXXXXXXXXXXXXXDEPNKIK 551
           NTGGS RSAF  LR G + N     +                           +E     
Sbjct: 534 NTGGSTRSAFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTN 593

Query: 552 IRMKKAHRRSVP-PNLYSDFYANEDTPKLYS-----SNSPVKLKSLSTQRESIQNRVKAL 605
               K H RSV   ++ SD    E      S     ++SP+K+ +    R SIQ RV  L
Sbjct: 594 KFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDL 653

Query: 606 LETFEEEPSTIKTASGYGKYT-----------------DSEFIT-SPVPERG-------- 639
           L+  ++ P   KTA  +G+++                 D   +T SPV ++         
Sbjct: 654 LKNSQDSP-VRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQS 712

Query: 640 GRIPTPTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYPDERISSTA 699
             + +PT K ++        E                            I    R S+ A
Sbjct: 713 NTVVSPTRKHFTR-----TREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRA 767

Query: 700 TERIVNLDVESLEKDFKRRFPSRI 723
                 +D++ LE+DFK+R+PS I
Sbjct: 768 NTLSDEVDIDDLEEDFKKRYPSAI 791

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/806 (43%), Positives = 430/806 (53%), Gaps = 99/806 (12%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQ     Y PGT LTVGSH  +IIKYLTSGGFA IYT EI P +  + ++ ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAA+S V  G+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E E+L I S   QG++AMHALQP LIHRDIKIENVLIS    FK+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP+NPQE  YVQHD+LKNTTAQYRAPEM+DLYRG PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEAAILHSR+Q+P++P Y+D LK+LI   L E+P++RPNICQ+LEE+SRIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPINNFYLSRTINVQASLMNPIIT-------PTQQTA-------LKHSQSSATISDQ 346
           G PCP+ NFY++R +  Q     P I        P   +A        K S +    S Q
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360

Query: 347 SYA-VPLASSRSSTTTGNKPILIETEIPDMSQG-----------------------SDDV 382
           ++A  P+ ++ +      KP+ I+      + G                       S D 
Sbjct: 361 TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISHDF 420

Query: 383 --YSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQXXXXXXXXXXXXXXHYVDSETQT---F 437
               R   F  + TL + S  S P+   G + +               Y+ S TQT   F
Sbjct: 421 NRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPI-YLSSGTQTDDGF 479

Query: 438 XXXXXXXXXXXXXXXXXXXXXDQLKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQN 497
                                    +H TGGS T+ F   LK V TGE R+ SPI+SRQN
Sbjct: 480 ASSHALKLERTKSIASLSSSESVESQH-TGGSATRRFGQKLK-VFTGERRSISPIKSRQN 537

Query: 498 TGGSIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXXXXXXXXXXXXDEPNKIKIRMKKA 557
           TG S+RSAF  LR G +G +                              N  K R+  +
Sbjct: 538 TGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHS---------NGFKFRVSSS 588

Query: 558 HRRSVPPNLYSDFYA-----------------NEDT--PKLYSSNSPVKLKSLSTQRESI 598
                  N+Y  F                    +DT     Y S+SPVK+ +    R SI
Sbjct: 589 ESIEE-ENVYPRFSHSRSSSSASIVSDLDQLQQDDTGAKNYYKSHSPVKVSATQGSRSSI 647

Query: 599 QNRVKALLETFEEEPSTIKTASGYGKYT------------DSEFITSPVPERGGRIP--- 643
           Q RV+ LL+  ++ P   KTA GYG  +             +E +   V +     P   
Sbjct: 648 QKRVQDLLKNSQDSP-VKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVL 706

Query: 644 TPTNKRYSSVIINPVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYPDERISSTATER- 702
           +P  KR SSV+I    +                            +  D+ I    T   
Sbjct: 707 SPA-KRNSSVVIK-AGQQVSKDAEEVPSSRKPAPPKPKRPKKPSHLKADKIIKEAETSAY 764

Query: 703 -----IVNLDVESLEKDFKRRFPSRI 723
                I +++++ LEKDFKRRFPS +
Sbjct: 765 EHSVDISDIEIDELEKDFKRRFPSAV 790

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 276/315 (87%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP IP Y PGT+LTVGSH+ K+I YLTSGGFAQ+Y+ EI P + + +S  ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN+HVVSYIDSHAA+S+   G+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EILNI+SQ  QG++AMHALQP LIHRDIKIENVLIS  G++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP+NPQE AYVQHDVLKNTTAQYR+PEM+DLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGGE AILHSR+Q+PA PIY+D+LK LIR  LME+P +RPN+CQ+LE++SR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GIPCPINNFYLSRTI 315
           GI CP+ NFYL R +
Sbjct: 301 GIQCPVRNFYLLRAM 315

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  520 bits (1339), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/469 (55%), Positives = 324/469 (69%), Gaps = 34/469 (7%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P IPTY PGT+L+VG+H+ KI+KY+ SGGFAQ+Y+ E+ P +    +   CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           P+KAGLN LRAEV+AMKLLK ++HVV YIDSHAARS +  G YEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EILNI+SQ  QG++AMHALQP LIHRDIKIENVLISA GE+K+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPPRNPQE A+VQHD+LKNTTAQYR+PEM+DLYR   I+EKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGG+ AILHSRYQ+ A PIY+D+LKNLI   L + P +RPNICQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GIPCPINNFYLSRTI---NVQASLMNPIIT----------PTQQTALKHSQSSAT----- 342
           G+  P+ NFYL R +   N   S + P ++          P Q   L  +QS        
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360

Query: 343 -ISDQSYAVPLASSRSSTTTGN-------KPILIETEI------PDMSQGSDDVYSRI-H 387
            ++ Q   + +A +RS  +TG         P+++ T++        +  GS D+ S I  
Sbjct: 361 GVTPQPMPI-MAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILP 419

Query: 388 PFQKSQTLRTPSRSSSPIKYTGTLLQXXXXXXXXXXXXXXHYVDSETQT 436
           PF ++ TL T   S+ P K  G +                +YVDSETQT
Sbjct: 420 PFNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSETQT 468

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  507 bits (1305), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 244/361 (67%), Positives = 287/361 (79%), Gaps = 15/361 (4%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP I TY PGT+L VGSH  +IIKY+TSGGFAQIYT EISP + + +S  ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN+HVVSYIDSHA++S    G+YEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRLTE E+L+I SQ  QG++AMHALQP L+HRDIKIENVLIS   ++KICDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPP NPQEL YVQHDVLKNTTAQYR+PEM+D YRGLPI+EKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-GGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299
           YYTTPFEK GGEAAIL +RY+YP FPIY+++LK+LI A LME+P +RPNI Q++EEIS++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGIPCPINNFYL------SRTINVQ--------ASLMNPIITPTQQTALKHSQSSATISD 345
           Q +PCPI NFYL       + + +Q         S  +PI+   +Q  L+   SS  I  
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPMIDH 360

Query: 346 Q 346
           Q
Sbjct: 361 Q 361

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  513 bits (1320), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 261/450 (58%), Positives = 309/450 (68%), Gaps = 28/450 (6%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP IP Y PGTLLTVGSH  +++KYLTSGGFAQIYT +ISP + + N+  ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAA+     G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQ RL E EILNI+SQ  QG++AMHAL P L+HRDIKIENVL+++KGE+K+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP N QE++YVQHD++KNTTAQYRAPEM+DLYRGLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEAAILH+ +Q+P +P Y+D+LK LI   LME PS+RPN  Q+LEE+S +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHS---QSSATISDQSYAVPLASSRS 357
            + CPI NFYL    NV    M     P    A+  S   Q     ++  Y  P A S +
Sbjct: 301 NVQCPIPNFYLMNN-NVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMN 359

Query: 358 S-----------TTTGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSSSPIK 406
                        +T N  ++  T   +M++        + P QKSQTL        P+ 
Sbjct: 360 DIQMMNAINLKVNSTHNTGMIPPTMATNMARTIP-----MQPVQKSQTL--------PVS 406

Query: 407 YTGTLLQXXXXXXXXXXXXXXHYVDSETQT 436
              T LQ               YVDSETQT
Sbjct: 407 SIPTNLQNTNKSSPFNLKSTTTYVDSETQT 436

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  509 bits (1312), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 268/315 (85%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP +  Y PGTLL+VGSH  +IIKYLTSGGFAQ+YT EISPI+P+ NS   CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAA+     G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL+I+SQ  QGV+AMHALQP L+HRDIKIENVL++++G +K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP NPQE  YVQHD++KNTTAQYR+PEM++L +GLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GE AILH+ +Q+P FP Y+D++K+LIR TL   PS+RPNI QLLEE+S+IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GIPCPINNFYLSRTI 315
            +PCPI +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  511 bits (1317), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 244/351 (69%), Positives = 278/351 (79%), Gaps = 7/351 (1%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP IP Y PG +L VGSH  KI+KYLTSGGFAQ+Y  EISP + ++ S  ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARS----TVLAGAYEVFLLMEYCKGGG 116
           PDK  LN  RAEV+AMKLL+NN++VVSYIDSHAA+S     V  G+YEVFLLMEYC G G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKIC 176
           LIDFMNTRLQNRL E EILNI+S   QGV+AMHALQP L+HRDIKIENVLIS K EFK+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFL 236
           DFGSVC  IRPP N  EL +VQHD+LKNTTAQYR+PEML L + +PINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
           YK+CYYTTPFEK GE AILHSRYQYPA+P Y+D LKNLIR  LM DPSKRPNICQ++EE+
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRIQGIPCPINNFYLSRTIN---VQASLMNPIITPTQQTALKHSQSSATIS 344
           SR+QG+PCP+ NFYL R I    VQ +  N  +       L+HS SS  +S
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALS 351

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  509 bits (1310), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 283/373 (75%), Gaps = 30/373 (8%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP+   Y  GT LTVGSH  +IIKYLTSGGFA IY+ EISP +P +    ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAA+S    G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRLTE E+L I+S   QG++AMHAL P LIHRDIKIENVLIS    FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP+N QE +YVQ+D+LKNTTAQYR+PEM+DLYRG PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK G+AAILHSR+Q+PA+P Y+D+LKNLI   L E+P++RPNICQ+LEE+SRIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPINNFYLSR-----------------TINVQASLM--------NPIITPTQQTALK 335
            +PCP+ NFYL R                 ++ V  SL          P++TP      K
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPVLTP-----FK 355

Query: 336 HSQSSATISDQSY 348
           H+QSSA  + +++
Sbjct: 356 HAQSSALRTSKTF 368

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 87/292 (29%), Positives = 123/292 (42%), Gaps = 44/292 (15%)

Query: 466 TGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTXXXXXXXX 525
           TGGS ++ F   LK+V TGE R+ SPI+SRQNTG S++SAF  LR G +  +        
Sbjct: 510 TGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSK 569

Query: 526 XXXXXXXXXXXXXXXXXXXDEPNKIKIRMKKAH--------------RRSVPPNLYSDFY 571
                                 N  K R+  +               R++   ++ SD  
Sbjct: 570 KNTVDVTTNGSSS---------NGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLD 620

Query: 572 ANED-----TPKLYSSNSPVKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYT 626
           + +D       K Y S+SPVKL   S  R SIQ RV+ LL++ ++ P   K+A GYG+ +
Sbjct: 621 SLQDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSP-VKKSAHGYGEVS 679

Query: 627 DSEFITSPVPERG----------GRIPTPTNKRYSSVIINPVTEXXXXXXXXXXXXXXXX 676
           + E   SP    G           R   P  KRYSSV  + +                  
Sbjct: 680 EKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIVPTAKNTTAKDIEQPIRV 739

Query: 677 XXXXXXXXXXXKIYPDERI--SSTATE---RIVNLDVESLEKDFKRRFPSRI 723
                       +  D  I   S+ TE      +L++E LEKDF+RRFPS +
Sbjct: 740 HHKPKRPTKPPHLKADRIIKHGSSTTENPRHSSDLEIEELEKDFQRRFPSAV 791

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  505 bits (1301), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 307/698 (43%), Positives = 390/698 (55%), Gaps = 91/698 (13%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP I  Y  GT+L VGSH  K++KYL SGGFA +Y+ EISP +P      ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDKA LNTLRAEVD+MK L+ N+ +VSYIDSHA +S V  G YEV+LLMEYC GGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EILNI+SQ  QGV+AMHALQP LIHRDIKIENVL+S   EFK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IR PRN +E  YVQ+D++KNTTAQYR PEM+DLYRGLPI+EKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GE+AIL S++++PA+P Y+D++KNLI   L  DP KRPNICQ++EE+SRIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 G------------------------------------IPCPINNFYL-----------SR 313
           G                                    +P  ++  +L           S+
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQTPSK 360

Query: 314 TINVQ------ASLMNPIITPTQQTALKHSQSSA-----TISDQSYAVPLA----SSRSS 358
           T ++Q       S   P++T  QQ  L   Q +      T+S+ + + P +    S+  S
Sbjct: 361 TASIQHLPYLHVSKSQPMVT--QQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLS 418

Query: 359 TTTGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQXXXXX 418
           T+   + +     IP +       Y + H   +SQ++  P  S SP++  G         
Sbjct: 419 TSATMESLPRAMRIPQLE------YQQPHLLTRSQSV-VPRASVSPVR-NGRGAISSILA 470

Query: 419 XXXXXXXXXHYVDSETQTFXXXXXXXXXXXXXXXXXXXXXDQLKEHR---TGGSITQFFT 475
                     YVDSETQT                         +      TGGS+T+   
Sbjct: 471 SNRTSLDRPKYVDSETQTSDHPSELGLSRSLSRKSVASSLSSAESLEATSTGGSLTRKIG 530

Query: 476 STLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTXXXXXXXXXXXXXXXXXX 535
           S +K+V+TGE R  S IRS QNTG S++SAF+ALR GI+                     
Sbjct: 531 SKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLEARKYR 590

Query: 536 XXXXXXXXXDEPNKIKIRMKKAHRRS------VPPNLYSDFYANEDTPKLYSSNSPVKLK 589
                    +  +       K+HRRS      VP N  +D+   ED  K     S ++  
Sbjct: 591 STSGKSIPENTSSNT-----KSHRRSTSSFSFVPEN--NDYELIEDIQK-EKPKSSLRRS 642

Query: 590 SLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTD 627
           S      SIQ RVK L+    ++     +A+GYGKYTD
Sbjct: 643 SSLKTSSSIQKRVKDLINA--DDIPNRSSATGYGKYTD 678

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  500 bits (1287), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 261/315 (82%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP +     GT LTVG+H  KI+KYLTSGGFAQIY  EI  +  +N S  ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LN LRAEVDAMKLL NN+HVVSYIDSHA RS    G YEVFLLMEYC+GGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRLTE EIL+I+SQT QG++ MHAL P L+HRDIKIENVL+S  G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPPRN QEL YVQHD++KNTTAQYR PEMLDLYRGLPI+EK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GE AILH+R+Q+P+FP Y+D+LKNLI++ L E PS RPN+CQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GIPCPINNFYLSRTI 315
            +PCPI NFYL R +
Sbjct: 301 NVPCPIRNFYLLRAM 315

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 68/149 (45%), Gaps = 24/149 (16%)

Query: 592 STQRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIP--TPTNKR 649
           S +R+SIQ RV+ LL+         K+A GYGKYTD       +   G  IP  TP +  
Sbjct: 547 SEKRKSIQLRVQHLLDNMSSN-EVKKSAQGYGKYTDE------LSSTGTNIPKVTPDSPV 599

Query: 650 YSSVI-------------INPVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYP--DER 694
            + +I              N +++                           ++ P  ++R
Sbjct: 600 LADLIDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPKKLRSNKKISTLSALRLEPKQNDR 659

Query: 695 ISSTATERIVNLDVESLEKDFKRRFPSRI 723
           I+S AT+ +++L+V+ LE+DFKRRFPS +
Sbjct: 660 ITSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  499 bits (1285), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/322 (71%), Positives = 267/322 (82%), Gaps = 1/322 (0%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP+IPTYP G  L VG H+  I+KYLTSGG+AQ+Y  +ISP +    S   CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDKA LNT RAEVDAMKLL+N  HVVSYIDS+AA+S +  GAYEV LLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EILNI+SQ  QGV+AMH+L+P L+HRDIKIENVLIS  GE+K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP + QE  +VQHD+LKNTTAQYRAPEM+DL R LPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEAAILHSRY+Y A+P Y+D LKNLIR  L   PS+RPNICQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GIPCPINNFYLSRTINVQASLM 322
           GIPCPI NFYL R I+ +++LM
Sbjct: 301 GIPCPIKNFYLERAIH-RSTLM 321

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 552 IRMKKAHRRSVPPNLYSDFYANEDTPKLYSSNSPVKLKSLSTQRESIQNRVKALLETFEE 611
           I + KA   S+P N  S          L +S+S        +   SIQ+R+K L++  + 
Sbjct: 548 IPVSKAKHHSLPSNFSSSIKIGNGEGTLTTSDSN------QSDNNSIQDRMKNLIDNADN 601

Query: 612 EPSTIKTASGYGKYTDS 628
            P   K AS YGKYT S
Sbjct: 602 IPIN-KIASDYGKYTKS 617

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  494 bits (1272), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 229/338 (67%), Positives = 265/338 (78%), Gaps = 8/338 (2%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP+I  Y PGT L VG H   IIKYLTSGGFAQIY  +++P NP N    ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           P+K+GLNTLRAEV+AM+LLK   HVV YIDS+AARS    G YEV  LME+C GGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E E+LNI++Q  QG+ AMH+L P LIHRDIKIENVLIS+ GE+K+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPP+N +E  +VQ D++KNTTAQYR PEMLDLYRG PINEKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFE GGE AILH+RYQYP +P+Y+ +LKNLIR  LME P +RPN+CQ+LEE+S +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GIPCPINNFYLSRTINVQASLMN------PIITPTQQT 332
           GIPCP+ NFYL R    Q  + N      PI  PTQ T
Sbjct: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPI--PTQNT 336

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  488 bits (1257), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/309 (71%), Positives = 263/309 (85%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP I TY  GT LTVGSH  +IIKYLTSGGFAQ+Y+  I+P +P++NS  ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAM+LLKNNR+VVSYIDSHAA++ +  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL I+SQ  QGV+AMHALQP LIHRDIKIENVLISA  E+K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPPRN QEL+YVQ D+LKNTTAQYR+PEM+D +RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGG+ AIL  ++++P +P Y+++LK LIR  L++DP  RPN+ QLL+ IS +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GIPCPINNF 309
            +PCPIN+ 
Sbjct: 301 NVPCPINDI 309

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  485 bits (1249), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 265/309 (85%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP I TY  GT LTVGSH  +I+KYLTSGGFAQ+Y+  ISP +P+++S  ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAM+LL+NNR+VVSYIDSHAA++ +  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL I+SQ  QGV+AMHALQP LIHRDIKIENVLISA  E+K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPPRNPQEL+YVQ D+ KNTTAQYR+PEM+D++RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGGE AIL   +++P +P Y+++L++LIR  L+++P +RPN+ QLL+ IS +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GIPCPINNF 309
            +PCPI++ 
Sbjct: 301 NVPCPISDI 309

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  483 bits (1243), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/306 (71%), Positives = 264/306 (86%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP I TY  GT LTVGSH  +IIKYLTSGGFAQ+Y+  ISP +P+ NS  ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NNR+VVSYIDSHAA++T+  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL I+ Q  QGV+AMHALQP LIHRDIKIENVLISAK E+K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPPRNPQEL+YV+ DVLKNTTAQYR+PEM+D++RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGGE AIL+ ++++  +P Y+++L+NLI   L+++PS+RPN+ QLL++I+ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GIPCPI 306
             P PI
Sbjct: 301 NAPYPI 306

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  481 bits (1238), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/323 (68%), Positives = 269/323 (83%), Gaps = 3/323 (0%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP I TY  GT LTVGSH  +IIKYLTSGGFAQ+Y+  ISP +P+ N+  ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAM+LLKNNR+VVSYIDSHAA++ +  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRL E EIL I+SQ  QGV+AMHALQP LIHRDIKIENVLIS   E+K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IR PRN QEL+YVQ D+LKNTTAQYR+PEM+D++RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEKGGE AIL  ++++P +P Y+++LK+LIR  L+++P  RP++ QLL+ IS +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GIPCPINNFYLSRTINVQASLMN 323
            +PCPIN+    +T+   +S +N
Sbjct: 301 NVPCPINDI---QTVQAPSSHLN 320

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  480 bits (1236), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 285/380 (75%), Gaps = 7/380 (1%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQ  +P Y P T++TVGSH  KI+KYL SGG+AQ+Y+  ++P++    +  ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LN LRAEVDA+K+L+N ++VVSYIDSHA++ +   G+YEVF+LMEYC GG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           +NTRL+NRL E+EIL+I++Q   GV+ MH LQP+LIHRDIKIEN+LIS  GE+K+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           VC  IRPPR+ +E+ Y+QHD++KNTTAQYR+PEMLDL +G  INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GE AIL S++QYPA+P+Y+D LKN+IR  L  DP KRPNICQL+EE+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GIPCPINNFYLSRTINVQASLMNPI-----ITPTQQTALKHSQSSATISDQSYAVPLASS 355
           GI  P+ NFYLSR +   +SLM P+       P      KH +    I      +P   S
Sbjct: 301 GIVPPMKNFYLSRALET-SSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQS 359

Query: 356 RSSTTTGNKPILIETEIPDM 375
            S+  T NK IL     PD+
Sbjct: 360 TSNGMTTNK-ILTRQTSPDI 378

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 81/176 (46%), Gaps = 21/176 (11%)

Query: 461 LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGIT-GNTXX 519
           L ++ TG S+ +  +  LK V+TGE R+ SP+RSRQNTGGS RS F  L  G T GN+  
Sbjct: 495 LSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGGNSRI 554

Query: 520 XXXXXXXXXXXXXXXXXXXXXXXXXDEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPKL 579
                                     E   I        R+ V      D       PK+
Sbjct: 555 SSSEHTIRGPSSSSHKSRVSSSTKNFEEGFI--------RKHV------DIVEESAEPKV 600

Query: 580 YSSNSPVKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPV 635
                 +KLK+    ++SI+ RV+ LL   E+E    +TASGYGKYTD + I + +
Sbjct: 601 -----GIKLKTTREAKDSIKRRVRELLLVSEDEQYH-RTASGYGKYTDVQEIVTNI 650

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  475 bits (1222), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 258/311 (82%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQPNI TYP GT LTVGSH  +IIKYLT+GGFAQIY T ISPI+P++ +  ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LN LRAEVDAMKLL+NNR VVSYIDSHAA+S+   G YEVFLLMEYC+ GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           +N+RLQNRL E E++NI+    QGV+AMHALQP L+HRDIKIENVL+S   EFK+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPP NPQELA VQ+D+++NTTAQYR+PEM+D+ RG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFEK GEA IL SRY++PAFP Y+D+L++LI   L   P+ RPNI  +++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GIPCPINNFYL 311
            I CPI NFYL
Sbjct: 301 NISCPIINFYL 311

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  472 bits (1215), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 270/361 (74%), Gaps = 20/361 (5%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQ       PG +LTVGSH  KII+YLTSGGFAQIY+ E+    P   S  ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK  LNTLRAEVDAMK+LK +RHVVSYIDSHAA+S    G YEV+LLMEYC  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MN+RLQ RL+E E+L I+S   QG+ AMHAL P LIHRDIKIENVLIS  G+FK+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V   IRPP+N  E  YVQHD+LKNTTAQYRAPEM+DLYR LP++EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           Y+TTPFEK GE AIL +++Q+P++P YTD+LKNLI   L E P +RPNICQ+LEE+SRIQ
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSSTT 360
           G+PCP+ NFYL R       + +   TP   +A   SQ          A+PLA+ + ST+
Sbjct: 300 GVPCPLPNFYLER-------MKHGACTPVHHSA---SQP---------ALPLATHQFSTS 340

Query: 361 T 361
           T
Sbjct: 341 T 341

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  469 bits (1207), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/345 (64%), Positives = 269/345 (77%), Gaps = 14/345 (4%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQ-TACLKRVI 59
           MNQ    ++ PGT+LTVGSH  K++KYLTSGGFAQIY  E+  I+P +  +  ACLKRV 
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEV--ISPDSKVKDVACLKRVH 58

Query: 60  VPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLID 119
           VPDK  LNTLRAEVDAMKLL+ N+H+VSYIDSHA++S +  G+YEV LLMEYC  GGLI 
Sbjct: 59  VPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118

Query: 120 FMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFG 179
           FMNTRLQ+RL E E+L I++Q VQG+ AMHALQP LIHRDIKIENVLI+  G+ K+CDFG
Sbjct: 119 FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178

Query: 180 SVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKL 239
           SVC  IRPP+N  EL+YVQHD+LKNTTAQYRAPEM+DLYRG  ++EKSDIWALGVFLYKL
Sbjct: 179 SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKL 238

Query: 240 CYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299
           CYYTTPFEK GE AIL + +Q+P++P Y+++LKNLI   L E+P  RPN CQ+LEE+ RI
Sbjct: 239 CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298

Query: 300 QGIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATIS 344
           QG PCP+ NFYL R++  Q         P+Q   L+HS S   I+
Sbjct: 299 QGQPCPVKNFYLERSLKQQ--------IPSQ---LRHSVSQPMIA 332

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  459 bits (1181), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 258/329 (78%), Gaps = 8/329 (2%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MNQP IP YPPG ++ VGSH  KI+KYLTSGGFAQIY+ EISP + Y NS  ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           P+K+GLN LR EVDAMKLLKNNRHVVSYIDS+AA+S    G+YEVFLLMEYC+ G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNT+L+ RL E+E+LNI++Q  QG++AMH L P LIHRDIKIENVLIS  G FK+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYK-- 238
           VC  IRPPRNPQEL YVQHDV+KNTTAQYR+PEM+DL +G PI  K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --LCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
             L +YT  F +  E AIL+ RYQYPA+PIY+D+LKN++R  L   P KRPNICQLLEEI
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SRIQGIPCPINNFYLSRTINVQASLMNPI 325
           S+IQ IPCPI+NFYL R+ +  A  + P+
Sbjct: 297 SKIQNIPCPIDNFYLERSRHQGAVSVMPV 325

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  460 bits (1183), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 211/325 (64%), Positives = 256/325 (78%), Gaps = 3/325 (0%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT-ACLKRV 58
           MNQP IP Y  G +L +G+H   I KYL  GGFAQ+Y+   I   N  N   T ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLI 118
           IVPDK+GLNTLRAEVDAMKLLK N+++VSYIDSHA RS +  G YEVFLLMEYC  GG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDF 178
           DF+NTRL +RL E EIL I+S   QGV+AMH LQP LIHRDIKIENVLIS  G++KICDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYK 238
           GS CS +RPP+ PQE A++ HD++ NTTAQYR+PEM+D Y G PI+EKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISR 298
           LCYYTTPFEK GE AIL+ ++Q+P++P Y+D ++N+I   L +DP KRPNICQ+LE++S+
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 IQGIPCPINNFYLSRTINVQASLMN 323
           +QG+PCPI NF L+R I +Q S  N
Sbjct: 301 LQGVPCPIENFMLTR-IKLQNSRNN 324

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 584  SPVKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTD 627
            S ++L S    ++ I+ RV  LL+  E +    +TA GYGKYTD
Sbjct: 1196 SSLRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  437 bits (1123), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 251/320 (78%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60
           MN P+IP Y PGT +TVGSH   I+KYLTSGG+AQIY+ +I P + +  +  A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120
           PDK+ LNTLRAEVDAMK LK+++++VSYIDSHAA+S  + G YEVFL+MEYC  GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
           MNTRLQNRLTE EIL I     QGV+AMH LQP LIHRDIKIENVLIS   ++K+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
           V  YIRPP+ P+ELAYV+HD++ +TTAQYRAPEMLDL +G  +N+KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           YYTTPFE+ GEA IL+   ++P +P Y+D +K LI + L ++P  RPNI Q+++ +S++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GIPCPINNFYLSRTINVQAS 320
            + CPI N ++   I++  S
Sbjct: 301 NVNCPIPNIHVPTDISIAVS 320

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  401 bits (1030), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 240/340 (70%), Gaps = 4/340 (1%)

Query: 9   YPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNT 68
           Y  GT L V SH   I  YLTSGGFAQ+YT  I+  +     +  CLKRVIVP+K  LN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR 128
           LRAEVDAMK+LKNN+++VSYIDSHA R      +Y V LLMEYC G GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPP 188
           L E+EIL I++   QGV  MH LQP L+HRDIKIENVL+S  G FK+CDFGSV   +R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 RNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEK 248
            + +E  Y+Q+D+LKNTTAQYR+PEM++L  G PINEKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 GGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGIPCPINN 308
            G  AI+  ++ YPA+P YTD LKN+IR  L  +P +RPNICQLLEE+ RIQ    P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYLSRTINVQASLMNPIITPTQQTALKHSQ-SSATISDQS 347
           FY+ R +   +SL      P +   LK++Q S   IS QS
Sbjct: 309 FYVQRAM---SSLQMDTTQPHRIPILKYTQMSKPVISSQS 345

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 4/171 (2%)

Query: 459 DQLKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTX 518
           D +  + TGGS+ +   + +K   TG  R+ SPI+SRQNTG SIRSAF+ +R GI     
Sbjct: 496 DSISRNSTGGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGI---NL 552

Query: 519 XXXXXXXXXXXXXXXXXXXXXXXXXXDEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPK 578
                                     D   +     K  H  +      S     +++  
Sbjct: 553 RSSRISSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYNSLSRKLSLSSQKQNSLN 612

Query: 579 LYSSNSPVKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSE 629
             +SN P+ L +    ++SI++RV+AL+++   +   I +A GYGKYTD++
Sbjct: 613 DSTSNDPIILITNLEAKKSIKDRVQALMKS-SSDNHVIISAHGYGKYTDNK 662

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  311 bits (796), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 206/312 (66%), Gaps = 10/312 (3%)

Query: 8   TYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE----ISPINP-----YNNSQTACLKRV 58
           +Y PGT++ VG H  +++KYL  GGFA+IY  +    +S ++P       N    CLKRV
Sbjct: 28  SYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRV 87

Query: 59  IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLI 118
           +V D  GLN +R EV+ M+ LK    VV Y DS+A+R    A  YEV LLME C    L+
Sbjct: 88  LVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLL 147

Query: 119 DFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDF 178
           D+MN RL  +L+E EIL I+      V+ MH L   LIHRDIKIENVL+ +K  FK+CDF
Sbjct: 148 DYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDF 207

Query: 179 GSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYK 238
           GS  + +    + Q++A +  ++  +TT QYR+PEM+DLYR LP+NEKSDIWALGVFLYK
Sbjct: 208 GSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYK 267

Query: 239 LCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISR 298
           L +YTTPFE+ G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+L +I  
Sbjct: 268 LMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICY 326

Query: 299 IQGIPCPINNFY 310
           I GI  P+++ Y
Sbjct: 327 ISGIKNPMDDAY 338

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  314 bits (804), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 208/320 (65%), Gaps = 11/320 (3%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNN---------S 50
           +N PN   YP G +++VG+H  +I+ YL  GGFAQIY  + +  +N + +          
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  QTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLME 110
             ACLKRVIV D+ GLN +R EV+ MK LK++ ++V Y DS+A+R T     +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAK 170
            C    L+D+MN RL+ +L+E EIL I+     G+S MH L   LIHRDIKIENVL+ A 
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIW 230
             FK+CD GS      P  + Q++A +  ++  +TT QYRAPEM+DLYR LPINEKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC 290
           ALG+FLYKL +YTTPFE  G+ AILHS+Y +P    Y+ K+ NLI   L E+P+ RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QLLEEISRIQGIPCPINNFY 310
           Q++  I  I  +P PI + Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  309 bits (791), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 204/315 (64%), Gaps = 9/315 (2%)

Query: 4   PNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEI--------SPINPYNNSQTACL 55
           P +    PGTL+ VGSH  +I+KYL  GGFA IY  +         +P +       ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGG 115
           KRV+V D+ GLN LR EV+ MK LKN+ ++V Y DS+A+R    +  YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKI 175
            L+D+MN RL  +L+EKE+L I+    + V+ MH L   LIHRDIKIENVL+ ++  FK+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVF 235
           CDFGS  S        Q++A + +++  +TT QYRAPEM+DLYR LPI+EKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEE 295
           LYKL +YTTPFE  G+ AILHS+Y  PA   Y+ KL NLI   L E+P+ RPNI Q++ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 ISRIQGIPCPINNFY 310
           +  I  +  P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  308 bits (790), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 209/328 (63%), Gaps = 20/328 (6%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYT-------TEISPINPYNNSQT------ 52
           I  +  G  + VGSH  +I+KYLT GGFAQIY         E   I+  N  Q       
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 53  --ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLME 110
              CLKRV+V D+AGL+ ++ EV+ MK L+   +VV Y DS+A R+    G +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAK 170
           YC    L+D+MN RL  +LTE EILNI+     GVS +H L   LIHRDIKIENVL+   
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GEFKICDFGSVCSYIRPP--RNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSD 228
             FK+CDFGS  + I PP     Q+++ + HD+  +TT QYR+PEM+DL+R LP+NEK+D
Sbjct: 206 NRFKLCDFGS--TNICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPN 288
           IWALGVFLYKL +YTTPFE  G+ AILHS+Y+ P    Y+++L NLI   L E+P+ RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 ICQLLEEISRIQGIPCPINNFYLSRTIN 316
           I Q+L EI  I  +  PI + Y +   N
Sbjct: 323 IYQVLSEICSILNVEVPIPDIYGAGVFN 350

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  308 bits (790), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 207/318 (65%), Gaps = 11/318 (3%)

Query: 3   QPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQ---------T 52
           +PN   Y PGT + VG+H  +IIKY+  GGFAQIY  + I  +N + N++          
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYC 112
           ACLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A+R       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 KGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGE 172
               L+D+MN RL  +LTEKEIL I+      VS MH L   L+HRDIKIENVL+ A+  
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWAL 232
           FK+CDFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPI+EKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQL 292
           G+FLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 LEEISRIQGIPCPINNFY 310
           L  I  I G+  PI + Y
Sbjct: 315 LHNICSISGMKVPIEDQY 332

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  307 bits (787), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 207/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNS--------Q 51
           + +P +  Y PGT++ VG+   +II ++  GGFAQIY+ + I  +  +NN          
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  TACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEY 111
            ACLKRV+VPD+ GL+ +R EV+ MK L+  + ++ Y DS+A+R T     YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKG 171
           C    L+D+MN RL  RLTEKEIL ++  T   +S MH L   LIHRDIKIENVL+ A+ 
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWA 231
            FK+CDFGS  +        Q++A +  ++  NTT QYR+PEM+DLYR LPINEKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQ 291
           LG+FLYKL ++ TPFE  G+ +ILHS+Y++PA   Y+ KL NLI   L E+P  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 LLEEISRIQGIPCPINNFY 310
           ++  I  + G   PI + Y
Sbjct: 313 VMHHICSVIGCEVPIEDKY 331

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  306 bits (783), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 209/324 (64%), Gaps = 17/324 (5%)

Query: 3   QPN-IP-TYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPIN-------------P 46
           QPN +P  YP GT + VGSH  ++IKY+  GGFAQIYT + I  +N             P
Sbjct: 91  QPNTLPGNYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKP 150

Query: 47  YNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVF 106
                 ACLKRV+V D  GLN +R EV+ M+ L+    VV Y DS+A+  +  A  YEV 
Sbjct: 151 LQPGDIACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVL 210

Query: 107 LLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVL 166
           LLME+C    L+D+MN RL  RL+EKEI+ I+  T  G++ +H L+  LIHRDIKIENVL
Sbjct: 211 LLMEFCPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVL 270

Query: 167 ISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEK 226
           +  +  FK+CDFGS         N +++A    ++  NTT QYR+PEM+DLYR  PI+EK
Sbjct: 271 VDQENNFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEK 330

Query: 227 SDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKR 286
           SDIWALGVFLYKL ++TTPFE+ G+ AILHS+Y++P    Y+ KL NLI   L E+PS R
Sbjct: 331 SDIWALGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVR 389

Query: 287 PNICQLLEEISRIQGIPCPINNFY 310
           PNI Q+L+ +  I G   P+N+ Y
Sbjct: 390 PNIYQVLQYLCSINGWKVPLNDKY 413

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  303 bits (775), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 204/323 (63%), Gaps = 22/323 (6%)

Query: 9   YPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNS----------------- 50
           + PG ++ VG H  +IIKYL  GGFAQIY+   I  +N ++N                  
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 51  ---QTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFL 107
                ACLKRV+VPD+ GLN LR EV+ M+ LK   ++V Y DS+A+R       +EV L
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L+EKEIL I+     G+S MH LQ  LIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKS 227
            +   FK+CDFGS  +      + QE+A +  ++  +TT QYR+PEM+DLYR LPI+EKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRP 287
           DIWALGVFLYKL +YTTPFE  G+ AILHS+Y+ P    Y+ +L NLI   L E+P+ RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPNN-YSSRLINLIIIMLAENPNLRP 317

Query: 288 NICQLLEEISRIQGIPCPINNFY 310
           NI Q++ ++    GI  PI + Y
Sbjct: 318 NIYQVMHQVCITIGIEPPIKDKY 340

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  305 bits (780), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 152/325 (46%), Positives = 206/325 (63%), Gaps = 10/325 (3%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT------- 52
           M  P +  Y PG ++ VG+H  +++ YL  GGFAQIY  + +  +N ++N+ +       
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 53  -ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEY 111
            ACLKRV+V D+ GLN +R EV+ MK LK   ++V Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKG 171
           C    L+D+MN RL  +LTE EI+ I+      +S MH L  +LIHRDIKIENVL+ AK 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWA 231
            FK+ DFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQ 291
           LGVFLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISRIQGIPCPINNFYLSRTIN 316
           +L  +  I  +  PI + Y     N
Sbjct: 313 VLYHLCEILNVEVPIEDKYAEGAYN 337

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  303 bits (777), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 204/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT------- 52
           M  P +  Y PG ++ VG+H  +I+ YL  GGFAQIY  + +  +N ++N+ +       
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 53  -ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEY 111
            ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A+R       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKG 171
           C    L+D+MN RL  +LTE EI+ I+      +S MH L   LIHRDIKIENVL+ AK 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWA 231
            FK+ DFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPINEKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISRIQGIPCPINNFY 310
           +L  +  I  +  PI + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  303 bits (776), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 204/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT------- 52
           M  P +  + PG ++ VG+H  ++I YL  GGFAQIY  + +  +N ++N+ +       
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 53  -ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEY 111
            ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKG 171
           C    L+D+MN RL  +LTE EI+ I+   V  +S MH L   LIHRDIKIENVL+ A  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWA 231
            FK+ DFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISRIQGIPCPINNFY 310
           +L  +  I  I  PI + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  303 bits (775), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 205/326 (62%), Gaps = 25/326 (7%)

Query: 9   YPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT--------------- 52
           +P GT + VGSH  +IIKY+  GGFAQIY  + +  +N + +S T               
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 53  --------ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYE 104
                   ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A+R    A  +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           V LLME C    L+D+MN RL  +LTE EIL I+      VS MH L+  L+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VL+ A+  FK+CDFGS  + +      Q++A +  ++  +TT QYR+PEM+DLYR LPI+
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPS 284
           EKSDIWALG+FLYKL ++ TPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPN 322

Query: 285 KRPNICQLLEEISRIQGIPCPINNFY 310
            RPNI Q+L+ I  +  +  PI + Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  300 bits (769), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT------- 52
           M  P +  Y PG ++ VG+H  +I+ YL  GGFAQIY  + +  +N ++N+ +       
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 53  -ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEY 111
            ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKG 171
           C    L+D+MN RL  +L+E EI+ I+      +S MH L   LIHRDIKIENVL+ A+ 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWA 231
            FK+ DFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISRIQGIPCPINNFY 310
           +L  I  I     PI + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  300 bits (768), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 204/320 (63%), Gaps = 12/320 (3%)

Query: 2   NQPN-IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPY--NNSQT----- 52
           N+P+ +  +  G+ + VG+   +I+KYLT GGFAQIY  + +   N +  NNS       
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 53  --ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLME 110
             ACLKRV+V D+ GLN +R EV+ MKLLK   ++V Y DS+A+R       +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAK 170
            C    L+DFMN RL  +L+EKEIL I+      V+ MH L P LIHRDIKIENVL+ ++
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 GEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIW 230
             FK+ DFGS           Q++A +  D+  +TT QYR+PEM+DLY+ LPI+EKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 ALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC 290
           ALG+FLYKL +Y TPFE  G+ AILHS+Y +P    Y+ +L NLI   L E+P+ RPNI 
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQTN-YSSRLINLIIIMLSENPNLRPNIY 315

Query: 291 QLLEEISRIQGIPCPINNFY 310
           Q+L EI  I G    I + Y
Sbjct: 316 QVLHEICSISGTRLEITDKY 335

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  294 bits (753), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 198/308 (64%), Gaps = 10/308 (3%)

Query: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTT---------EISPINPYNNSQTACLKRVIVPD 62
           G+ + VG+H  +I+KYL  GGFA IY           E +P       +TACLKRV+V D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMN 122
           + GLN +R EV  MK L    ++V Y DSHA+RS      +EV LLME C    L+D+MN
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 123 TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVC 182
            RL  +L+E+EIL I+    + ++ MH L   LIHRD+KIENVL+     FK+CDFGS  
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 183 SYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYY 242
           + +      QE+A + +++  +TT QYR+PEM+DLYR LPI+EKSDIWALG+FLYKL +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 243 TTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGI 302
           TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+++ +  I  +
Sbjct: 272 TTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 303 PCPINNFY 310
             PI + Y
Sbjct: 331 ENPIEDKY 338

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  293 bits (751), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 152/307 (49%), Positives = 196/307 (63%), Gaps = 9/307 (2%)

Query: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT-------ACLKRVIVPDK 63
           G++L VG H  +II+YL  GGFA IY    I   N  +   +       ACLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  AGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNT 123
            GLN LR EV+ MK LK   +VV Y DS+A+R T     +EV LLME C  G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCS 183
           RL  +L+E+E+L I+    +G+S MH L+  LIHRDIKIENVL+ +   FK+CDFGS  +
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 YIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYT 243
            +      QE+A + +++  +TT QYR+PEM+DLYR L INEKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGIP 303
           TPFE  G+ AILHS+Y  P    ++ KL NLI   L E+P  RPNI Q+L  I  I    
Sbjct: 271 TPFELTGQFAILHSKYDIPQNN-FSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPINNFY 310
            PI + Y
Sbjct: 330 VPIEDHY 336

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  295 bits (756), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 199/316 (62%), Gaps = 10/316 (3%)

Query: 4   PNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNN--------SQTAC 54
           P +  + PG ++ VG+H  +++ YL  GGFAQIY  + +  +N + N           AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKG 114
           LKRV+V D+ GL+ +R EV+ MK L   +++V Y DS+A R       +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
             L+D+MN RL  +LTEKEIL I+      VS MH L+  LIHRDIKIENVL+ A+  FK
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGV 234
           +CDFGS           QE+A +  ++  +TT QYR PEM+DLYR LPINEKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
           FLYKL ++ TPFE  G+ AILHS+Y++P    Y+ +L NLI   L E+P  RPNI Q+L 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 EISRIQGIPCPINNFY 310
            I  + G+  PI + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  290 bits (743), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/333 (45%), Positives = 203/333 (60%), Gaps = 16/333 (4%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTT---------EISPINPYNNSQTACLK 56
           I TY PG ++ VG H  +IIKYL  GGFA+IY           +I+ I         CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGG 116
           RV+V D  GLN +R EV  MK L    ++V   DS+A+R T     YEV LLME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKIC 176
           L+D+MN RL  +LTE EIL I+      V+ MH L   LIHRDIKIENVL+ ++  FK+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFL 236
           DFGS  + +      +++A +  ++  +TT QYR+PEM+D+YR + INEKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
           YKL +Y TPFE+ G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+L  I
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SRIQGIPCPINNFY------LSRTINVQASLMN 323
            +I  I  PI++ Y        +  N Q +L N
Sbjct: 395 CKIINIKTPIDDIYGLGPYDFQKYTNYQTALQN 427

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  293 bits (749), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 210/324 (64%), Gaps = 20/324 (6%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT------------ 52
           +  Y PG ++ VGSH  +I++Y+  GGFAQIY+ + +   N ++  ++            
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAAR------STVLAGAYEVF 106
           ACLKRVIV D+ GLN LR EV+ MK L    ++V Y DS+A+R      S      +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVL 166
           LLME C    L+D+MN RL  +L+E+EIL ++      ++ MH L+  LIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 ISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEK 226
           +  K  FK+CDFGS  +        +++AY+  ++  +TT QYR+PEM+DLYR LPI+EK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 SDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKR 286
           SDIWALG+FLYKL ++TTPFE+ G+ AILHS++++P    Y+ KL NLI   L E+P+ R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQNN-YSFKLINLIIVMLSENPNLR 313

Query: 287 PNICQLLEEISRIQGIPCPINNFY 310
           PNI Q+L +I +++ +P PI + Y
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKY 337

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  291 bits (745), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 196/308 (63%), Gaps = 10/308 (3%)

Query: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTT---------EISPINPYNNSQTACLKRVIVPD 62
           G+ + VG+H  +I+KYL  GGFA IY           E  P         ACLKRV+V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMN 122
           + GLN +R EV  MK L    ++V Y DSHA+R+   +  +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVC 182
            RL  +L+E+EIL I+    + ++ MH L   LIHRD+KIENVL+ A   FK+CDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 SYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYY 242
           +        QE+A + +++  +TT QYR+PEM+DLYR LPINEKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGI 302
           TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+++ +  I  +
Sbjct: 314 TTPFELTGQFAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 PCPINNFY 310
             P+ + Y
Sbjct: 373 KNPLEDKY 380

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  291 bits (746), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/322 (46%), Positives = 201/322 (62%), Gaps = 18/322 (5%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNN--------------- 49
           I  +  G  L VG+H  +I+ YLT GGFAQIY  + I  +N ++N               
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  -SQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLL 108
               ACLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A RS      YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLIS 168
           ME C    L+++MN RL  +L+EKE+L I+     GV+ MH L+  LIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 AKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSD 228
           +   FK+CDFGS  +        Q++A +  +V  +TT QYR+PEM+DLYR LPINEKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPN 288
           IWALGVFLYKL +YTTPFE  G+ A+LHS++  PA   Y+ K+ NL+   L E+ + RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLRPN 326

Query: 289 ICQLLEEISRIQGIPCPINNFY 310
           I Q++  I ++  +  PI + Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  288 bits (737), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 196/317 (61%), Gaps = 11/317 (3%)

Query: 4   PNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNS----------QTA 53
           PN     P T + VG+H C+I+++L  GGFA IY  +   +    ++            A
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCK 113
           CLKRVIVPD+ GLN LR EV+ MK L+ + ++V Y DS+A+R    +  +E+ LLME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 114 GGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEF 173
              L+D+MN +L  +LTE EIL I+      ++ MH L   LIHRDIKIENVL+     F
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 174 KICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALG 233
           K+CDFGS           Q++A + +++  +TT QYR+PEM+DLYR LPINEKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 234 VFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
           +FLYKL +YTTPFE  G+ AILHS+Y+ P    Y+ KL NLI   L E+PS RPNI Q++
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 294 EEISRIQGIPCPINNFY 310
             +  I     P  + Y
Sbjct: 323 HHVCSILKCDVPFTDKY 339

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  290 bits (743), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 202/321 (62%), Gaps = 19/321 (5%)

Query: 3   QPNIP-TYPPGTLLTVGSHYCKIIKYLTSGGFAQIY-------TTEISPIN------PYN 48
           QP I   +P G ++TVGSH  +++ YL  GGFAQIY       T E    N      P  
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  NSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAG----AYE 104
               ACLKRV+V D+ GLN +R+EV+ MK L+   ++V Y DS+A+R    +G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           V LLME C    L+D+MN RL  +LTE+EI  I+      V+ MH L   LIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VL+ A   FK+CDFGS  +      + Q++A +  D+  +TT QYR+PEM+DL++ +PIN
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPS 284
           EKSDIWALGVFLYKL ++TTPFE+ G+ A+LHS++++P    Y+ KL NLI   L E+PS
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPS 387

Query: 285 KRPNICQLLEEISRIQGIPCP 305
            RPNI Q+L  +S +     P
Sbjct: 388 LRPNIYQVLYYLSEVTNREVP 408

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  287 bits (734), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/333 (46%), Positives = 198/333 (59%), Gaps = 31/333 (9%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNN--------------S 50
           I  Y  GT+LTVG    +I+KYLT GGFAQIYT   I  +N ++N               
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 51  QTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAAR--------------- 95
             ACLKRV+VPD+ GL+ +R EVD MK L N  ++V Y DS+A++               
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDN 156

Query: 96  STVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPAL 155
           +      +E+ LLMEYC    L+DFMN RL  +LTE EIL  ++     V  MH L   L
Sbjct: 157 NKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPL 216

Query: 156 IHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML 215
           IHRDIKIENVL+ +   FK+ DFGS      P    Q++A +  D+  NTT QYR+PEM+
Sbjct: 217 IHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMI 276

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLI 275
           DLY+ LPI+EKSDIWALGV LYKL +YTTPFE  G+ AILHS+Y++PA   Y+ K  NLI
Sbjct: 277 DLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLI 335

Query: 276 RATLMEDPSKRPNICQLLEEISRIQGIPCPINN 308
              L E+P+ RPNI Q+L  +  I       NN
Sbjct: 336 IIMLAENPNLRPNIFQVLYYLKSISNTMNSNNN 368

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  288 bits (737), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 196/316 (62%), Gaps = 12/316 (3%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT----------AC 54
           I  Y PG L++VG+H  KI  YL  GGFAQIY  + I  +N + N +           AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKG 114
           LKRV+V D+ GLN +R EV+ MKLL+   ++V Y DS+A R       YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
             L+D+MN RL+ +L E EI+ I+  T   VS MH L   LIH+DIK+EN+L+ +   FK
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGV 234
           +CDFGS         +  ++A +  ++  +TT QYR+PEM+DLYR LPINE SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
           FLYKL ++ TPFE+ G+ +ILH+++  P    Y  KL NLI   L E+ + RPNI Q++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 EISRIQGIPCPINNFY 310
           EI  I   P PI + Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  281 bits (719), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 195/309 (63%), Gaps = 13/309 (4%)

Query: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNN----------SQTACLKRVIVP 61
           G+ + VG H  ++I+YL  GGFA IY  ++S +   N             T CLKRV V 
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIY--KVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D+ GLN LR EV+ MK L+N  ++V Y DS+A+R       YEV LLME C  G L+D+M
Sbjct: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
           N RL  +L+E E+L I+     G+S MH  +  LIHRDIKIENVL+ A   FK+CDFGS 
Sbjct: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
              +    + QE+A + +++  +TT QYR+PEM+DLYR LPINEKSDIWALG+FLYKL +
Sbjct: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269

Query: 242 YTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQG 301
           YTTPFE  G+ AILHS+Y+ P    ++ KL NL+   L E+P  RPN+ Q++  I  +  
Sbjct: 270 YTTPFELTGQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHICSMME 328

Query: 302 IPCPINNFY 310
               I++ Y
Sbjct: 329 CEVKIDDLY 337

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 147/322 (45%), Gaps = 45/322 (13%)

Query: 8   TYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLN 67
           T PP TL T+        K +  G F  ++      +N  N ++     ++I  D +   
Sbjct: 9   TLPPSTLFTID-------KCVGKGNFGDVFKA----MN--NVTKEVVAIKIINLDDSEEE 55

Query: 68  TLR--AEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRL 125
           T     E+  M LLK+  ++  YI       T +   Y ++++MEYC GG   D + T  
Sbjct: 56  TFEIIKEMRLMSLLKS-PYIARYI-------TTINEDYLMWIVMEYCGGGSARDLIKTCY 107

Query: 126 QNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI 185
           +  L E ++  ++   + G+  +HA     IHRDIK  N+L++  G  K+ DFG V + +
Sbjct: 108 REGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEM 164

Query: 186 RPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
           R     +             T  + APE++ +  G+  NEKSDIW+LG+  Y+L     P
Sbjct: 165 RSTMKAKTFV---------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPP 214

Query: 246 FEKGGEAAILHS---RYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGI 302
             K     ++ +   R        YT+ +K+ I   L++DP KRP+  +LLE    ++G 
Sbjct: 215 LAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG- 273

Query: 303 PCPINNF-----YLSRTINVQA 319
           P  + N      YL  T   QA
Sbjct: 274 PGNVENLKNEVSYLKFTKETQA 295

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/354 (25%), Positives = 150/354 (42%), Gaps = 75/354 (21%)

Query: 13  TLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAE 72
           ++L  G HY  I + L  GGF+ +Y      +    N+    LK++  P       + + 
Sbjct: 20  SVLINGQHY-AIQRLLGEGGFSFVYL-----VQSRENNDLFALKKIHCP----FGNIESV 69

Query: 73  VDAMKLLKNNRHVVSYIDSHAARSTVLA---GAYEVFLLMEYCKGGGLIDFMNTRLQN-- 127
            +AM+ + + +   S   +H   S VL    G+  VF+L+ Y   G L+D +NT L +  
Sbjct: 70  SEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 128 RLTEKEILNILSQTVQGV------------------------------------------ 145
            ++E+EI+ IL    +G+                                          
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 146 -----------SAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQEL 194
                      S+  A   A  H+DIK  N++ S+ G   ICD GS         +  +L
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 195 AYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-- 252
              Q    ++ T  +R+PE+L++     I+EK DIW+LG  LY +C+  +PFE+  +   
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 253 -----AILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQG 301
                AI   ++  P    Y+ +L  +I+  +  D  KRP+I +LL  +  +QG
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 107/204 (52%), Gaps = 29/204 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V+    +V++ +EYC G  L +++   +Q+R++ +E   + +Q V  V   H+LQ   +H
Sbjct: 96  VIVTESKVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVH 151

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDL 217
           RD+K+EN+L+  KG  KI DFG    + R       L  V        T  Y APE+++ 
Sbjct: 152 RDLKLENILLDKKGRAKITDFG----FTRECATKTMLETVC------GTTVYMAPELIER 201

Query: 218 --YRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQ-YPAFPIYTDKL--- 271
             Y G  I    DIW+LGV LY + + T PF++  E     ++++     P Y D +   
Sbjct: 202 KSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYNDDVVSK 254

Query: 272 --KNLIRATLMEDPSKRPNICQLL 293
             K+LI   L +DPS+RP + Q+L
Sbjct: 255 DAKDLISQLLCKDPSQRPQLSQVL 278

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 104/201 (51%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
           +V++ +EYC G  L D++   +  R+   E   + +Q V  V   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML--DLYRGL 221
           N+L+  +G  K+ DFG    + R      +L  +        T  Y APE+L  D Y G 
Sbjct: 158 NILLDMQGNAKLADFG----FTRECATKNQLETIC------GTTVYMAPELLRRDTYDGF 207

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAF---PIYTDKLKN----- 273
            I    DIW+LGV LY L   + PF++  E     +R ++      P Y +K+ N     
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIE 258

Query: 274 LIRATLMEDPSKRPNICQLLE 294
           LI++ L++DP KRP++ ++L+
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 106/225 (47%), Gaps = 38/225 (16%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY +GG L D++  R   +L E+E ++   Q VQGVS  H     + H
Sbjct: 132 VWENKSELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICH 187

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K +  KI DFG                   + +L+ +     Y +PE 
Sbjct: 188 RDLKPENLLLDKKNKTVKIADFGMAA------------LETTNRLLETSCGSPHYASPEI 235

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L    H RYQ P+    +
Sbjct: 236 VMGQKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VS 289

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEEISRIQ-------GIPCPI 306
            + K+LI   L+ DP KR  + ++LE    ++       G+ CP+
Sbjct: 290 KEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPL 334

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 136/329 (41%), Gaps = 63/329 (19%)

Query: 23  KIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNN 82
           +I K L  GG + +Y  E          +   LK+   P      ++ +   AMK + N 
Sbjct: 27  RIQKLLGEGGLSFVYLVE------SKEGELFALKKTRCP----FGSIGSISPAMKEVANY 76

Query: 83  R-----HVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN--RLTEKEIL 135
           +     ++   +DS   +     G+  V++L+ Y   G L D +N  L +  +++E +IL
Sbjct: 77  QRFSSPYIAQIVDSQVVQEK--DGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMSELDIL 134

Query: 136 NILSQTVQGVSAMHALQP-----------------------------------ALIHRDI 160
            +     +G+  +H   P                                   +  HRD+
Sbjct: 135 RMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSYAHRDV 194

Query: 161 KIENVLISAKGEFKICDFGSVCSYIRPPRNP-QELAYVQHDVLKNTTAQYRAPEMLDLYR 219
           K  N++IS +    I D GS CS  R   N  Q L   Q     N T  Y APE+LD+  
Sbjct: 195 KPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILDVKL 253

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRYQYPAFPIYTDKLK 272
              I EK DIW+ G  +Y +C+  +PFE+  +        AI   +Y  P    Y+  L 
Sbjct: 254 NSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSSSLI 313

Query: 273 NLIRATLMEDPSKRPNICQLLEEISRIQG 301
            LI   L  +P +RP++ +L+  +  +QG
Sbjct: 314 ELIGKCLSVNPEQRPSVNELIALLMELQG 342

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 100/205 (48%), Gaps = 31/205 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ ++   +LTE E ++   Q + G+S  H+    + H
Sbjct: 203 VWENNNELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICH 258

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K    KI DFG                 V + +L+ +     Y +PE 
Sbjct: 259 RDLKPENLLLDKKRRIIKIADFGMAA------------LQVSNRLLQTSCGSPHYASPEI 306

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SDIW+ G+ L+ L     PF       +L    + RYQ P++   +
Sbjct: 307 VMGKCYNGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--IS 360

Query: 269 DKLKNLIRATLMEDPSKRPNICQLL 293
            + KNLI   L+ DPSKR +  Q+L
Sbjct: 361 QEAKNLISRILVVDPSKRISTEQIL 385

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 133/288 (46%), Gaps = 48/288 (16%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVP--DKAGLNTLRA 71
           L  VG++  KI+K +  G F ++Y     P +          K+V++   DK   N +R 
Sbjct: 33  LNEVGNY--KILKQIGEGSFGKVYLALHKPTH----------KKVVLKSSDKTDPNVVR- 79

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
                ++  + +    YI        V+    +V++++EYC    L D++ ++   R++ 
Sbjct: 80  -----EIFYHRQFDFPYI---TKLYEVIITETKVWMVIEYCPNKELYDYLLSK--KRISL 129

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E   I +Q V  V   H+L  + +HRD+K+EN+L+      K+ DFG    + +     
Sbjct: 130 DESARIFAQIVGAVYYAHSL--SCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKN---- 183

Query: 192 QELAYVQHDVLKNTTAQYRAPEML--DLYRGLPINEKSDIWALGVFLYKLCYYTTPFE-- 247
                 Q + +  TT  Y APE+L  + Y G  I    DIWALG+ LY +   T PF+  
Sbjct: 184 -----TQLETICGTTV-YMAPELLRREKYDGYKI----DIWALGILLYTIINGTMPFDED 233

Query: 248 --KGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
             K  E  I+ +   Y     + D   +L+   L +DPS RP I Q+L
Sbjct: 234 DPKKTELKIISASPDYDN-KYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 143/332 (43%), Gaps = 55/332 (16%)

Query: 15  LTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVP--DKAGLNTLRAE 72
           ++V  H   I + L  GGF+ +Y  E        N   A LK++  P      ++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVE-----SRENGLMA-LKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN--RLT 130
           VD  +  K+  ++   IDS   +     G+  V++L+ Y   G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFKS-PYIAQIIDSQVVQER--DGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EKEILNILSQTVQGVSAMHALQPA-----------------------------------L 155
           E E++ +     +G+  +H   PA                                    
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML 215
            H DIK  N++IS++G   I D GS         + Q L   Q    ++ T  + APE+L
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE---AAILHS----RYQYPAFPIYT 268
           D+     I EK D+W+ G  +Y +C+  +PFE+  +   A++ +S    +Y  P+   Y+
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
             L ++++  L  DP  RP++ +L+  +  +Q
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 104/205 (50%), Gaps = 29/205 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V+     V++ +EYC G  L +++   ++ R+   E  ++ SQ V  V   H+++   +H
Sbjct: 96  VIVTENSVWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVH 151

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDL 217
           RD+K+EN+L+  KG+ K+ DFG    + R       L  V        T  Y APE+++ 
Sbjct: 152 RDLKLENILLDKKGQAKLTDFG----FTRECATKGILETV------CGTTVYMAPELIER 201

Query: 218 --YRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQ-YPAFPIYTDKL--- 271
             Y G  I    D W+LG+ LY + +   PF+   E   + ++Y+     P Y D     
Sbjct: 202 KPYEGYKI----DTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDA 254

Query: 272 --KNLIRATLMEDPSKRPNICQLLE 294
             K+LI   L +DPS+RP++ Q+L+
Sbjct: 255 NGKDLIMQLLQKDPSQRPSLTQVLQ 279

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 144/325 (44%), Gaps = 39/325 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y + + +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 62  PPSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKL 117

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K+  ++V + D     + V       ++L+E C  G L+D +  R Q  L
Sbjct: 118 LSEIQIHKSMKHP-NIVQFTDCFEDDTNV-------YILLEICPNGSLMDLLKQRKQ--L 167

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q V  +  MH+ +  +IHRD+K+ N+        KI DFG          
Sbjct: 168 TEPEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA---- 221

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEML-DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEK 248
           N +E  Y         T  Y APE+L   + G     + DIW++GV +Y L     PF+ 
Sbjct: 222 NDRERKYT-----ICGTPNYIAPEVLTGKHTGHSF--EVDIWSIGVMIYALLIGKPPFQ- 273

Query: 249 GGEAAILHSRYQYPAFPIYTDK-----LKNLIRATLMEDPSKRPNICQLLEEISRIQGIP 303
             E   ++ R +   F    DK      K LI+  L  DP +RP++ +++E +      P
Sbjct: 274 AKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFP 333

Query: 304 CPINNFYLS-----RTINVQASLMN 323
             IN   L+       +++Q SL+N
Sbjct: 334 ARINGDILNFVPEFHDLDLQESLIN 358

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 82/152 (53%), Gaps = 7/152 (4%)

Query: 156 IHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML 215
           +HRDI++ N+L S++G   + D GS C          +L  +Q  V  N +  Y APE+L
Sbjct: 219 VHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQDWVTANCSFPYTAPELL 278

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRYQYPAFPIYT 268
           ++     I+ K+DIW++G   Y + +  +PFE+  +        AI   +Y +P    Y+
Sbjct: 279 NVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTYAIGCGKYTFPKQTRYS 338

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300
           + L  +I++ L  DP+ RP+I +LL+ +  +Q
Sbjct: 339 ESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 102/205 (49%), Gaps = 29/205 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V+    +V++ +EYC G  L D + +   +R+   E + + +Q V GV   H+L    +H
Sbjct: 97  VIITETKVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVH 152

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDL 217
           RD+K+EN+L+   G+ K+ DFG    + R       L  +        T  Y APE+++ 
Sbjct: 153 RDLKLENILLDKSGDAKLTDFG----FTRECMTKTTLETI------CGTTVYMAPELIER 202

Query: 218 --YRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA----AILHSRYQYPAF--PIYTD 269
             Y G  I    DIW+LGV LY +   + PF++  E      I+H   Q P     I T 
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVH---QTPQLNENIVTA 255

Query: 270 KLKNLIRATLMEDPSKRPNICQLLE 294
             K+LI   L ++P+ RP + Q+L+
Sbjct: 256 DAKDLILRLLAKNPNDRPTVEQILK 280

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 128/268 (47%), Gaps = 33/268 (12%)

Query: 31  GGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYID 90
           G +  +Y      IN + + Q   +K ++  +   LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVY----KAINKHTD-QVVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-- 85

Query: 91  SHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHA 150
            H      +  +YE+++L+EYC  G L   + +R    L+E E    ++QT+ G+  +H 
Sbjct: 86  -HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 151 LQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+SA    K+ DFG     +    N   L           T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWM 185

Query: 211 APEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFP--IYT 268
           APE+L   RG   +  SDIW+LG  + ++     P+    +A I ++      +P   ++
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFS 242

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEEI 296
           + LK+ +    +++  KRP   QLL+ +
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 134/290 (46%), Gaps = 52/290 (17%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVP--DKAGLNTLRA 71
           L  VG++  KI+K +  G F ++Y     P +          ++V++   DK+  N +R 
Sbjct: 31  LSEVGNY--KILKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKSDPNLVR- 77

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
                ++  + +    YI        V+    +V++ +EYC G  L + +   + +R+  
Sbjct: 78  -----EVFYHRQFDFPYI---TKLYEVIVTETKVWMALEYCPGRELYEHL--LMLHRIPL 127

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E   + +Q V  V   H+L    +HRD+K+EN+L+   G  K+ DFG    + R   + 
Sbjct: 128 DECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFG----FTRECVSK 181

Query: 192 QELAYVQHDVLKNTTAQYRAPEML--DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
             L  +        T  Y APE++    Y G  I    DIW+LGV LY +   T PF++ 
Sbjct: 182 SSLETI------CGTTVYMAPELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDED 231

Query: 250 GEAAILHSRYQ-YPAFPIYTDKL-----KNLIRATLMEDPSKRPNICQLL 293
            E     ++++    FP + D       K+LI+  L + PS+RP + Q+L
Sbjct: 232 DETK---TKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 99/203 (48%), Gaps = 27/203 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ ++   +L+E E ++  +Q +QGVS  H+    + H
Sbjct: 194 VWENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICH 249

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPE--M 214
           RD+K EN+L+  K +  KI DFG     +     P +L           +  Y +PE  M
Sbjct: 250 RDLKPENLLLDKKNKVIKIADFGMAALEL-----PNKLLETSCG-----SPHYASPEIVM 299

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYTDK 270
              Y G P    SD+W+ G+ L+ L     PF       +L      R+Q P  P  T+ 
Sbjct: 300 GKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTND 353

Query: 271 LKNLIRATLMEDPSKRPNICQLL 293
            K+LI   L+ +P KR  I ++L
Sbjct: 354 AKDLITRILVTNPEKRLTINEIL 376

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 94/194 (48%), Gaps = 20/194 (10%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++ ++E+  GG L+  +  R   RL E+    I SQ V  V  MHA    +IHRD+K EN
Sbjct: 87  LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHA--KGVIHRDLKPEN 142

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VL+S +G   I DFG+ C        P         V    TA+Y +PE+L L+      
Sbjct: 143 VLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV---GTAEYVSPELL-LHSQCSFG 198

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGE------AAILHSRYQYPAFPIYTDKLKNLIRAT 278
             SD+WALG  +Y+L     PF    E         L  R+ Y A P+    +  L+++ 
Sbjct: 199 --SDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVALVQSI 252

Query: 279 LMEDPSKRPNICQL 292
           L+ DP +RP+  QL
Sbjct: 253 LVLDPLQRPSAKQL 266

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 128/268 (47%), Gaps = 33/268 (12%)

Query: 31  GGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYID 90
           G +  +Y      IN + + Q   +K V+  +   LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVY----KAINKHTD-QVVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKY-- 85

Query: 91  SHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHA 150
            H      +  +YE+++L+EYC  G L   + +R    L+E E    ++QT+ G+  +H 
Sbjct: 86  -HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 151 LQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+SA    K+ DFG     +    N   L           T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWM 185

Query: 211 APEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFP--IYT 268
           APE+L   RG   +  SDIW+LG  + ++     P+    +A I ++      +P   ++
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFS 242

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEEI 296
           + LK+ +    +++  KRP   QLL+ +
Sbjct: 243 EPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 117/242 (48%), Gaps = 38/242 (15%)

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
           T+  E++  KL+  +++++S ID     +T+       ++++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLYDII-CRSKR 146

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            L E E   ++ Q    V  +H  +  ++H D+K+ N+LI +    ++CDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 188 PRNPQELAYVQHDVLKNT-----TAQYRAPEMLDLY-----RGLPINEKSDIWALGVFLY 237
                  ++V  D+  N+     T  Y +PE++  +     + L   ++SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 238 KLCYYTTPFE----KGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
            + +  TPFE    +     I+  +Y +      ++K+K LI+  L   P +R  I +++
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

Query: 294 EE 295
            +
Sbjct: 311 SD 312

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 107/204 (52%), Gaps = 27/204 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQ-NRLTEKEILNILSQTVQGVSAMHALQPALI 156
           ++    +V++ +EYC G  L D +   LQ  R+  +E + + SQ V  V   H+L    +
Sbjct: 105 IIVTESKVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CV 159

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLD 216
           HRD+K+EN+L+   G  K+ DFG    + R     + +  V  + +  TT  Y APE+ +
Sbjct: 160 HRDLKLENILLDKDGNAKLTDFG----FTR-----ECMEKVNLETICGTTV-YMAPELTE 209

Query: 217 L--YRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA----AILHSRYQYPAFPIYTDK 270
              Y G  I    DIW+LGV LY +   + PF++  EA     I++   +Y +    T +
Sbjct: 210 RKPYDGFKI----DIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEYNS-KFMTAE 264

Query: 271 LKNLIRATLMEDPSKRPNICQLLE 294
            ++L+R  L +D + RP++ ++L+
Sbjct: 265 GEDLVRKLLQKDSNLRPSVREILQ 288

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 102/215 (47%), Gaps = 25/215 (11%)

Query: 84  HVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQ 143
           H+V ++D              V++L+E C  G L+D +  R    LTE E+  + +Q   
Sbjct: 151 HIVKFMDC-------FEDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCG 201

Query: 144 GVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLK 203
            ++ MH+    +IHRD+K+ NV        KI DFG   +      N  E  Y       
Sbjct: 202 AINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG--- 252

Query: 204 NTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILH----SRY 259
             T  Y APE++ L + +  + ++DIW+LG+ +Y +     PF+      I       +Y
Sbjct: 253 --TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQY 309

Query: 260 QYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
           ++P     T+ +K LI+  L+ DPS+RP I  +L+
Sbjct: 310 EFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 130/287 (45%), Gaps = 46/287 (16%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEV 73
           L  VG++  KI+K +  G F ++Y     P +     +  CLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE-K 132
              ++  + +    YI        V+    +V++ +EYC G  L D + +  +  L E  
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECG 135

Query: 133 EILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQ 192
           E+   +S  V    +MH      +HRD+K+EN+L+   G  K+ DFG    + R      
Sbjct: 136 ELFAQISGAVYYAHSMHC-----VHRDLKLENILLDKNGNAKLTDFG----FTRECMTKT 186

Query: 193 ELAYVQHDVLKNTTAQYRAPEMLD--LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGG 250
            L  V        T  Y APE+++   Y G  I    DIW+LGV LY L     PF+   
Sbjct: 187 TLETV------CGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDD 236

Query: 251 EA----AILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
           EA     I++   +Y A  +  D  ++LI   L ++P +RP++ Q+L
Sbjct: 237 EAKTKWKIVNEEPKYDA-KVIPDDARDLISRLLAKNPGERPSLSQVL 282

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 82/177 (46%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +   L+N +TE E+  I  Q V G+  +H    A+IHRDIK ENV++ A G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML--DLYRGLPINEKSDIWAL 232
            + DFGS       P           DV   T   Y APE+L  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            G+ LY + +   PF    E  IL     +      + + K LI   L  +  KRP I
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 127/292 (43%), Gaps = 46/292 (15%)

Query: 9   YPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNT 68
           +    L  VG++  KI K +  G F ++Y     P       Q   LK     DK+  N 
Sbjct: 31  FSSSELTEVGNY--KIQKQIGEGSFGKVYLATHRPT-----KQKVVLK---TGDKSDPNV 80

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR 128
           +R      ++  + +    YI        V+    +V++ +EYC G  L D + ++  +R
Sbjct: 81  VR------EVFYHRQFDYPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLLSK--SR 129

Query: 129 LTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPP 188
           L   E   + +Q    V   H L    +HRD+K+ENVL+   G  K+ DFG    + R  
Sbjct: 130 LPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFG----FTRES 183

Query: 189 RNPQELAYVQHDVLKNTTAQYRAPEMLDL--YRGLPINEKSDIWALGVFLYKLCYYTTPF 246
                L  V        T  Y APEM+    Y G  +    DIW+LGV LY L     PF
Sbjct: 184 MTKAVLETVCG------TTVYMAPEMIQHKPYDGFKV----DIWSLGVILYTLLCGCLPF 233

Query: 247 EKGGEAAILHSRYQYPAFPIYTDKL-----KNLIRATLMEDPSKRPNICQLL 293
           ++  +  +L  +      P+  +++     +NLI   L +DP++RPN   +L
Sbjct: 234 DEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/327 (26%), Positives = 145/327 (44%), Gaps = 43/327 (13%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y + + +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 62  PPSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKL 117

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
            +E+   ++ K+ RH  +V + D     + V       ++L+E C  G L+D +  R Q 
Sbjct: 118 LSEI---QIHKSMRHPNIVQFTDCFEDDTNV-------YILLEICPNGSLMDLLKQRKQ- 166

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q V  +  MH+ +  +IHRD+K+ N+        KI DFG        
Sbjct: 167 -LTEPEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA-- 221

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEML-DLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
             N +E  Y         T  Y APE+L   + G     + D+W++GV +Y L     PF
Sbjct: 222 --NDRERKYT-----ICGTPNYIAPEVLTGKHTGHSF--EVDVWSIGVMIYALLIGKPPF 272

Query: 247 EKGGEAAILHSRYQYPAFPIYTDK-----LKNLIRATLMEDPSKRPNICQLLEEISRIQG 301
           +   E   ++ R +   F    DK      K LI+  L  DP +RP++ +++E +     
Sbjct: 273 Q-AKEVNTIYERIKVCDFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVWFRNV 331

Query: 302 IPCPINNFYLS-----RTINVQASLMN 323
            P  IN   L+       +++Q SL+N
Sbjct: 332 FPMRINGDVLNFVPEYHDLDLQESLIN 358

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 127/267 (47%), Gaps = 33/267 (12%)

Query: 31  GGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYID 90
           G +  +Y      IN + + Q   +K ++      LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVY----KAINKHTD-QVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-- 85

Query: 91  SHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHA 150
            H      +  +YE+++L+EYC  G L   + +R    L+E E  + ++QT+ G+  +H 
Sbjct: 86  -HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG 139

Query: 151 LQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+SA    K+ DFG     +    N   L           T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWM 185

Query: 211 APEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFP--IYT 268
           APE+L   RG   +  SDIW+LG  + ++     P+    +A I ++      +P   ++
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFS 242

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEE 295
           + LK+ +    +++  KRP   QLL+ 
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLKH 269

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 130/286 (45%), Gaps = 44/286 (15%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEV 73
           L  VG++  KI+K +  G F ++Y     P +     +  CLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQVGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKE 133
              ++  + +    YI        V+    +V++ +EYC G  L D + +   +R++  E
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLLS--LHRISLLE 133

Query: 134 ILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQE 193
              + +Q    V   H++    +HRD+K+EN+L+   G  K+ DFG    + R       
Sbjct: 134 CAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----FTRECMTKTT 187

Query: 194 LAYVQHDVLKNTTAQYRAPEMLD--LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE 251
           L  V        T  Y APE+++   Y G  I    DIW+LGV LY L   + PF+   E
Sbjct: 188 LETVCG------TTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDDE 237

Query: 252 A----AILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
                 I++    Y +  I  D  K+LI   L ++P +RP++ Q+L
Sbjct: 238 VKTKWKIVNEEPNYDSTLI-PDDAKDLISRLLAKNPKERPSLPQVL 282

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 111/234 (47%), Gaps = 36/234 (15%)

Query: 85  VVSYIDSHA---ARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQT 141
           V+  + SHA   A   V     E++L++EY  GG L D++ +R   +L E+E ++   Q 
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQI 223

Query: 142 VQGVSAMHALQPALIHRDIKIENVLISAKG-EFKICDFGSVCSYIRPPRNPQELAYVQHD 200
           V+GVS  H+    + HRD+K EN+L+  K  + KI DFG     +     P +L      
Sbjct: 224 VEGVSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFGMAALEL-----PNKL------ 270

Query: 201 VLKNT--TAQYRAPE--MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL- 255
            LK +  +  Y +PE  M   Y G P    SD+W+ G+ L+ L     PF       +L 
Sbjct: 271 -LKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEE--ISRIQGIPC 304
                +YQ P     + + +NLI   L+ DP KR    ++LE   I +   +P 
Sbjct: 326 KVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV 377

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 138/290 (47%), Gaps = 52/290 (17%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVP--DKAGLNTLRA 71
           L  VG++  KI+K +  G F ++Y     P +          ++V++   DK   N +R 
Sbjct: 31  LSEVGNY--KIMKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKNDPNVVR- 77

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
                ++  + +    YI        V+    +V++ +EYC G  L + +      R++ 
Sbjct: 78  -----EVFYHRQFDYLYI---TRLYEVIVTETKVWMALEYCPGKELYEHL--LALKRISL 127

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E   + +Q V  +   H+L    +HRD+K+EN+L+  KG  K+ DFG    + R     
Sbjct: 128 DECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFG----FTR----- 176

Query: 192 QELAYVQHDVLKNTTAQYRAPEMLDL--YRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           + ++  Q D +  TT  Y APE+ +   Y G  I    DIWALGV LY +   + PF++ 
Sbjct: 177 ECVSKSQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDED 231

Query: 250 GEAAILHSRYQ-YPAFPIYTDKL-----KNLIRATLMEDPSKRPNICQLL 293
            EA    ++++     P   + L     K+LI   L +DP++RP+I ++L
Sbjct: 232 DEAK---TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 102/200 (51%), Gaps = 16/200 (8%)

Query: 97  TVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALI 156
           T +     ++++MEYC GG   D + T   N L E ++  I  + ++G+  +H  +   I
Sbjct: 78  TTMIEDVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQKK--I 135

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLD 216
           HRDIK  N+L++ +G+ K+ DFG V   IR        A ++       T  + APE+++
Sbjct: 136 HRDIKAANILLTDEGKVKLGDFG-VSGQIR--------ATMKRGTFVG-TPYWMAPEVVN 185

Query: 217 LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS--RYQYPAF-PIYTDKLKN 273
                  NEK+DIW+LG+ +Y+L     P  K     ++ S  R + P     Y+D  K 
Sbjct: 186 -KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQYSDVAKG 244

Query: 274 LIRATLMEDPSKRPNICQLL 293
            + A L++DP+ RP+   LL
Sbjct: 245 FVAACLVKDPNLRPSAEMLL 264

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 129/290 (44%), Gaps = 33/290 (11%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + + G  Y +   +L  GGFA+ +  +      +     A   ++ +  +   N L
Sbjct: 87  PPSLIKSKGKDYYRG-HFLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKL 142

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
            +E+   ++ KN RH  +V +ID              V++L+E C  G L+D +  R   
Sbjct: 143 LSEI---QIHKNMRHQNIVHFID-------CFEDDINVYILLEICPNGSLMDLLKRR--K 190

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q    +  MH+    +IHRD+K+ N+        KI DFG + + I  
Sbjct: 191 ILTEPEVRFFTTQICGALDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAII-- 245

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N  E  Y         T  Y APE++   + +  + + DIW+LGV ++ +     PF+
Sbjct: 246 -NNENERKYTIC-----GTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ 299

Query: 248 KGGEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
               + I     H  Y +P     +  +K LI+  L  +P +RP I ++L
Sbjct: 300 AKEVSTIYDRIKHCNYSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 138/323 (42%), Gaps = 61/323 (18%)

Query: 23  KIIKYLTSGGFAQIYTTEI--SPINPYNNSQTA---CLKRVIVPDKAGLNTLRAEVDAMK 77
           KI + L  GG + +Y  ++    ++  N++ TA    LK++I P    ++    E++  K
Sbjct: 31  KIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNGMREIENYK 90

Query: 78  LLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR--LTEKEIL 135
             ++  +V+  IDS   +     G+  +++++ Y   G L D +N RL     ++E E +
Sbjct: 91  RFQSP-YVIQSIDSQVMQEK--DGSKTIYIILPYYSLGSLQDSINRRLLEGTFISEAECV 147

Query: 136 NILSQTVQGVSAMH--------------------------------------------AL 151
            I+    +G+  +H                                            A 
Sbjct: 148 RIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEMDMLSSSSAG 207

Query: 152 QPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRA 211
             A  HRDI   N+L S+ G   I D GS         N  +L+ +Q  V  N T  Y A
Sbjct: 208 LIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVNDNCTLPYTA 267

Query: 212 PEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRYQYPAF 264
           PE+L+L     ++ K DIW++G   Y L +  +PFE+  +        AI   +Y +P  
Sbjct: 268 PELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRN 327

Query: 265 PIYTDKLKNLIRATLMEDPSKRP 287
             ++++L ++I+  +  DP +RP
Sbjct: 328 SRFSERLLDVIKRCIQVDPIQRP 350

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 97/201 (48%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
           E++L++EY +GG L D++ +R   +L E+E ++   Q VQGVS  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLISAKG-EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA---QYRAPE--MLDL 217
           N+L+  K    KI DFG               A    D L  T+     Y +PE  M   
Sbjct: 197 NLLLDKKNLSVKIADFGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 218 YRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYTDKLKN 273
           Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P     +++ K+
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKD 297

Query: 274 LIRATLMEDPSKRPNICQLLE 294
           LI   L+ DP+ R  I ++LE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 122/233 (52%), Gaps = 37/233 (15%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K+++H  +V++IDS      +L G  +++++ME+ +GG L D +   +   LT
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSF-----LLKG--DLWVIMEFMEGGSLTDVVTHCI---LT 643

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +N+L+S KG+ K+ DFG  C+ I     
Sbjct: 644 EGQIGTVCRETLRGLQFLHSN--GVIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN---- 696

Query: 191 PQELAYVQHDVLKNT---TAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF- 246
                  +H++ + T   T  + APE++      P   K DIW+LG+ + ++     P+ 
Sbjct: 697 -------EHNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYL 746

Query: 247 -EKGGEAAILHSRYQYPAF---PIYTDKLKNLIRATLMEDPSKRPNICQLLEE 295
            E    A  L +    P      + +D L + +   L  +P +R +   LLE+
Sbjct: 747 NETPLRALYLIATNGTPKLKEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 97/201 (48%), Gaps = 16/201 (7%)

Query: 97  TVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALI 156
           T L     ++++MEYC GG   D +       + E ++  IL  TV+G+  +H  +   I
Sbjct: 78  TTLTEDVTMWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--I 135

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLD 216
           HRDIK  N+L++  G+ K+ DFG V   IR                   T  + APE+++
Sbjct: 136 HRDIKAANILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVIN 185

Query: 217 LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS---RYQYPAFPIYTDKLKN 273
             +    NEK+DIW+LG+  Y+L     P  K     ++ +   R        Y++K K 
Sbjct: 186 -KQCKGYNEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKY 244

Query: 274 LIRATLMEDPSKRPNICQLLE 294
            +   L++DP +RP+I  LLE
Sbjct: 245 FVSLCLIKDPKQRPSIEALLE 265

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 97/417 (23%), Positives = 177/417 (42%), Gaps = 56/417 (13%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 81  PPSLIKTRGRDYRRG-HFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKL 136

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K+  ++V ++D     + V       ++L+E C  G L+D M  R    L
Sbjct: 137 LSEIQIHKSMKHP-NIVHFVDCFEDDTNV-------YILLEICSNGSLMDLMKKR--KTL 186

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q    V  MH+ +  +IHRD+K+ N+        K+ DFG          
Sbjct: 187 TEPEVRFFTTQICGAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA---- 240

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L + +    + + DIW++GV +Y L     PF+  
Sbjct: 241 NNRERKYTV-----CGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-A 293

Query: 250 GEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGI-- 302
            +  +++ R     Y YP     + + K LI   L  DP +RP+I ++++++   +GI  
Sbjct: 294 KDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDVW-FRGIFP 352

Query: 303 -----------PCPINNFYLS------RTINVQASLMNPIITPTQQTALKHSQSSATISD 345
                      P   N   L       RT    A L++  +      ++++ +S+   ++
Sbjct: 353 PKITEDVMELTPKDTNEITLEESFTNFRTCMTNAGLLSSSVPSASSKSVRYKESNDAANE 412

Query: 346 QSYAVPLASSRSSTTTGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSS 402
               +  +   ++TT GNK IL     P    G+ + Y  +   +  + L   +R +
Sbjct: 413 LKAQIK-SDINNATTNGNKTILPHALSPG---GTKNKYKEVIDLEAQRKLNDLAREA 465

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 91/182 (50%), Gaps = 26/182 (14%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +   L+  +TE E   I  Q V  +  +H+    ++HRDIK ENV++ +KG  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEMLDLYRGLPINEK-SDIW 230
            + DFGS              AYV+    DV   T   Y APE+L    G P + K  DIW
Sbjct: 1152 LIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVL---SGEPFDGKPQDIW 1194

Query: 231  ALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC 290
            A+GV LY + +   PF    E  IL    ++      +++  NLI+  L ++PS+RP I 
Sbjct: 1195 AIGVLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTID 1252

Query: 291  QL 292
            ++
Sbjct: 1253 EV 1254

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 119/254 (46%), Gaps = 29/254 (11%)

Query: 47  YNNSQTACLKRVIVPDKAG--LNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYE 104
           Y  +   C  +V+  D A   +  ++ EV  +  LK   ++  Y  S+   +       E
Sbjct: 38  YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHYYGSYLNNT-------E 90

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG L   +      ++ E+ I  I+ + +  ++ MH  +  +IHRDIK  N
Sbjct: 91  LWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAAN 145

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VLI+  G  K+CDFG      +     Q +A          T  + APE+  +  G+  +
Sbjct: 146 VLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEV--IMEGVYYD 194

Query: 225 EKSDIWALGVFLYKLCYYTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLM 280
            K DIW+LG+  Y++     P+   +   A  L ++ + P      ++  LK  I   L 
Sbjct: 195 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLD 254

Query: 281 EDPSKRPNICQLLE 294
           EDP +RP+  +LL+
Sbjct: 255 EDPKERPSAEELLK 268

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 125/271 (46%), Gaps = 28/271 (10%)

Query: 28  LTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRH--- 84
           L  G ++ +Y       +  N +   C K+ I+ +K  +  +  E D + +L    H   
Sbjct: 16  LGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKK-VKYVTIEKDLLNMLAKGGHLGI 74

Query: 85  VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQG 144
           V  +   H   +        ++ ++EY  GG L+  +  RL  RLTE    +I +Q V  
Sbjct: 75  VKLFCTFHDIEN--------LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDT 124

Query: 145 VSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI-RPPRNPQELAYVQHDVLK 203
           V  MH+    +IHRD+K ENVL+S +G   I DFG+ C+   R   N +  A        
Sbjct: 125 VDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVG---- 178

Query: 204 NTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS--RYQY 261
             TA+Y +PE+L L+     +  SDIWALG  +Y+L     PF    E           Y
Sbjct: 179 --TAEYVSPELL-LHSQCGFS--SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDY 233

Query: 262 PAFPIYTDKLKNLIRATLMEDPSKRPNICQL 292
                 + ++ +++++ L+ DP KRP+  QL
Sbjct: 234 KWLFSNSPQVVSIVQSILVTDPLKRPSAAQL 264

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 101/207 (48%), Gaps = 35/207 (16%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E+FL++EY  GG L D++ +R   RL+EKE ++   Q ++G +  H+    + H
Sbjct: 125 VWENKLELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICH 180

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQ--HDVLKNTTA--QYRAP 212
           RD+K EN+L+  K +  KI DFG              +A +Q  + +L+ +     Y +P
Sbjct: 181 RDLKPENLLLDKKNKRIKIADFG--------------MAALQTSNKLLETSCGSPHYASP 226

Query: 213 E--MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPI 266
           E  M   Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P    
Sbjct: 227 EIVMGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--A 280

Query: 267 YTDKLKNLIRATLMEDPSKRPNICQLL 293
            + + ++LI   L+ DP+KR  I  +L
Sbjct: 281 ISLEAQDLISRILVVDPNKRITINDIL 307

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 39/229 (17%)

Query: 78  LLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEIL 135
           +++ ++H  +V++IDS+ A+        +++++MEY +GG L D +   L   L+E +I 
Sbjct: 668 VMRESKHSNIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LSEGQIG 717

Query: 136 NILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELA 195
            +  +T++G+  +H+    ++HRDIK +N+L+S KG  K+ DFG  C            A
Sbjct: 718 AVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFG-FC------------A 762

Query: 196 YVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EKG 249
            +  + LK TT      + APE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 763 QINENNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 819

Query: 250 GEAAILHSRYQYPAF---PIYTDKLKNLIRATLMEDPSKRPNICQLLEE 295
             A  L +    P        +D L   +   L  DPS+R    +LL++
Sbjct: 820 LRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 136/329 (41%), Gaps = 61/329 (18%)

Query: 23  KIIKYLTSGGFAQIYTTEI---SPI--NPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMK 77
           KI + L  GG + +Y  ++   S I  N     +   LK++I P+   ++    E++  K
Sbjct: 31  KIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESISNGMREIENYK 90

Query: 78  LLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR--LTEKEIL 135
             ++  +V+  IDS   +     G+  +++++ +   G L D +N RL     ++E E +
Sbjct: 91  RFQS-PYVIQSIDSQVMQEK--DGSKSIYIILPFYTLGSLQDSINRRLLEGTFISEAECV 147

Query: 136 NILSQTVQGVSAMH--------------------------------------------AL 151
            I+   ++G+  +H                                              
Sbjct: 148 RIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEMDMLSSNLGA 207

Query: 152 QPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRA 211
             A  HRDI   N+L S+ G   I D GS         N  +L  +Q  V  N T  Y A
Sbjct: 208 SIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVNDNCTLPYTA 267

Query: 212 PEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRYQYPAF 264
           PE+L L     ++ K DIW+LG   Y L +  +PFE+  +        AI   +Y +P  
Sbjct: 268 PELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAINTGKYSFPRN 327

Query: 265 PIYTDKLKNLIRATLMEDPSKRPNICQLL 293
             +++ L ++I+  +  DP +RP   QLL
Sbjct: 328 SRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 114/232 (49%), Gaps = 23/232 (9%)

Query: 66  LNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRL 125
           ++ L  E+  +  LK++ ++++YI       T +     ++++M+YC GG   D +    
Sbjct: 56  IDLLAQEIFFLAELKSD-YIINYI-------TTIMEDVSMWIVMDYCGGGSCSDLIKIVY 107

Query: 126 QNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI 185
            N + E+++  I+   + G+  +H  +   IHRDIK  N+L++  G+ K+ DFG V   I
Sbjct: 108 PNGIVEEKVSFIVKNVLLGLQYLH--EQKKIHRDIKAANILLTDDGQVKLGDFG-VSGQI 164

Query: 186 RPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
           +        A ++ D     T  + APE+++       +EK DIW+LG+  Y+L     P
Sbjct: 165 K--------ATLKRDTFVG-TPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPP 215

Query: 246 FEKGGEAAILHSRYQYPAFPI---YTDKLKNLIRATLMEDPSKRPNICQLLE 294
             K     ++ S  +     +   Y D  K+ I   L++DP  RPN+  LL+
Sbjct: 216 LSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 97/197 (49%), Gaps = 27/197 (13%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           V++ +EYC G  L +++  +    L  +E   + SQ V  V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPL--EECSELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDL--YRGLP 222
           +L+  KG  K+ DFG    + R       L  +        T  Y APE+++   Y G  
Sbjct: 159 ILLDKKGHAKLTDFG----FTRECATKGILETIC------GTTVYMAPELIERKPYEGYK 208

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKL-----KNLIRA 277
           I    D W+LG+ LY + + T PF++  E    +    Y   P Y +       K LI  
Sbjct: 209 I----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYN--PTYDNDYIDSNGKELISQ 262

Query: 278 TLMEDPSKRPNICQLLE 294
            L +DP++RP++ Q+L+
Sbjct: 263 LLEKDPNQRPSLTQVLQ 279

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 118/235 (50%), Gaps = 39/235 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     +L G  +++++MEY +GG L D +   +   LT
Sbjct: 670 INEILVMKGSKHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  C        
Sbjct: 720 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSINGNIKLTDFG-FC-------- 768

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A V    LK TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 769 ----AQVNETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 821

Query: 247 --EKGGEAAILHSRYQYPAF---PIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
             E    A  L +    P        +D LK+ +   L  +P +R +  +LLE++
Sbjct: 822 LNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 111/222 (50%), Gaps = 20/222 (9%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG   D +    +  LTE+++  I  + ++G+  +H+ +   IHRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           +L++  G+ K+ DFG          + Q +A  + D    T   + APE++        N
Sbjct: 163 ILLTDDGKVKLGDFGV---------SGQMMATRRRDTFVGTPF-WMAPEVIARSE-QGYN 211

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILH---SRYQYPAFPIYTDKLKNLIRATLME 281
           EK+DIW+LG+ +++L     P  +     +L    SR        Y+  ++  +   L +
Sbjct: 212 EKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLEDRYSHAIREFVSLCLNK 271

Query: 282 DPSKRPNICQLLEE--ISRI--QGIPCPINNFYLSRTINVQA 319
           DP+KRP   +LL+   I+R+  +G+        L + + V+A
Sbjct: 272 DPAKRPTASELLKHRFIARVGKKGVENLKEEVDLIKGVKVKA 313

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 47  YNNSQTACLKRVIVPDKAG--LNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYE 104
           Y  ++  C  +V+  D A   +  ++ E+  +  LK   ++  Y  S+   +       +
Sbjct: 38  YTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHYYGSYLNDT-------K 90

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG L   +      ++ E+ I  I+ + +  +  MH  +  +IHRDIK  N
Sbjct: 91  LWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELLTAL--MHIHKDGVIHRDIKAAN 145

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VLI+  G  K+CDFG      +     Q +A          T  + APE+  +  G+  +
Sbjct: 146 VLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEV--IMEGVYYD 194

Query: 225 EKSDIWALGVFLYKLCYYTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLM 280
            K DIW+LG+  Y++     P+   +   A  L ++ + P      ++  LK +I   L 
Sbjct: 195 TKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLD 254

Query: 281 EDPSKRPNICQLLEE--ISRIQGIPCPINNFYLSR 313
           EDP +RP+   LL+   I   + +P  I    +SR
Sbjct: 255 EDPKERPSAEDLLKTKFIKLHKNVPVSILKELISR 289

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 98/201 (48%), Gaps = 23/201 (11%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V+    +V++  EYC G  L D +   LQ R+     + + +Q V  V   H+L    +H
Sbjct: 97  VIVTESKVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVH 152

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML-- 215
           RD+K+EN+L+   G  K+ DFG    + R       L  +        T  Y APE++  
Sbjct: 153 RDLKLENILLDKNGNAKLTDFG----FTRECMTKTSLETIC------GTTVYMAPELIKR 202

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAI-LHSRYQYPAF--PIYTDKLK 272
           + Y G  I    DIW+LGV LY +   + PF++  E         + P F   I ++  K
Sbjct: 203 ESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAK 258

Query: 273 NLIRATLMEDPSKRPNICQLL 293
           +L+   L +DP++RP++ ++L
Sbjct: 259 DLLIKLLSKDPNERPSMQEIL 279

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 129/286 (45%), Gaps = 44/286 (15%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEV 73
           L  VG++  KI+K +  G F ++Y     P +     +  CLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKE 133
              ++  + +    YI        V+    +V++ +EYC G  L D + +   +R++  E
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLS--LHRISLLE 133

Query: 134 ILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQE 193
              + +Q    V   H++    +HRD+K+EN+L+   G  K+ DFG    + R       
Sbjct: 134 CGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----FTRECMTKTT 187

Query: 194 LAYVQHDVLKNTTAQYRAPEML--DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE 251
           L  V        T  Y APE++    Y G  I    D W+LGV LY L   + PF+   E
Sbjct: 188 LETV------CGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDDE 237

Query: 252 A----AILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
           A     I++   +Y    +  D  K+LI   L ++P +RP++ Q+L
Sbjct: 238 AKTKWKIVNEEPKYDP-KLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 89/185 (48%), Gaps = 28/185 (15%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +    +  +TE E   I  Q + G+S +H  +  ++HRDIK ENV++ AKG  K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVK 1151

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQH---DVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            + DFGS              AYV++   DV   T   Y +PE+L  + Y G P     DI
Sbjct: 1152 LIDFGSA-------------AYVKNGPFDVFVGTI-DYASPEVLRGEKYEGKP----QDI 1193

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WALG+ LY + +   PF    E  IL    ++P     +    +LI+  L     +RP+I
Sbjct: 1194 WALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSI 1251

Query: 290  CQLLE 294
              + E
Sbjct: 1252 TDISE 1256

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 132/292 (45%), Gaps = 32/292 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +         +     A   ++ +  +     L
Sbjct: 84  PPSLIKTRGRDYHRG-HFLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKL 139

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K+  ++V +ID     + V       ++L+E C  G L+D +  R    L
Sbjct: 140 LSEIQIHKSMKH-VNIVQFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KSL 189

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q    +  MH+ +  +IHRD+K+ N+    K   KI DFG   +      
Sbjct: 190 TEPEVRFFTTQICGAIKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA---- 243

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L + +    + + DIW++GV +Y L     PF+  
Sbjct: 244 NDRERKYTV-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQ-S 296

Query: 250 GEAAILHSRYQYPAFPIYTDKL-----KNLIRATLMEDPSKRPNICQLLEEI 296
            +   ++ R +   F    DKL     K LI+  L  DP +RP++ ++++ I
Sbjct: 297 KDVNTIYERIKCRDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 96/205 (46%), Gaps = 31/205 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ +R   RL E+E ++   Q +QGVS  HA    + H
Sbjct: 184 VWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICH 239

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K    KI DFG                 V + +L+ +     Y +PE 
Sbjct: 240 RDLKPENLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEI 287

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P     +
Sbjct: 288 VMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN--LS 341

Query: 269 DKLKNLIRATLMEDPSKRPNICQLL 293
            + ++LI   L  +P+KR    ++L
Sbjct: 342 KEAQDLIAKILTVNPAKRLTTEEIL 366

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 97/203 (47%), Gaps = 27/203 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E+FL++EY  GG L D++ +R   +L+E+E ++   Q ++GVS  H+    + H
Sbjct: 187 VWENKSELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICH 242

Query: 158 RDIKIENVLISAK-GEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPE--M 214
           RD+K EN+L+  K    KI DFG     +     P +L      V    +  Y +PE  M
Sbjct: 243 RDLKPENLLLDKKINTIKIADFGMAALEL-----PNKLL-----VTSCGSPHYASPEIVM 292

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYTDK 270
              Y G P    SD+W+ G+ L+ L     PF       +L      ++Q P     + +
Sbjct: 293 GKSYHGSP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQN--ISLE 346

Query: 271 LKNLIRATLMEDPSKRPNICQLL 293
            ++LI   L+ DP KR  I  +L
Sbjct: 347 AEDLISRILVVDPEKRIQINDIL 369

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 111/233 (47%), Gaps = 35/233 (15%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E++A+K L N+ ++V   +       VL  +  + +++EY  GG    ++  +   RL E
Sbjct: 95  EINALKHL-NHPNIVRLEE-------VLQNSKYIGIVLEYASGGEFYKYIQKK--RRLKE 144

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
                + +Q + GV  MH+    L+HRD+K+EN+L+       I DFG V  ++  P N 
Sbjct: 145 SAACRLFAQLISGVYYMHSK--GLVHRDLKLENLLLDKNENLLITDFGFVNEFL--PEN- 199

Query: 192 QELAYVQHDVLKNTTAQ--YRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
                   +++K +     Y APE++   R      K+DIW+ GV +Y +     P++  
Sbjct: 200 --------ELMKTSCGSPCYAAPELVVTARPYEA-RKADIWSCGVIMYAMLAGYLPWDDD 250

Query: 250 GE---AAILHSRYQYPA-----FPIYTDKL-KNLIRATLMEDPSKRPNICQLL 293
            E      +   Y+Y       FP Y   + ++L+RA L+ DP KR  I Q L
Sbjct: 251 PENPDGDDIGKLYRYITRTPLKFPDYIAPVPRDLLRAILVADPKKRITIAQTL 303

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 87/186 (46%), Gaps = 28/186 (15%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +    +  +TE E   I  Q V G+  +H     ++HRDIK ENV++ +KG  K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            I DFGS              AYV+    DV   T   Y APE+L  + Y G P     DI
Sbjct: 1301 IIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLSGEPYEGKP----QDI 1342

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WALG+ LY + +   PF    E  IL    ++ +    T+    LI+  L+     RP I
Sbjct: 1343 WALGILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAI 1400

Query: 290  CQLLEE 295
             ++ ++
Sbjct: 1401 DEIFDD 1406

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 16/194 (8%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG   D +       L E ++  I    ++G+  +H  +   IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VL++  G  K+ DFG V   +R                   T  + APE++        N
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFV---------GTPYWMAPEIIS-NSSHGYN 198

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS---RYQYPAFPIYTDKLKNLIRATLME 281
           EK+DIW+LG+ +Y+L     P+ K     ++ +   +        ++D  K  I A L++
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACLIK 258

Query: 282 DPSKRPNICQLLEE 295
           DP +RP   +LL++
Sbjct: 259 DPDERPTATELLQQ 272

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 116/259 (44%), Gaps = 36/259 (13%)

Query: 51   QTACLKRVIVPD-----KAGLNTLRAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAY 103
            +   +K++ VP      +  LNT+ A    +  LK+  H  +V Y+      +      Y
Sbjct: 1159 EMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLNIVQYLGFEMKHNI-----Y 1213

Query: 104  EVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
             +FL  EY  GG +   +  R+  R  +K I ++ +Q ++G+S +H+    ++HRD+K +
Sbjct: 1214 SLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLHS--QGILHRDMKAD 1267

Query: 164  NVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPI 223
            N+L+   G  KI DFG             E  Y   ++    T  + APEM+D  +G   
Sbjct: 1268 NLLLDQDGICKISDFGI--------SKKSEDIYSNSEMTMRGTVFWMAPEMVDTKQGY-- 1317

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLME-- 281
            N K DIW+LG  + ++     P+        ++   Q  + P   +  K+LI  T     
Sbjct: 1318 NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFL 1377

Query: 282  ------DPSKRPNICQLLE 294
                  DP +RP   QLLE
Sbjct: 1378 NQCFHIDPKERPTAGQLLE 1396

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 115/232 (49%), Gaps = 39/232 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     +L G  +++++MEY +GG L D +   +   LT
Sbjct: 372 INEILVMKGSKHSNIVNFIDSY-----LLKG--DLWVVMEYMEGGSLTDVVTHCI---LT 421

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +N+L+S  G+ K+ DFG  C        
Sbjct: 422 EGQIGAVCRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG-FC-------- 470

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 471 ----AQINEVNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 523

Query: 247 --EKGGEAAILHSRYQYPAFPI---YTDKLKNLIRATLMEDPSKRPNICQLL 293
             E    A  L +    P        +D LK  +   L  DP  R N  +LL
Sbjct: 524 LNETPLRALYLIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 96/206 (46%), Gaps = 31/206 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ ++   +LTE E +    Q ++GV   H+    + H
Sbjct: 228 VWENKNELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICH 283

Query: 158 RDIKIENVLISAKGEF-KICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K +  KI DFG                 V + +LK +     Y +PE 
Sbjct: 284 RDLKPENLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEI 331

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L    + RYQ P +   +
Sbjct: 332 VMGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LS 385

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLE 294
              K+LI   L+ +P  R    Q+LE
Sbjct: 386 KDAKDLISRILLVNPKARLTTEQILE 411

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 98/207 (47%), Gaps = 33/207 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY +GG L D++ ++   +L E E ++   Q VQ V+  H     + H
Sbjct: 142 VWENKSELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICH 197

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA---QYRAPE 213
           RD+K EN+L+  K    KI DFG               A    D L  T+     Y +PE
Sbjct: 198 RDLKPENLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASPE 244

Query: 214 ML--DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIY 267
           ++    Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P +   
Sbjct: 245 IVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--L 298

Query: 268 TDKLKNLIRATLMEDPSKRPNICQLLE 294
           + + K+LI   L+ DP++R  I Q+L+
Sbjct: 299 SVEAKDLISRILVVDPNRRITIDQILQ 325

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 121/231 (52%), Gaps = 31/231 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     VL G  +++++MEY +GG L D +   +   LT
Sbjct: 666 INEILVMKGSKHQNIVNFIDSY-----VLKG--DLWVVMEYMEGGSLTDVVTHCI---LT 715

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +N+L+S  GE K+ DFG  C+ I     
Sbjct: 716 EAQIGAVCRETLRGLQFLHS--KGVIHRDIKSDNILLSMNGEIKLTDFG-FCAQI----- 767

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EK 248
             E+   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 768 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 821

Query: 249 GGEAAILHSRYQYPAF---PIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              A  L +    P      + + +LK+ +   L  +P  R +  +LL ++
Sbjct: 822 PLRALYLIATNGTPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 129/287 (44%), Gaps = 46/287 (16%)

Query: 14  LLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEV 73
           L  VG++  KI+K +  G F ++Y     P +     +  CLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE-K 132
              ++  + +    YI        V+    +V++ +EYC G  L D + +  +  L E  
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECG 135

Query: 133 EILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQ 192
           E+   +S  V    +MH      +HRD+K+EN+L+   G  K+ DFG    + R      
Sbjct: 136 ELFAQISGAVYYAHSMHC-----VHRDLKLENILLDRNGNAKLTDFG----FTRECMTKT 186

Query: 193 ELAYVQHDVLKNTTAQYRAPEMLD--LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGG 250
            L  V        T  Y APE+++   Y G  I    DIW+LGV LY L     PF+   
Sbjct: 187 TLETV------CGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDD 236

Query: 251 EA----AILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
           E      I++   +Y +  I  D  K+LI   L ++P +RP++ Q+L
Sbjct: 237 EVKTKWKIVNEEPKYDSKFI-PDDAKDLISRLLAKNPGERPSLPQVL 282

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 99/207 (47%), Gaps = 35/207 (16%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E+FL++EY  GG L D++ +R   RL EKE ++   Q ++G +  H     + H
Sbjct: 125 VWENKLELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICH 180

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQ--HDVLKNTTA--QYRAP 212
           RD+K EN+L+  K +  KI DFG              +A +Q  + +L+ +     Y +P
Sbjct: 181 RDLKPENLLLDKKNKRIKIADFG--------------MAALQTSNKLLETSCGSPHYASP 226

Query: 213 E--MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPI 266
           E  M   Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P    
Sbjct: 227 EIVMGKNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS-- 280

Query: 267 YTDKLKNLIRATLMEDPSKRPNICQLL 293
            +   ++LI   L+ DP KR +I ++L
Sbjct: 281 VSSGAQDLISRILVVDPDKRISINEIL 307

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 111/227 (48%), Gaps = 26/227 (11%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E +A++ + N++ +V    +    S++       + L+EYC  G  +  M  +    L E
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDESSL-------YFLLEYCPNGDFLSLM--KKYGSLNE 277

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
                  +Q +  +  +H     +IHRDIK EN+L+  + + K+ DFG+         N 
Sbjct: 278 TVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNK 335

Query: 192 QELAYVQHDVLKNTTAQYRAPEML-DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGG 250
            +L       +   TA+Y APE+L D +    ++ + D+WA G  LY++     PF+   
Sbjct: 336 FDLLTRSKSFV--GTAEYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATN 389

Query: 251 E----AAILHSRYQYPA-FPIYTDKLKNLIRATLMEDPSKRPNICQL 292
           E      ++  +Y + A FP+    +++L++  L++D ++RP+I Q+
Sbjct: 390 EYLTFQKVMKVQYAFTAGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 118/228 (51%), Gaps = 31/228 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     +L G  +++++MEY +GG L D +   L   LT
Sbjct: 693 INEIIVMKESKHENIVNFIDSY-----LLKG--DLWVIMEYMEGGSLTDVVTHCL---LT 742

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E ++  +  +T+ G+  +H+    +IHRDIK +N+L+S +G+ K+ DFG  C+ I     
Sbjct: 743 EAQVGAVCRETLSGLQFLHS--KGVIHRDIKSDNILLSMRGDIKLTDFG-FCAQI----- 794

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EK 248
             EL   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 795 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 848

Query: 249 GGEAAILHSRYQYPAF---PIYTDKLKNLIRATLMEDPSKRPNICQLL 293
              A  L +    P+       +D L N +   L  +P +R +   LL
Sbjct: 849 PLRALYLIATNGTPSLKEPEALSDALNNFLGWCLKVNPDERASAKDLL 896

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 97/205 (47%), Gaps = 31/205 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ +R   +L E+E ++   Q +QGV+  HA    + H
Sbjct: 167 VWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICH 222

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA---QYRAPE 213
           RD+K EN+L+  K +  KI DFG     +              D L +T+     Y +PE
Sbjct: 223 RDLKPENLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCGSPHYASPE 269

Query: 214 --MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTD-- 269
             M   Y G P    +D+W+ G+ L+ L     PF       +L  + Q   + + +D  
Sbjct: 270 IVMGKSYHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGVYHMPSDLS 324

Query: 270 -KLKNLIRATLMEDPSKRPNICQLL 293
              K+LI   L+ DP KR    ++L
Sbjct: 325 PDAKDLISKILVVDPDKRLTTTEIL 349

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 113/234 (48%), Gaps = 39/234 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           V+ + ++K ++H  +V++IDS+  R        +++++MEY +GG L D +   +   LT
Sbjct: 741 VNEILVMKGSKHNNIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +N+L+S  G+ K+ DFG  C        
Sbjct: 791 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG-FC-------- 839

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 840 ----AQINEVNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

Query: 247 --EKGGEAAILHSRYQYPAFPI---YTDKLKNLIRATLMEDPSKRPNICQLLEE 295
             E    A  L +    P        + K+   +   LM DP  R     LLE+
Sbjct: 893 LNETPLRALYLIATNGTPKLKDPGNLSHKMAMFLNWCLMVDPEDRGTAADLLED 946

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 119/229 (51%), Gaps = 30/229 (13%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MK  K+ R++V++IDS+     +L G  +++++MEY +GG L D +   +   LTE
Sbjct: 700 EIMVMKGSKH-RNIVNFIDSY-----LLKG--DLWVVMEYMEGGSLTDVVTHCI---LTE 748

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            +I  +  +T+ G+  +H+    +IHRDIK +N+L+S  GE K+ DFG  C+ I      
Sbjct: 749 GQIGAVCRETLAGLQFLHSK--GVIHRDIKSDNILLSMTGEIKLTDFG-FCAQIN----- 800

Query: 192 QELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EKG 249
            E+   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 801 -EINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 854

Query: 250 GEAAILHSRYQYPAFPI---YTDKLKNLIRATLMEDPSKRPNICQLLEE 295
             A  L +    P         ++L+N +   L  +P +R +  QLL++
Sbjct: 855 LRALYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKD 903

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 92/187 (49%), Gaps = 28/187 (14%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +   L+  +TE E   I  Q + G+  +H  +  ++HRDIK ENV++ +KG  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            + DFGS              AYV+    DV   T   Y APE+L  + Y G P     DI
Sbjct: 1127 LIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDI 1168

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WA+G+ LY + +   PF    E  I+    ++      +++  NLI+  L ++  KRP I
Sbjct: 1169 WAVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTI 1226

Query: 290  CQLLEEI 296
              + +++
Sbjct: 1227 QDIYDDV 1233

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 33/218 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ ++   +L E+E ++   Q V+GVS  H+    + H
Sbjct: 182 VWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICH 237

Query: 158 RDIKIENVLISAKG-EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K    KI DFG     +     P +L       LK +     Y +PE 
Sbjct: 238 RDLKPENLLLDKKNRRIKIADFGMAALEL-----PNKL-------LKTSCGSPHYASPEI 285

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P+    +
Sbjct: 286 VMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN--LS 339

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEE--ISRIQGIPC 304
            + ++LI   L+ DP KR    ++L+   I +   +P 
Sbjct: 340 SEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPV 377

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 93/191 (48%), Gaps = 22/191 (11%)

Query: 106  FLLMEYCKGGGLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
            ++ +E     G ID  +   L+  +TE E   I  Q V G+  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 165  VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML--DLYRGLP 222
            V++ + G  K+ DFGS  +Y +    P E+           T  Y APE+L  + Y+G P
Sbjct: 935  VIVDSNGFVKLIDFGS-AAYTKT--GPFEVFV--------GTIDYAAPEILGGNPYKGKP 983

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMED 282
                 DIWALGV LY L Y   PF    E  IL  + ++      T    +LIR  L + 
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 283  PSKRPNICQLL 293
             + RP+I +++
Sbjct: 1038 VNDRPSIDEIV 1048

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 86/183 (46%), Gaps = 28/183 (15%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +   ++  +TE E + I  Q   G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            I DFGS              AYV+    DV   T   Y APE+L  + Y G P     DI
Sbjct: 1103 IVDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDI 1144

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WA+GV LY + Y   PF    E  IL +  +  +    +D    LIR  L    SKRP+I
Sbjct: 1145 WAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSI 1202

Query: 290  CQL 292
             ++
Sbjct: 1203 DEI 1205

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 132/300 (44%), Gaps = 53/300 (17%)

Query: 9   YPPGTLLTVGSHYCKIIKYLTSGGFAQIY------TTEISPINPYNNSQTACLKRVIVPD 62
           +PP T +   S    I + +  G F  +Y      T E+  +   N  +T     V+  +
Sbjct: 23  HPPDTAVEKPSQLYDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDVLAQE 82

Query: 63  KAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMN 122
              L+ LRA             V +Y  ++    ++       +++ME+C GG   D + 
Sbjct: 83  IYFLSELRAPF-----------VTTYYKTYVEDVSM-------WIVMEFCGGGSCADLLK 124

Query: 123 TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVC 182
              ++RL E ++  I+ + + G+  +H+ +   IHRD+K  N+L++ +GE K+ DFG   
Sbjct: 125 HLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFGV-- 180

Query: 183 SYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYY 242
                  + Q +A ++ +     T  + APE++    G   +EK+DIW+LG+   +L   
Sbjct: 181 -------SGQIMATLKRNTFVG-TPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTG 230

Query: 243 TTPFEKGGEAAILHSRYQYPAFPI---------YTDKLKNLIRATLMEDPSKRPNICQLL 293
             P+ K     +L +       P+         +T   ++ I   L +DP+ RP    LL
Sbjct: 231 QPPYAKYDPMKVLMN------IPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 27/196 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ ++   +L+EKE ++   Q +QGVS  H+    + H
Sbjct: 204 VWENKSELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICH 259

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPE--M 214
           RD+K EN+L+  K +  KI DFG     +     P +L           +  Y +PE  M
Sbjct: 260 RDLKPENLLLDKKNKSIKIADFGMAALEL-----PNKLLQTSCG-----SPHYASPEIVM 309

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYTDK 270
              Y G P    SD+W+ G+ L+ L     PF       +L      +++ P+    + +
Sbjct: 310 GKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPE 363

Query: 271 LKNLIRATLMEDPSKR 286
            ++LI   L+ DPSKR
Sbjct: 364 AQDLISRILVIDPSKR 379

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 115/234 (49%), Gaps = 39/234 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+  R        +++++MEY +GG L D +   +   LT
Sbjct: 710 INEILVMKASKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +NVL+S  GE K+ DFG  C        
Sbjct: 760 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFG-FC-------- 808

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 809 ----AQINEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

Query: 247 --EKGGEAAILHSRYQYPAFP---IYTDKLKNLIRATLMEDPSKRPNICQLLEE 295
             E    A  L +    P        +D LK+ +   L  +P +R    QLL +
Sbjct: 862 LNETPLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 132/323 (40%), Gaps = 61/323 (18%)

Query: 23  KIIKYLTSGGFAQIYTTEISP-----INPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMK 77
           +I + L  GG + +Y  ++S       N     +   LK++I P    ++    E++  K
Sbjct: 31  RIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMREIENYK 90

Query: 78  LLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR--LTEKEIL 135
             ++  +V+  IDS   +     G+  +++++ Y   G L D +N RL     ++E E +
Sbjct: 91  RFQS-PYVIKSIDSQVMQEK--DGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAECV 147

Query: 136 NILSQTVQGVSAMH--------------------------------------------AL 151
            I+    +G+  +H                                            A 
Sbjct: 148 RIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNSAG 207

Query: 152 QPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRA 211
             A  HRDI   N+L S+ G   I D GS         N  +L+ +Q  V  N T  Y  
Sbjct: 208 SIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPYTP 267

Query: 212 PEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRYQYPAF 264
           PE+L+L     ++ K DIW+LG   Y L +  +PFE+  +        AI   +Y +P  
Sbjct: 268 PELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRN 327

Query: 265 PIYTDKLKNLIRATLMEDPSKRP 287
             +++ L ++I+  +  DP +RP
Sbjct: 328 SRFSEGLLSVIKKCIQVDPIQRP 350

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 99/176 (56%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K +RH  +V++IDS+     VL G  +++++MEY +GG L D +   +   LT
Sbjct: 665 INEILVMKGSRHPNIVNFIDSY-----VLKG--DLWVIMEYMEGGSLTDVVTHCI---LT 714

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG  C+ I     
Sbjct: 715 EGQIGAVCRETLSGLKFLHSK--GVLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 766

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
             EL   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 767 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 816

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 119/259 (45%), Gaps = 38/259 (14%)

Query: 51   QTACLKRVIVPDKAGLN--TLRAEVDAMKL----LKNNRH--VVSYIDSHAARSTVLAGA 102
            +   +K+V VP K GL   T+   VDA++L    LK+  H  +V Y+   A       G 
Sbjct: 1164 EMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTLKDLDHLNIVQYLGFEAKN-----GI 1217

Query: 103  YEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKI 162
            Y +FL  EY  GG +   +  R+  R  +  I ++  Q +QG+S +H+    ++HRD+K 
Sbjct: 1218 YSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQGLSYLHSR--GILHRDMKA 1271

Query: 163  ENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLP 222
            +N+L+   G  KI DFG         R   ++ Y   ++    T  + APEM+D  +G  
Sbjct: 1272 DNLLLDQDGVCKISDFG-------ISRKSNDI-YSNSEMTMKGTVFWMAPEMVDTKQGY- 1322

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPA--------FPIYTDKLKNL 274
             + K DIW+LG  + ++     P+      A +    Q  +         P+ ++  K  
Sbjct: 1323 -SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEF 1381

Query: 275  IRATLMEDPSKRPNICQLL 293
            +      DP KRP   +LL
Sbjct: 1382 LDCCFEIDPEKRPTADKLL 1400

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 117/230 (50%), Gaps = 31/230 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           V+ + ++K +RH  +V++IDS+      L G   ++++MEY KGG L D +   +   LT
Sbjct: 608 VNEILVMKASRHENIVNFIDSY-----FLNG--NLWVIMEYMKGGSLTDVVTHCI---LT 657

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E++I  +  +T+ G+  +H+    +IHRDIK +NVL+S  G+ K+ DFG  C+ I     
Sbjct: 658 EQQISTVTRETLNGLRFLHS--KGVIHRDIKSDNVLLSLSGDIKLTDFG-FCAQI----- 709

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EK 248
             E+   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 710 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 763

Query: 249 GGEAAILHSRYQYPAFP---IYTDKLKNLIRATLMEDPSKRPNICQLLEE 295
              A  L +    P        ++ LK  +   L  DP +R +  +LL +
Sbjct: 764 PLRALYLIATNGTPELKDPDSLSECLKAFLDWCLKVDPHERASATELLND 813

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 100/193 (51%), Gaps = 16/193 (8%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG   + +    +++LTE +   I+S+ + G+  +H+ +   IHRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDYLHSQRK--IHRDIKSAN 148

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           +L++  G  K+ DFG          + Q +   + D    T   + APE++D  +    N
Sbjct: 149 ILLTDNGHVKLGDFGV---------SGQMMVTRKRDTFVGTPF-WMAPEVIDRNKK-GYN 197

Query: 225 EKSDIWALGVFLYKLCYYTTPFEK--GGEAAILHSRYQYPAFPI-YTDKLKNLIRATLME 281
           E +DIW+LG+ + +L     P +K    +A +   +   P     ++   K+ +   L++
Sbjct: 198 EMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHAKDFVAQCLIK 257

Query: 282 DPSKRPNICQLLE 294
           DPS+RP   +LL+
Sbjct: 258 DPSQRPTASELLK 270

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 129/291 (44%), Gaps = 30/291 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A L    +  +     L
Sbjct: 71  PPSLIKTRGRDYHRG-HFLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKL 126

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K+ ++VV +ID     + V       ++L+E C  G L+D +  R    L
Sbjct: 127 LSEIQIHKSMKH-QNVVQFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KLL 176

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q    +  MH+ +  +IHRD+K+ N+        KI DFG          
Sbjct: 177 TEPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA---- 230

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L + +    + + DIW++GV LY L     PF+  
Sbjct: 231 NDRERKYTV-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSK 284

Query: 250 GEAAILH----SRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
               I        + +P     +++ K LI+  L  DP +RP+I ++++ +
Sbjct: 285 DVNTIYERIKCCDFSFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 116/230 (50%), Gaps = 31/230 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+  R        +++++MEY +GG L D +   +   LT
Sbjct: 709 INEILVMKASKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 758

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +N+L+S  GE K+ DFG  C+ I     
Sbjct: 759 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMTGEIKLTDFG-FCAQI----- 810

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EK 248
             E+   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 811 -NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 864

Query: 249 GGEAAILHSRYQYPAFP---IYTDKLKNLIRATLMEDPSKRPNICQLLEE 295
              A  L +    P        +D LK  +   L  DP +R    +LL +
Sbjct: 865 PLRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 103/207 (49%), Gaps = 29/207 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  + + RL E     + +Q V GV+ MH+    L+H
Sbjct: 117 VLQNSKYIGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGVNYMHS--KGLVH 172

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+       I DFG V  +++            +D++K +     Y APE++
Sbjct: 173 RDLKLENLLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPELV 221

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFE------KGGEAAILH---SRYQYPAFPI 266
              +      K+DIW+ G+ LY +     P++      +G + A L+   +R     FP 
Sbjct: 222 ISTKPYEA-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSL-KFPE 279

Query: 267 YTDKL-KNLIRATLMEDPSKRPNICQL 292
           Y   + ++L+R  L+ DP KR NI Q+
Sbjct: 280 YISPIPRDLLRRLLVSDPRKRLNIRQI 306

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 99/203 (48%), Gaps = 27/203 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  + + RL E     + +Q + GV+ MH+    L+H
Sbjct: 121 VLQNSKYIGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LVH 176

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+       I DFG V  ++  P N         + +K +     Y APE++
Sbjct: 177 RDLKLENLLLDKNENLVITDFGFVNEFL--PDN---------EYMKTSCGSPCYAAPELV 225

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGG---EAAILHSRYQYPA-----FPIY 267
              R   +  K+D+W+ G+ LY +     P++      E   +   YQY       FP Y
Sbjct: 226 ISTRPY-VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEY 284

Query: 268 TDKL-KNLIRATLMEDPSKRPNI 289
              + ++L+R  L+ DP+KR N+
Sbjct: 285 ITPIPRDLLRKILVPDPNKRVNM 307

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 102/203 (50%), Gaps = 27/203 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V+     V++++EYC G  L + +    + RL+ +E   + SQ    V   H L+   +H
Sbjct: 96  VIVTESRVWMVLEYCSGHELYEHL--LKEQRLSLEESKKLFSQIASAVYYAHELK--CVH 151

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELA-YVQHDVLKNTTAQYRAPEMLD 216
           RD+K+ENVL+   G  K+ DFG            +E+A   Q + +  TT  Y APE+++
Sbjct: 152 RDLKLENVLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTV-YMAPELIE 200

Query: 217 --LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE----AAILHSRYQYPAFPIYTDK 270
              Y G  +    DIW+LG+ LY +     PF++  +      I++    +    I  D 
Sbjct: 201 RKCYDGFKV----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDA 256

Query: 271 LKNLIRATLMEDPSKRPNICQLL 293
           + +LI+  L ++P++R ++ Q+L
Sbjct: 257 I-DLIQGMLRKNPNERISLAQVL 278

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 118/260 (45%), Gaps = 38/260 (14%)

Query: 51   QTACLKRVIVPD--------KAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGA 102
            +   +K+V VP         K  +  L++EV  +K L ++ ++V Y+ S      +    
Sbjct: 1175 EMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DHLNIVQYLGSE-----IRGNI 1228

Query: 103  YEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKI 162
            Y +FL  EY  GG +   +  RL  R  EK I ++ +Q + G+  +H+    ++HRD+K 
Sbjct: 1229 YSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLHS--KGILHRDMKA 1282

Query: 163  ENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLP 222
            +N+L+   G  KI DFG      +  +N     Y   D+    T  + APEM+D  +G  
Sbjct: 1283 DNLLLDEDGICKISDFG----ISKKSKN----IYSNSDMTMRGTVFWMAPEMVDTKQGY- 1333

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEK-GGEAAILHSRYQYPAFPIYTD-------KLKNL 274
             + K DIW+LG  + ++     P+      AA+        A PI  D       K K+ 
Sbjct: 1334 -SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPDDTIQLISSKGKDF 1392

Query: 275  IRATLMEDPSKRPNICQLLE 294
            +      DP KRP    LLE
Sbjct: 1393 LSKCFEIDPEKRPTADDLLE 1412

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 99/206 (48%), Gaps = 31/206 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ ++   +L E+E ++   Q V+GVS  H+    + H
Sbjct: 182 VWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICH 237

Query: 158 RDIKIENVLISAKG-EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K    KI DFG     +     P +L       LK +     Y +PE 
Sbjct: 238 RDLKPENLLLDKKNRRIKIADFGMAALEL-----PNKL-------LKTSCGSPHYASPEI 285

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P     +
Sbjct: 286 VMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LS 339

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLE 294
            + ++LI   L+ DP+KR    ++L+
Sbjct: 340 AEARDLISKILVIDPAKRITTQEILK 365

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 117/229 (51%), Gaps = 31/229 (13%)

Query: 73   VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
            ++ + ++K ++H  +V++IDS+     +L G  +++++MEY +GG L D +   +   LT
Sbjct: 1070 INEIIVMKESKHKNIVNFIDSY-----LLKG--DLWVVMEYMEGGSLTDVVTHCI---LT 1119

Query: 131  EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
            E +I  +  +T+ G+  +H+    +IHRDIK +N+L+S +G+ K+ DFG  C+ I     
Sbjct: 1120 EGQIGAVCRETLNGLKFLHS--KGVIHRDIKSDNILLSMQGDIKLTDFG-FCAQI----- 1171

Query: 191  PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EK 248
              E+   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 1172 -NEVHLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 1225

Query: 249  GGEAAILHSRYQYPAF---PIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
               A  L +    P        +  L N + A L  DP  R    +LLE
Sbjct: 1226 PLRALYLIATNGTPELKEPEKLSSILHNFLDACLKVDPEVRATATELLE 1274

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 119/256 (46%), Gaps = 38/256 (14%)

Query: 54   CLKRVIVPDKAGLN--------TLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEV 105
             +K+V VP  +  N         LR+EV  +K L ++ ++V Y+      S      Y +
Sbjct: 1208 AVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYLGFENKNSI-----YSL 1261

Query: 106  FLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENV 165
            FL  EY  GG +   +  R+  R  E  I ++ +Q ++G++ +H+    ++HRD+K +N+
Sbjct: 1262 FL--EYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHS--KGILHRDMKADNL 1315

Query: 166  LISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINE 225
            L+   G  KI DFG         R  +++ Y   D+    T  + APEM+D  +G   + 
Sbjct: 1316 LLDQDGICKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SA 1365

Query: 226  KSDIWALGVFLYKLCYYTTPFEK-GGEAAILHSRYQYPAFPIYTDKL-------KNLIRA 277
            K DIW+LG  + ++     P+      AA+        A PI  D L       ++ + A
Sbjct: 1366 KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLITRVGRSFLDA 1425

Query: 278  TLMEDPSKRPNICQLL 293
                DP KRP   +LL
Sbjct: 1426 CFEIDPEKRPTATKLL 1441

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 131/294 (44%), Gaps = 36/294 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 68  PPSLIKTRGRDYHRG-HFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKL 123

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
            +E+   ++ K+ RH  +V +ID     + V       ++L+E C  G L+D +  R   
Sbjct: 124 LSEI---QIHKSMRHFNIVQFIDCFEDDTNV-------YILLEICPNGSLMDLLKRR--K 171

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q V  V  MH+ +  +IHRD+K+ N+        KI DFG        
Sbjct: 172 VLTEPEVRFFTTQIVGAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA-- 227

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N +E  Y         T  Y APE+L   +    + + DIW+ GV +Y L     PF+
Sbjct: 228 --NDRERKYTV-----CGTPNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ 279

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              E  I++ R     Y +P     + +   LIR  L  DP +RP++ ++++ +
Sbjct: 280 -AKEVNIIYERIKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 90/186 (48%), Gaps = 28/186 (15%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +    ++ +TE E   I  Q V G+  +H     ++HRD+K ENV++ AKG  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            + DFGS              AYV     DV   T   Y APE+L  + Y G P     DI
Sbjct: 1257 LIDFGSA-------------AYVNSGPFDVFVGTI-DYAAPEVLSGEPYLGKP----QDI 1298

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WA+G+ LY + +   PF    E  IL +  +       +    +LI+  L ++P+KRP I
Sbjct: 1299 WAIGILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTI 1356

Query: 290  CQLLEE 295
             +++ +
Sbjct: 1357 DEIVND 1362

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 118/231 (51%), Gaps = 31/231 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K +RH  +V++IDS+     +L G  +++++MEY +GG L D +   +   LT
Sbjct: 654 INEILVMKGSRHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G+  +H+    ++HRDIK +N+L+S  G+ K+ DFG  C+ I     
Sbjct: 704 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSISGDIKLTDFG-FCAQI----- 755

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EK 248
             E+   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 756 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 809

Query: 249 GGEAAILHSRYQYPAFPI---YTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              A  L +    P        +  L+N +   L  DP +R +   LL ++
Sbjct: 810 PLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPEQRASATDLLNDV 860

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 88/183 (48%), Gaps = 28/183 (15%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G +D  +   L+  +TE E   I  Q V G+  +H     ++HRDIK ENV++ + G  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVK 1112

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            I DFGS              AYV+    DV   T   Y APE+L  + Y G P     DI
Sbjct: 1113 IIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDI 1154

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WA+GV LY + +   PF    E  IL +  +  +    +D+   LIR  L    SKRP+I
Sbjct: 1155 WAIGVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSI 1212

Query: 290  CQL 292
             ++
Sbjct: 1213 SKI 1215

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 135/286 (47%), Gaps = 46/286 (16%)

Query: 20  HYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLL 79
            Y  + K +  G    +YT      N   +++   +K++ +  +     +  E+  MK  
Sbjct: 516 QYANLTK-IGQGASGGVYTA-----NQVKSNELVAIKQMDLEKQPKKELILNEIIVMKES 569

Query: 80  KNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILS 139
           ++N +VV++I++H ++  +       +++MEY +GG L D +   L   L+E +I  +  
Sbjct: 570 RHN-NVVNFINAHLSKGNL-------WIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCR 618

Query: 140 QTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQH 199
           +T++G+  +H+    +IHRDIK +NVL+S KG+ K+ DFG  C+ I             +
Sbjct: 619 ETLEGLKFLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI-------------N 662

Query: 200 DVLKNTTAQ-----YRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF--EKGGEA 252
           D+  N T       + APE++      P   K DIW+LG+ + ++     P+  E   +A
Sbjct: 663 DIDLNRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNEAPLKA 719

Query: 253 AILHSRYQYPAFPI---YTDKLKNLIRATLMEDPSKRPNICQLLEE 295
             L +    P        +D   N +   L  +P +R +  +LL +
Sbjct: 720 LYLIATNGTPKLKEPENLSDVFSNFLDRCLRVEPEERASAIELLAD 765

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 96/194 (49%), Gaps = 20/194 (10%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG L   +      ++ EK I  I+ + +  +  +H  +  +IHRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAAN 142

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           VLI+ +G+ K+CDFG      +     Q +A          T  + APE+  +  G+  +
Sbjct: 143 VLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYD 191

Query: 225 EKSDIWALGVFLYKLCYYTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLM 280
            K DIW+LG+  Y++     P+   +   A  L  + + P      YT +LK  I   L 
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLD 251

Query: 281 EDPSKRPNICQLLE 294
           EDP +R +  +LL+
Sbjct: 252 EDPQERLSAEELLK 265

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 126/267 (47%), Gaps = 33/267 (12%)

Query: 31  GGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYID 90
           G +  +Y      IN + + Q   +K ++  +   LN + AE+ ++    NN ++V Y  
Sbjct: 34  GSYGVVY----KAINKHTD-QVVAIKEIVYENDEELNDIMAEI-SLLKNLNNNNIVKY-- 85

Query: 91  SHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHA 150
            H      +  +YE+++L+EYC  G L   + +R    L+E E    ++QT+ G+  +H 
Sbjct: 86  -HG----FIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYVTQTLWGLKYLHG 139

Query: 151 LQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+SA    K+ DFG     +    N   L           T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWM 185

Query: 211 APEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFP--IYT 268
           APE+L   RG   +  SDIW+LG  + +L     P+    +A I ++      +P   ++
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYHNLTDANIYYAVENDTYYPPTAFS 242

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLEE 295
           + LK+ +    +++  KRP   QLL+ 
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLKH 269

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 112/237 (47%), Gaps = 27/237 (11%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D+  +  ++ E+  +  LK   ++  Y  S+   +++       +++MEYC GG L   +
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSL-------WIIMEYCGGGSLRSLL 123

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
                 ++ EK I  I+ + +  +  +H  +  +IHRDIK  NVLI+  G  K+CDFG  
Sbjct: 124 R---PGKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVA 178

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
               +     Q +A          T  + APE+  +  G+  + K+DIW+ G+  Y++  
Sbjct: 179 AQLNQTKSRRQTMA---------GTPYWMAPEV--IMEGVYYDTKADIWSTGITAYEVTT 227

Query: 242 YTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKRPNICQLLE 294
              P+   +   A  L ++ + P      Y+  +K  I   L EDPS+RP   +LL+
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK 284

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 99/176 (56%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     VL G  +++++MEY +GG L D +   +   LT
Sbjct: 642 INEILVMKGSKHPNIVNFIDSY-----VLKG--DLWVIMEYMEGGSLTDVVTHCI---LT 691

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG  C+ I     
Sbjct: 692 EGQIGAVCRETLSGLKFLHSK--GVLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 743

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
             EL   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 744 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 793

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 99/200 (49%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG   D +     N L E+++  I+ +   G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEM----LDLYRG 220
           +L++ +G  K+ DFG V  +IR        + ++ D     T  + APE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS-------RYQYPAFPIYTDKLKN 273
              NEK+DIW+LG+  Y+L     P  K     ++ +       + Q P    ++D  K+
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKD 247

Query: 274 LIRATLMEDPSKRPNICQLL 293
            +   L++ P+ RP+   LL
Sbjct: 248 FVAGCLVKTPADRPSAYNLL 267

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 114/236 (48%), Gaps = 32/236 (13%)

Query: 66  LNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRL 125
           L  L  E+  +  LK+  ++++YI      +T+L  A  ++++MEYC GG   D +    
Sbjct: 62  LEVLAQEIFFLAELKSP-YIINYI------TTLLEDA-SMWIVMEYCGGGSCSDLLKYYF 113

Query: 126 QNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI 185
            N L EK++  I  + ++G+  +H  +   IHRDIK  N+L++ +G  K+ DFG      
Sbjct: 114 NNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFGVSGQLK 171

Query: 186 RPPRNPQELAYVQHDVLKNTTAQYRAPEM----LDLYRGLPINEKSDIWALGVFLYKLCY 241
              R    +           T  + APE+    ++ Y     +EK DIW+LG+ +++L  
Sbjct: 172 STLRRGTIVG----------TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLK 216

Query: 242 YTTPFEKGGEAAILH--SRYQYPAFP-IYTDKLKNLIRATLMEDPSKRPNICQLLE 294
              P  K     +L   SR   P     Y+D  K+ +   L+++P++RP    LL+
Sbjct: 217 GVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 131/294 (44%), Gaps = 36/294 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +       ++ +    K V         T 
Sbjct: 71  PPSLIKTRGKDYHRG-HFLGEGGFARCFQIKD------DSGEIFAAKTVAKASIKSEKTR 123

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
           +  +  +++ K+  H  +V +ID     S V       ++L+E C  G L++ +  R   
Sbjct: 124 KKLLSEIQIHKSMSHPNIVQFIDCFEDDSNV-------YILLEICPNGSLMELLKRR--K 174

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q    +  MH+ +  +IHRD+K+ N+   +    KI DFG        
Sbjct: 175 VLTEPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA-- 230

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N  E  Y         T  Y APE+L + +    + + DIW+LGV LY L     PF+
Sbjct: 231 --NESERKYTI-----CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ 282

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              +   ++ R     + +P     +D+ K LIR  L  DP +RP++ ++++ +
Sbjct: 283 -ARDVNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 106/221 (47%), Gaps = 34/221 (15%)

Query: 85  VVSYIDSHA---ARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQT 141
           V+  + SHA   A   V     E++L++EY  GG L D++ ++   +L E+E ++   Q 
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQI 223

Query: 142 VQGVSAMHALQPALIHRDIKIENVLISAKG-EFKICDFGSVCSYIRPPRNPQELAYVQHD 200
           V+GVS  H+    + HRD+K EN+L+  K  + KI DFG     +     P +L      
Sbjct: 224 VEGVSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFGMAALEL-----PNKL------ 270

Query: 201 VLKNT--TAQYRAPE--MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL- 255
            LK +  +  Y +PE  M   Y G P    SD+W+ G+ L+ L     PF       +L 
Sbjct: 271 -LKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293
                +YQ P     + + ++LI   L+ +P KR    ++L
Sbjct: 326 KVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEIL 364

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 89/349 (25%), Positives = 151/349 (43%), Gaps = 42/349 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +       ++ +    K V         T 
Sbjct: 71  PPSLIKTRGKDYHRG-HFLGEGGFARCFQIKD------DSGEIFAAKTVAKASIKSEKTR 123

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
           +  +  +++ K+  H  +V +ID     S V       ++L+E C  G L++ +  R   
Sbjct: 124 KKLLSEIQIHKSMSHPNIVQFIDCFEDDSNV-------YILLEICPNGSLMELLKRR--K 174

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q    +  MH+ +  +IHRD+K+ N+   +    KI DFG        
Sbjct: 175 VLTEPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA-- 230

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N  E  Y         T  Y APE+L + +    + + DIW+LGV LY L     PF+
Sbjct: 231 --NESERKYTI-----CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ 282

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGI 302
              +   ++ R     + +P     +D+ K LIR  L  DP +RP++ ++++ +      
Sbjct: 283 -ARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTF 341

Query: 303 PCPINNFYLSRTINV-----QASLMNPIITPTQQTALKHSQSSATISDQ 346
           P  I +  +S   N      + SL+N      +++ L  S SS  I  Q
Sbjct: 342 PPSIPSTVMSEAPNFEDIPEEQSLVN-FKDCMEKSLLLESMSSDKIQRQ 389

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 95/194 (48%), Gaps = 20/194 (10%)

Query: 104 EVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
           +++++MEYC GG L     T L+    +++ L ++ + +  V+ ++  +  +IHRDIK  
Sbjct: 94  KLWVIMEYCAGGSL----RTLLRPGKIDEKYLGVIVRNLL-VALLYIHKDNVIHRDIKAA 148

Query: 164 NVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPI 223
           NVLI+  G  K+CDFG            Q +A          T  + APE+  +  G+  
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEV--IMEGVYY 197

Query: 224 NEKSDIWALGVFLYKLCYYTTPF--EKGGEAAILHSRYQYPAFPI--YTDKLKNLIRATL 279
           N K+DIW+LG+  Y++     P+   +   A  L ++ + P      Y+  LK  I   L
Sbjct: 198 NTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCL 257

Query: 280 MEDPSKRPNICQLL 293
            EDP  RP   +LL
Sbjct: 258 DEDPEARPTAEELL 271

>KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa]
           {ON} Anc_3.60 YNL298W
          Length = 829

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 118/246 (47%), Gaps = 40/246 (16%)

Query: 21  YCKIIKYLTSGGFAQIYTTE--ISPINPYNNSQTACLKR---VIVPDKAGLNTL------ 69
           Y K+I+    G    +Y  E   SP + Y N     ++      + DK  +  +      
Sbjct: 530 YFKMIEKAGQGASGSVYLAERLESPPSEYQNDHVVSIENNEPQAIGDKVAIKQMILSKQP 589

Query: 70  RAE--VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM---- 121
           R E  V+ + ++KN+RH  +V++++++      L    +++++ME+ +GG L D +    
Sbjct: 590 RKELIVNEILVMKNSRHKNIVNFLEAY------LKTEDDLWVVMEFMEGGSLTDIIENSP 643

Query: 122 -NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180
            N    + LTE +I  I+ +T QG+  +H     +IHRDIK +NVL+  +   KI DFG 
Sbjct: 644 TNGSNHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRARVKITDFG- 700

Query: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240
            C+ +   R+ +             T  + APE++   +    +EK D+W+LG+   ++ 
Sbjct: 701 FCAKLTDKRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEML 749

Query: 241 YYTTPF 246
               P+
Sbjct: 750 EGEPPY 755

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 99/198 (50%), Gaps = 28/198 (14%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++ME+C GG   D +    ++RL+E ++  I+ + + G+  +H+ +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           +L++  GE K+ DFG          + Q +A ++       T  + APE++   +    N
Sbjct: 168 ILLTDDGEVKLGDFGV---------SGQIMATLKRTTFVG-TPYWMAPEII-AKKDNGYN 216

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPI---------YTDKLKNLI 275
           EK+DIW+LG+   +L     P+ K     +L +       P+         +T   ++ I
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVN------IPLRKPPKLQGRFTGSARDFI 270

Query: 276 RATLMEDPSKRPNICQLL 293
              L++DP  RP+  +LL
Sbjct: 271 ALCLIKDPDLRPSAAELL 288

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/340 (22%), Positives = 149/340 (43%), Gaps = 68/340 (20%)

Query: 25  IKYLTSGGF-------AQIYTTEISPINPYNNSQTACLKRVIVP--DKAGLNTLRAEVDA 75
           +K LTSG         + + T+ ++ I+ Y+      +++++ P  D   ++    E+D 
Sbjct: 51  VKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPTDMVVRQIMCPFGDIESVSNALKEIDN 110

Query: 76  MKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN--RLTEKE 133
            +  K+  +++  +DS   +     G+  V +L+ Y   G L D ++  L +  R++E E
Sbjct: 111 YRYFKS-PYIMQCLDSQVIQRR--DGSKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESE 167

Query: 134 ILNILSQTVQGVSAMH----------ALQP---------------ALI------------ 156
           ++ ++  T +G+  +H          ++ P               A++            
Sbjct: 168 VIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLS 227

Query: 157 ----------HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTT 206
                     H +IK  N+L S+ G   I + GS+        N + L  ++    ++ T
Sbjct: 228 SHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCT 287

Query: 207 AQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRY 259
             Y  PE+L+L  G  ++   DIW+LG  LY L +  +PF++  +         I  +RY
Sbjct: 288 VYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARY 347

Query: 260 QYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299
            +P   +Y+ KL ++I   L  +P+ RP + +LL ++  I
Sbjct: 348 SFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQLQDI 387

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 98/213 (46%), Gaps = 40/213 (18%)

Query: 97  TVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALI 156
           T L     ++++MEYC GG   D +     N + EK++  I SQ ++G+  +H  +   I
Sbjct: 78  TTLTEDVSMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH--EQKKI 135

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML- 215
           HRDIK  N+L++ +G  K+ DFG V   IR                   T  + APE++ 
Sbjct: 136 HRDIKAANILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYWMAPEVVS 185

Query: 216 ---DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAI-----------LHSRYQY 261
              D Y     +EK+DIW+LG+ +Y+L     P  K     +           LH  Y +
Sbjct: 186 KENDGY-----DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSH 240

Query: 262 PAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
            A        KN + + L+++P  R +  +++E
Sbjct: 241 SA--------KNFVSSCLVKNPVGRASAYEMVE 265

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 100/202 (49%), Gaps = 23/202 (11%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V+     V++ +EYC G  L D++   L+ R+   E   + +Q V  V   H+LQ   +H
Sbjct: 96  VIVTETRVWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVH 151

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML-- 215
           RD+K+EN+L+   G   + DFG    + R      +L  V        T  Y APE++  
Sbjct: 152 RDLKLENILLDKNGYAMLTDFG----FTRECATKTQLETV------CGTTVYMAPELIKR 201

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAI-LHSRYQYPA-FPIYTD-KLK 272
           + Y G  +    D W+LG+ LY + +   PF++       L   ++ PA    YT  + K
Sbjct: 202 EAYDGYKV----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAK 257

Query: 273 NLIRATLMEDPSKRPNICQLLE 294
           +LI   L ++ ++RPN+ ++L+
Sbjct: 258 DLIVRLLDKNAAQRPNLNEVLQ 279

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 137/308 (44%), Gaps = 32/308 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 66  PPSLIKTRGRDYHRG-HFLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKL 121

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K+  ++V +ID     + V       ++L+E C  G L+D +  R    L
Sbjct: 122 LSEIQIHKSMKHP-NIVQFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KVL 171

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q V  +  MH  +  +IHRD+K+ N+   +    KI DFG          
Sbjct: 172 TEPEVRYFTTQIVGAIKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---- 225

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L   +    + + DIW++GV +Y L     PF+  
Sbjct: 226 NDRERKYTV-----CGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-A 278

Query: 250 GEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGIPC 304
            E  I++ R     Y +P     + ++  LI+  L  DP +RP++ ++++ +      P 
Sbjct: 279 KEVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPA 338

Query: 305 PINNFYLS 312
            IN   L+
Sbjct: 339 RINGDVLT 346

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 117/240 (48%), Gaps = 35/240 (14%)

Query: 21  YCKIIKYLTSGGFAQIYTTEISPINPYNNSQTA---------CLKRVIVPDKAGLNTLRA 71
           + ++++    G    +Y  E   + PY +   A          +K++I+  +     +  
Sbjct: 587 FFRMVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKELIVN 646

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM-----NTRLQ 126
           E+  MK  K+N ++V++++++      L    +++++MEY +GG L D +      +  Q
Sbjct: 647 EILVMKDSKHN-NIVNFLEAY------LKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQ 699

Query: 127 NRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIR 186
           + LTE +I  I+ +T QG+  +H     +IHRDIK +NVL+  +G  KI DFG  C+ + 
Sbjct: 700 SPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRGRVKITDFG-FCAKLT 756

Query: 187 PPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
             R+ +             T  + APE++   +    +EK D+W+LG+   ++     P+
Sbjct: 757 DKRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPY 805

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 87/187 (46%), Gaps = 28/187 (14%)

Query: 115  GGLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEF 173
             G ID  +    +  +TE E   I  Q   G+  +H+L   ++HRDIK ENV+I +KG  
Sbjct: 1130 SGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSL--GIVHRDIKDENVIIDSKGYV 1187

Query: 174  KICDFGSVCSYIRPPRNPQELAYVQH---DVLKNTTAQYRAPEML--DLYRGLPINEKSD 228
            KI DFGS              AYV++   DV   T   Y APE+L  + Y G P     D
Sbjct: 1188 KIIDFGSA-------------AYVKNGPFDVFVGTI-DYAAPEVLAGNPYEGKP----QD 1229

Query: 229  IWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPN 288
            IWALG+ LY + +   PF    E  I+     +            LI+  L++   KRP+
Sbjct: 1230 IWALGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPD 1287

Query: 289  ICQLLEE 295
            I ++  +
Sbjct: 1288 INEVFSD 1294

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 140/326 (42%), Gaps = 67/326 (20%)

Query: 23  KIIKYLTSGGFAQIYTTEI---SPI--NPYNNSQTACLKRVIVPDKAGLNTLRAEVDAMK 77
           KI + L  GG + +Y  ++   S I  N     +   LK++I P    ++    E++  K
Sbjct: 31  KIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNGMREIENYK 90

Query: 78  LLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR--LTEKEIL 135
             ++  +V+  IDS   +     G+  +++++ Y   G L D +N RL     ++E E +
Sbjct: 91  RFQS-PYVIQSIDSQVTQEK--NGSKIIYIILPYYSLGSLQDSINRRLLEGTFISEAECV 147

Query: 136 NILSQTVQGVSAMH--------------------------------------------AL 151
            I+    +G+  +H                                            A 
Sbjct: 148 RIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEMDVLSSGSAG 207

Query: 152 QPALIHRDIKIENVLISAKGEFKICDFGSVCSY--IR-PPRNPQELAYVQHDVLKNTTAQ 208
             A  HRDI   N+L S++G   I D GS CS   IR   RN  +L+ +Q  V  N T  
Sbjct: 208 SIAYAHRDITPSNILYSSEGLPVIADLGS-CSQADIRIGSRN--QLSELQEWVNDNCTLP 264

Query: 209 YRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEA-------AILHSRYQY 261
           Y APE+L+L     ++ K DIW++G   Y L +  +PFE+  +        AI   +Y +
Sbjct: 265 YTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAINTGKYSF 324

Query: 262 PAFPIYTDKLKNLIRATLMEDPSKRP 287
           P    +++ L N+I+  +  DP +RP
Sbjct: 325 PRNSRFSEALLNVIKKCIQVDPIQRP 350

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 109/233 (46%), Gaps = 38/233 (16%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D    +S +       ++++EY + G L + +  R    L E
Sbjct: 89  EIIIMKLL-NHTNVLRLYDVWETKSNL-------YMVLEYVEKGELFNLLVER--GPLPE 138

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E +    Q + G+S  HAL   ++HRD+K EN+L+  K   KI DFG            
Sbjct: 139 NEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMA---------- 186

Query: 192 QELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTTPFE 247
              A    D L  T+     Y APE++    GLP +  +SD+W+ GV LY L     PF+
Sbjct: 187 ---ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 240

Query: 248 K--GGEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
           +  G   ++L       Y+ P     + + ++LI   L  DP +R    ++L+
Sbjct: 241 EDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 96/200 (48%), Gaps = 20/200 (10%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG +   +      ++ EK I  I+ + +  +  +H  +  +IHRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIH--KDNVIHRDIKAAN 168

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           +LI+ +G  K+CDFG      +     Q +A          T  + APE+  +  G+  +
Sbjct: 169 LLITNEGNVKLCDFGVAAQLNQNTMRRQTMA---------GTPYWMAPEV--IMEGISYD 217

Query: 225 EKSDIWALGVFLYKLCYYTTPF-EKGGEAAILHSRYQYPA---FPIYTDKLKNLIRATLM 280
            K+DIW++G+  Y++     PF E     A+       PA      +   LK  I   L 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLD 277

Query: 281 EDPSKRPNICQLLEEISRIQ 300
           EDP +RP   +LL E + I+
Sbjct: 278 EDPQERPTADKLLHESAFIK 297

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 87/187 (46%), Gaps = 32/187 (17%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +    +  +TE E   I  Q V G+  +H     ++HRDIK ENV++ +KG  K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYRGLPINEKSDI 229
            I DFGS              AYV+    DV   T   Y APE+L  + Y G P     DI
Sbjct: 1272 IIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLSGEPYEGKP----QDI 1313

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WA+G+ LY + +   PF    E  IL    ++      ++    LI+  L+    KRP  
Sbjct: 1314 WAIGILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRP-- 1369

Query: 290  CQLLEEI 296
              L+EEI
Sbjct: 1370 --LIEEI 1374

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 128/292 (43%), Gaps = 32/292 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +         +     A L    +  +     L
Sbjct: 72  PPSLIKTRGRDYHRG-HFLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKL 127

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +KN  ++V +ID     + V       ++L+E C  G L+D +  R    L
Sbjct: 128 LSEIQIHKSMKN-VNIVQFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KSL 177

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q    +  MH+ +  +IHRD+K+ N+        KI DFG          
Sbjct: 178 TEPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLA---- 231

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L + +    + + DIW++GV LY L     PF+  
Sbjct: 232 NDRERKYTV-----CGTPNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-S 284

Query: 250 GEAAILHSRYQYPAFPIYTDKL-----KNLIRATLMEDPSKRPNICQLLEEI 296
            +   ++ R +   F    DK      K LI+  L  DP +RP++ ++++ +
Sbjct: 285 KDVNTIYERIKCCDFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 129/291 (44%), Gaps = 30/291 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +  ++L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 131 PPSLIKTRGRDYRRG-QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKL 186

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K+ +++V ++D              V++L+  C  G L++ +  R    L
Sbjct: 187 LSEIQIHKSMKH-QNIVQFVD-------CFEDHINVYILLGMCPNGSLMELLKKR--KIL 236

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+     Q    +  MH+ +  +IHRD+K+ N+        KI DFG          
Sbjct: 237 TEPEVRFFTVQICGAIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLA---- 290

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L L +    + + DIW++GV ++ L     PF+  
Sbjct: 291 NDRERKYTVCG-----TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAK 344

Query: 250 GEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
               I     +S Y +P     + + K LI+  L+ DP  RP+I +++E +
Sbjct: 345 DVNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 112/237 (47%), Gaps = 33/237 (13%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR 128
           L  E++A+K+L +   V            VL  +  + +++EY  GG    ++  + + R
Sbjct: 123 LYREINALKMLTHPNIV--------KLEEVLQNSKYIGIVLEYASGGEFYKYI--KFKKR 172

Query: 129 LTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPP 188
           L E +   I +Q + GVS +H+    L+HRD+K+EN+L+   G   I DFG V    +  
Sbjct: 173 LKESKACTIFAQLISGVSYIHS--KGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTKTN 230

Query: 189 RNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN-EKSDIWALGVFLYKLCYYTTPFE 247
           +       + H    +    Y APE++      P N  K+DIW+ GV LY +     P++
Sbjct: 231 K-------LMHTPCGSPC--YAAPELVTSVE--PYNARKADIWSCGVILYAMLAGYLPWD 279

Query: 248 ---KGGEAAILHSRYQY-----PAFPIYTDKL-KNLIRATLMEDPSKRPNICQLLEE 295
              K      +   Y+Y       FP Y + + ++L+R  L  DP+KR ++  +L+ 
Sbjct: 280 DDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPAKRMSMKHILQH 336

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 94/194 (48%), Gaps = 20/194 (10%)

Query: 104 EVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
           +++++MEYC GG L   +      ++ EK +  I+ + +  +  +H  +  +IHRDIK  
Sbjct: 96  KLWVIMEYCAGGSLRTLLRP---GKIDEKYLGVIVRKLLIALVYIH--KDNVIHRDIKAA 150

Query: 164 NVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPI 223
           NVLI+ +G  K+CDFG            Q +A          T  + APE+  +  G+  
Sbjct: 151 NVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---------GTPYWMAPEV--IMEGVYY 199

Query: 224 NEKSDIWALGVFLYKLCYYTTPF--EKGGEAAILHSRYQYPAFPI--YTDKLKNLIRATL 279
           N K+DIW+LG+  Y++     P+   +   A  L ++ + P      Y+  LK  I   L
Sbjct: 200 NTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCL 259

Query: 280 MEDPSKRPNICQLL 293
            EDP +RP    LL
Sbjct: 260 DEDPEERPTAEDLL 273

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 99/176 (56%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     VL G  +++++MEY +GG L D +   +   LT
Sbjct: 663 INEILVMKGSKHPNIVNFIDSY-----VLKG--DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG  C+ I     
Sbjct: 713 EGQIGAVCRETLSGLEFLHS--KGVLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 764

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
             EL   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 765 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 131/294 (44%), Gaps = 36/294 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +       ++ +    K V         T 
Sbjct: 71  PPSLIKTRGKDYHRG-HFLGEGGFARCFQIKD------DSGEIFAAKTVAKASIKSEKTR 123

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
           +  +  +++ K+  H  +V ++D     S V       ++L+E C  G L++ +  R   
Sbjct: 124 KKLLSEIQIHKSMAHPNIVQFVDCFEDDSNV-------YILLEICPNGSLMELLKRR--K 174

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q    +  MH+ +  +IHRD+K+ N+   +    KI DFG        
Sbjct: 175 VLTEPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA-- 230

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N  E  Y         T  Y APE+L + +    + + DIW+LGV LY L     PF+
Sbjct: 231 --NESERKYTI-----CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ 282

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              +   ++ R     + +P     +D+ K LIR  L  DP +RP++ ++++ +
Sbjct: 283 -ARDVNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 108/230 (46%), Gaps = 27/230 (11%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR 128
           +R E+  +  LK   ++  Y  S+   +       +++++MEYC GG L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPP 188
           + EK I  I+ + +  + ++H  +  +IHRDIK  N+LI+  G  K+CDFG      +  
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSM 166

Query: 189 RNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF-- 246
              Q +A          T  + APE+  +  G+  + K DIW+LG+  Y++     P+  
Sbjct: 167 LKRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCH 215

Query: 247 EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKRPNICQLLE 294
            +   A  + ++ + P      Y+  LK  I   L EDP +RP   +L +
Sbjct: 216 MEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFK 265

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 99/209 (47%), Gaps = 27/209 (12%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  + + RL E    N+ SQ V GV  MH     L+H
Sbjct: 145 VLQNSKYIGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHC--KGLVH 200

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+   G   I DFG V  + +             +++K +     Y APE++
Sbjct: 201 RDLKLENLLLDKYGNLIITDFGFVNEFSK-----------FSELMKTSCGSPCYAAPELV 249

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFE---KGGEAAILHSRYQYPA-----FPIY 267
              R      K+DIW+ G+ L+ +     P++   K  +   +   Y+Y       FP Y
Sbjct: 250 ISTRPYEA-RKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFPEY 308

Query: 268 TDKL-KNLIRATLMEDPSKRPNICQLLEE 295
              + ++L+R  L+  P KR  + Q+L+ 
Sbjct: 309 ISPMARDLLRNILIPYPQKRATLKQILKH 337

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 134/294 (45%), Gaps = 36/294 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 80  PPSLIKTRGRDYHRG-HFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKL 135

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
            +E+   ++ K+ RH  VV +ID     + V       ++L+E C  G L++ +  R   
Sbjct: 136 LSEI---QIHKSMRHFNVVQFIDCFEDDTNV-------YILLEICPNGSLMELLKKR--R 183

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            +TE E+   ++Q    +  MH+ +  +IHRD+K+ N+        KI DFG        
Sbjct: 184 TVTEPEVRYFMTQICGAIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA-- 239

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N +E  Y         T  Y APE+L + +    + + DIW++GV +Y L     PF+
Sbjct: 240 --NDRERKYTV-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ 291

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              +  +++ R     + +P     +++ K LI   L  DP +RP+I ++++ +
Sbjct: 292 -SKDVNMIYERIKNRDFAFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 109/236 (46%), Gaps = 38/236 (16%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D       V     +++L++EY + G L + +  R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFD-------VWETNSDLYLVLEYAEKGELFNMLVER--GP 125

Query: 129 LTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPP 188
           L E E +    Q + G+S  H+L   ++HRD+K EN+L+  K   KI DFG         
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMA------- 176

Query: 189 RNPQELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTT 244
                 A    D L  T+     Y APE++    GLP     SD+W+ GV L+ L     
Sbjct: 177 ------ALESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRL 227

Query: 245 PF-EKGGEAAILHSRYQYPAFPI-----YTDKLKNLIRATLMEDPSKRPNICQLLE 294
           PF E+ G    L  + Q   F +      T + ++L+   L  DPSKR  I ++L+
Sbjct: 228 PFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 95/197 (48%), Gaps = 30/197 (15%)

Query: 106 FLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENV 165
           ++L EY  GG L+D++       L E    N   Q +  +  +HA    ++HRD+KIEN+
Sbjct: 203 YMLFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHA--NNIVHRDLKIENI 258

Query: 166 LISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEMLDLYRGLP- 222
           +IS+ G  KI DFG    Y +  +            LK       + APE+L   R  P 
Sbjct: 259 MISSNGNIKIIDFGLSNLYDKSKK------------LKTYCGSLYFAAPELL---RANPY 303

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQ-----YPAFPIYTDKLKNLIRA 277
           I  + D+W+ GV LY L     PF+    + +LH + +     YP F   + ++ +L+  
Sbjct: 304 IGPEIDVWSFGVVLYVLVCGKVPFDDEN-SNVLHEKIKQGRVFYPQF--LSIEVISLLST 360

Query: 278 TLMEDPSKRPNICQLLE 294
            L+ DP KR  + Q+++
Sbjct: 361 MLVVDPFKRATLDQVMK 377

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 112/230 (48%), Gaps = 33/230 (14%)

Query: 106 FLLMEYCKGGGLIDFM--NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
           ++L EY  GG L+D++  +  L+ R   K    I S     +  +H     ++HRD+KIE
Sbjct: 179 YMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIAS----ALQYLHMNN--IVHRDLKIE 232

Query: 164 NVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPI 223
           N++IS  GE KI DFG    Y     +P++  +     L      + APE+L  +    I
Sbjct: 233 NIMISTSGEIKIIDFGLSNMY-----DPKKQLHTFCGSL-----YFAAPELLKAHPY--I 280

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKGGEAAILH-----SRYQYPAFPIYTDKLKNLIRAT 278
             + D+W+ GV LY L     PF+    A++LH      + +YP     + ++ +L+   
Sbjct: 281 GPEVDVWSFGVVLYVLVCGKVPFDDEN-ASVLHEKIKQGKVEYPQH--LSIEVISLLSKM 337

Query: 279 LMEDPSKRPNICQLL--EEISRIQGIPCPINNFYLSRTINVQASLMNPII 326
           L+ DPSKR  + Q++  + + R    P P    YL   + +  + ++P++
Sbjct: 338 LVVDPSKRATLKQVVSHQWMQRGYDFPAP---SYLPYRVPLTVAGLDPVV 384

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 86/342 (25%), Positives = 152/342 (44%), Gaps = 48/342 (14%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A L   I  +K    T 
Sbjct: 79  PPSLIKTRGRDYHRG-HFLGEGGFARCFQMKDDKGKVFAAKTVAKLS--IKSEK----TR 131

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
           R  +  +++ K+ +H  +V + D     + V       ++L+E C  G +++ +  R + 
Sbjct: 132 RKLLSEIQIHKSMKHPNIVQFTDCFEDDTNV-------YILLEICPNGSVMELL--RQRK 182

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+   + Q +  +  MH+ +  +IHRD+K+ N+    +   KI DFG        
Sbjct: 183 HLTEPEVRFCMIQIIGAIRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA-- 238

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N +E  Y         T  Y APE+L   +    + + DIW++GV LY L +   PF+
Sbjct: 239 --NDKERKYTI-----CGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQ 290

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI------ 296
              E   ++ R     + +PA    +   KNLI   L  +P+ RP++ ++ + +      
Sbjct: 291 -AKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTF 349

Query: 297 -SRI-QGIPCPINNF----YLSRTINVQASLMNPIITPTQQT 332
            SR+   I   I NF    +    IN++  ++N  +  + QT
Sbjct: 350 PSRLPSTITKEIPNFDHLSFSESLINLKQCMLNSGLLKSSQT 391

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 99/206 (48%), Gaps = 27/206 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  +   RL E     + +Q + GV  MH+    L+H
Sbjct: 116 VLQNSKYIGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHS--KGLVH 171

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+       I DFG V  +             +++++K +     Y APE++
Sbjct: 172 RDLKLENLLLDKNENLLITDFGFVNEFNH-----------KNELMKTSCGSPCYAAPELV 220

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE-------AAILHSRYQYP-AFPIY 267
              +      K+DIW+ GV +Y +     P++   E       A + H   + P  FP Y
Sbjct: 221 VTTKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEY 279

Query: 268 TDKL-KNLIRATLMEDPSKRPNICQL 292
            + + ++L+R  L+ +P KR N+ Q+
Sbjct: 280 INPVPRDLLRRILVSNPKKRLNLRQV 305

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 131/292 (44%), Gaps = 32/292 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 84  PPSLIKTRGRDY-RREHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKL 139

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +K++ ++V +ID     + V       ++L+E C  G L+D +  R    L
Sbjct: 140 LSEIQIHKSMKHS-NIVQFIDCFEDDANV-------YILLEICPNGSLMDLLKKR--KSL 189

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q    +  +H+ +  +IHRD+K+ N+        K+ DFG          
Sbjct: 190 TEPEVRFFTTQICGAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA---- 243

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L + +    + + DIW++GV +Y L     PF+  
Sbjct: 244 NDRERKYTV-----CGTPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQ-A 296

Query: 250 GEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
            +  +++ R     Y YP     + + + LI   L  +P +RP I  +++++
Sbjct: 297 KDVNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 101/193 (52%), Gaps = 16/193 (8%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG   + +    ++++TE++   I+S+ + G+  +H+ +   IHRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHSQRK--IHRDIKSAN 148

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           +L++  G  K+ DFG          + Q +   + D    T   + APE++D  +    N
Sbjct: 149 ILLTDNGHVKLGDFGV---------SGQMMVTRKRDTFVGTPF-WMAPEVIDRNKQ-GYN 197

Query: 225 EKSDIWALGVFLYKLCYYTTPFEK--GGEAAILHSRYQYPAFPI-YTDKLKNLIRATLME 281
           E +DIW+LG+ + +L     P +K    +A +   +   P     ++   ++ +   L++
Sbjct: 198 EMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIK 257

Query: 282 DPSKRPNICQLLE 294
           DPS+RP   +LL+
Sbjct: 258 DPSQRPTAAELLK 270

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 99/176 (56%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K ++H  +V++IDS+     VL G  +++++MEY +GG L D +   +   LT
Sbjct: 704 INEILVMKGSKHPNIVNFIDSY-----VLKG--DLWVIMEYMEGGSLTDVVTHCI---LT 753

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG  C+ I     
Sbjct: 754 EGQIGAVCRETLSGLKFLHS--KGVLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 805

Query: 191 PQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
             EL   +  ++   T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 806 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 855

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 111/232 (47%), Gaps = 41/232 (17%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E++A+KLL  + ++V   +       VL  +  + +++E+  GG    ++  + + RL E
Sbjct: 103 EINALKLL-THPNIVRLEE-------VLQNSKYIGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
                + +Q + GV+ MH+    L+HRD+K+EN+L+       I DFG V  +       
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFVNEF------- 203

Query: 192 QELAYVQHDVLKNTTAQ--YRAPEML---DLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               +  ++++K +     Y APE++   + YR      K DIW+ G+ LY +     P+
Sbjct: 204 ----FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 247 EKGGE---AAILHSRYQYPA-----FPIYTDKL-KNLIRATLMEDPSKRPNI 289
           +   +      +   YQY       FP Y   L ++LIR  L  +PS+R +I
Sbjct: 256 DDDSQNPNGDDIGKLYQYITKTALKFPAYISPLARDLIRKILTANPSRRISI 307

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 120/259 (46%), Gaps = 38/259 (14%)

Query: 51   QTACLKRVIVPDKAGLN--------TLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGA 102
            +   +K+V VP  +  N         LR+EV  +K L ++ ++V Y+      +      
Sbjct: 1199 EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYLGFENKNNI----- 1252

Query: 103  YEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKI 162
            Y +FL  EY  GG +   +  R+  R  E  I ++ +Q ++G++ +H+    ++HRD+K 
Sbjct: 1253 YSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHS--KGILHRDMKA 1306

Query: 163  ENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLP 222
            +N+L+   G  KI DFG         R  +++ Y   D+    T  + APEM+D  +G  
Sbjct: 1307 DNLLLDQDGICKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY- 1357

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEK-GGEAAILHSRYQYPAFPIYTDKL-------KNL 274
             + K DIW+LG  + ++     P+      AA+        A PI  D L       +N 
Sbjct: 1358 -SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNF 1416

Query: 275  IRATLMEDPSKRPNICQLL 293
            + A    +P KRP   +LL
Sbjct: 1417 LDACFEINPEKRPTANELL 1435

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 131/292 (44%), Gaps = 32/292 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +    + +     A   +  +  +     L
Sbjct: 71  PPSLIKTRGKDYHRG-HFLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKL 126

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K + +  ++V +ID     S V       ++L+E C  G L++ +  R    L
Sbjct: 127 LSEIQIHKSMAHP-NIVQFIDCFEDDSNV-------YILLEICPNGSLMELLKRR--KVL 176

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           +E E+    +Q    +  MH+ +  +IHRD+K+ N+   +    KI DFG          
Sbjct: 177 SEPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---- 230

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N  E  Y         T  Y APE+L + +    + + DIW+LGV LY L     PF+  
Sbjct: 231 NESERKYTI-----CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-A 283

Query: 250 GEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
            +   ++ R     + +P     +D+ K LIR  L  DP +RP++ ++++ +
Sbjct: 284 RDVNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 130/292 (44%), Gaps = 32/292 (10%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A   ++ +  +     L
Sbjct: 68  PPSLIKTRGRDYHRG-HFLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKL 123

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRL 129
            +E+   K +++  ++V ++D     + V       ++L+E C  G L+D +  R    L
Sbjct: 124 LSEIQIHKSMRHT-NIVQFVDCFEDDTNV-------YILLEICPNGSLMDLLKRR--KML 173

Query: 130 TEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPR 189
           TE E+    +Q V  V  MH+ +  +IHRD+K+ N+        K+ DFG          
Sbjct: 174 TEPEVRFFTTQIVGAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA---- 227

Query: 190 NPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
           N +E  Y         T  Y APE+L   +    + + DIW+ GV +Y L     PF+  
Sbjct: 228 NDRERKYTV-----CGTPNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-A 280

Query: 250 GEAAILHSRYQYPAFPIYTDKLKN-----LIRATLMEDPSKRPNICQLLEEI 296
            E  I++ R +   F    DK  +     LI+  L  DP +RP++ ++++ +
Sbjct: 281 KEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 95/180 (52%), Gaps = 34/180 (18%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K +RH  +V++IDS+  +        +++++MEY +GG L D +   +   LT
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T+ G++ +H+    +IHRDIK +N+L+S  G+ K+ DFG  C        
Sbjct: 771 EGQIGTVCKETLGGLAFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG-FC-------- 819

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 820 ----AQINEVHLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 129/293 (44%), Gaps = 40/293 (13%)

Query: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTLRA 71
           G  L +GS     + Y +S G  Q     IS     N++  A    ++ PD       R 
Sbjct: 23  GETLGLGSTGKVQLAYNSSTG-QQAAIKVISKAVFNNDNANASDSALLTPDSLPYGIER- 80

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D       V      +++++EY + G L + +  R    L E
Sbjct: 81  EIIIMKLL-NHPNVLRLYD-------VWETDSNLYMVLEYAEKGELFNLLVER--GPLPE 130

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E +    Q + G+S  HAL   ++HRD+K EN+L+  K   KI DFG            
Sbjct: 131 NEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA---------- 178

Query: 192 QELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTTPF- 246
              A    D L  T+     Y APE++    GLP +  ++D+W+ G+ L+ L     PF 
Sbjct: 179 ---ALETEDKLLETSCGSPHYAAPEIIS---GLPYHGLETDVWSCGIILFALLTGRLPFD 232

Query: 247 -EKGGEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
            E G    +L      +++ P     + + ++LI   L  DP KR    ++L+
Sbjct: 233 EEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 89/196 (45%), Gaps = 28/196 (14%)

Query: 106  FLLMEYCKGGGLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
            +L  E     G ID  +   L+  +TE E   +  Q   G+  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 165  VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEML--DLYR 219
            V++  KG  K+ DFGS              AYV+    DV   T   Y APE+L  + Y 
Sbjct: 1109 VIVDNKGFVKLIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLGGEPYE 1154

Query: 220  GLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATL 279
            G P     DIWA+GV LY + Y   PF    E  IL    +  +    + +   LIR  L
Sbjct: 1155 GKP----QDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKIL 1208

Query: 280  MEDPSKRPNICQLLEE 295
                SKRP I  ++E+
Sbjct: 1209 NRSVSKRPTIDDIMED 1224

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 82/181 (45%), Gaps = 25/181 (13%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +   L+  +TE E   +  Q   GV  +H     ++HRDIK ENV++  KG  K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML--DLYRGLPINEKSDIWAL 232
            + DFGS     R P           DV   T   Y APE+L  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 233  GVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRP---NI 289
            GV LY + Y   PF    E  IL    +     I +++   LI   L    SKRP   +I
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

Query: 290  C 290
            C
Sbjct: 1318 C 1318

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 115/242 (47%), Gaps = 37/242 (15%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D   +  ++ E+  + LL+   ++  Y  S+           +++++MEYC GG + + +
Sbjct: 42  DINEIQDIQNEIKFLSLLRYAPNITYYYHSYLINR-------KIWIIMEYCNGGSVRNLI 94

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFG-- 179
                 R  E  I  IL + +  +  +H     +IHRDIK  N+LI+  G  K+CDFG  
Sbjct: 95  KI---GRFNEIYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIA 149

Query: 180 SVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML---DLYRGLPINEKSDIWALGVFL 236
           +   + +P R  Q +A          T  + APE++    LY     + K+DIW++G+  
Sbjct: 150 AKLEFSKPKR--QTMA---------GTPYWMAPEVIIESSLY-----DTKADIWSVGITA 193

Query: 237 YKLCYYTTPFEK--GGEAAILHSRYQYPAF--PIYTDKLKNLIRATLMEDPSKRPNICQL 292
           Y++     P+ +    +A  L ++ + P     +Y+  LK  I   L EDPS+R    +L
Sbjct: 194 YEITTGNPPYCEYDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKL 253

Query: 293 LE 294
           LE
Sbjct: 254 LE 255

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 88/186 (47%), Gaps = 26/186 (13%)

Query: 116  GLIDFMNT-RLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G +D  +    ++ +TE E   I  Q V G+  +H     ++HRDIK ENV++ +KG  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEMLDLYRGLPINEKS-DIW 230
            + DFGS              AYV+    DV   T   Y APE+L    G P   KS DIW
Sbjct: 1096 LIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLG---GNPYEGKSQDIW 1138

Query: 231  ALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC 290
            A+G+ LY L Y   PF    E  IL    ++      + + K LI   L     KRP I 
Sbjct: 1139 AIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTID 1196

Query: 291  QLLEEI 296
            ++ +++
Sbjct: 1197 EICQDV 1202

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 29/205 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           ++    +V++ +EYC G  L D +      R+   E   + +Q V  V   H+L    +H
Sbjct: 100 IIVTETKVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVH 155

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDL 217
           RD+K+EN+L+   G  K+ DFG    + R       L  V        T  Y APE+++ 
Sbjct: 156 RDLKLENILLDKHGRAKLTDFG----FTRECMTRSTLETVC------GTTVYMAPELIER 205

Query: 218 --YRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQY----PAFP--IYTD 269
             Y G  I    DIWALGV LY + Y   PF++  E   + ++++     P F   I ++
Sbjct: 206 KSYDGFKI----DIWALGVILYTMIYGAMPFDEDDE---VKTKWKIVNEDPDFTNNISSN 258

Query: 270 KLKNLIRATLMEDPSKRPNICQLLE 294
            +K+LI+  L +DP++RP I ++L+
Sbjct: 259 DVKDLIKKLLKKDPTERPTIREILK 283

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 128/296 (43%), Gaps = 39/296 (13%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++ ++++  GG L+  + T  Q R  E    + + Q +  +  +H  +  ++HRD+K EN
Sbjct: 86  LYFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDALEYIHGCK--VVHRDLKPEN 141

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPIN 224
           +L+S++G+  I DFG   +           ++V        TA+Y +PE+L   +    N
Sbjct: 142 LLLSSEGKLMITDFGVASNLAATDNLSSTSSFV-------GTAEYVSPELLLQNKS---N 191

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIY--TDKLKNLIRATLMED 282
             SDIWA+G  LY+    T PF    E A            IY  +  + +L+   L+ D
Sbjct: 192 FCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKILVLD 251

Query: 283 PSKRPNICQLLEEISRIQGIPCP-----------------INNFYLSRTINVQ-----AS 320
           P  R  + Q ++  +  QGI                     NNF     +N Q      +
Sbjct: 252 PDSRYTLPQ-IKNHAWFQGIDWTNKELIWKGIWQLFGNRNHNNFNGPSMMNKQLHVIDTT 310

Query: 321 LMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSSTTTGNKPILIETEIPDMS 376
           + N  I P ++  +K +Q++++I +    + L+    S      P  +++ +P  S
Sbjct: 311 IKNIPIQPRKRKPMKVTQTTSSIVEWRKTLGLSPVSGSVGPNGLPKQMKSHVPSRS 366

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 116/232 (50%), Gaps = 32/232 (13%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E +A++ L N+R +V    +    S++       + L+EY   G  +  M  +    L+E
Sbjct: 230 EKNALQRLNNSRGIVKLFFTFQDESSL-------YFLLEYAPNGDFLSVM--KKYGSLSE 280

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
                  +Q + G+  +H+    +IHRDIK EN+L+    + KI DFG+  + I  P+N 
Sbjct: 281 DCTRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGT--AKILEPKNE 336

Query: 192 QELAYVQHDVLKNT-----TAQYRAPEML-DLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
            E    + ++L  +     TA+Y +PE+L D Y    ++ + DIWA G  ++++     P
Sbjct: 337 DE-DNPEFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPP 391

Query: 246 FEKGGE----AAILHSRYQYPA-FPIYTDKLKNLIRATLMEDPSKRPNICQL 292
           F+   E      ++  +Y + A FP+    +++L++  L++ P +R  I Q+
Sbjct: 392 FKATNEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLKVPEQRLTIPQI 440

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 96/195 (49%), Gaps = 16/195 (8%)

Query: 97  TVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALI 156
           T L     ++++MEYC GG   D +    +  L E +   I  + ++G+  +H  +   I
Sbjct: 78  TTLLEDVSIWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLH--EQKKI 135

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLD 216
           HRDIK  N+L++  G  K+ DFG V   I+        A ++ D     T  + APE++ 
Sbjct: 136 HRDIKAANILLTDDGMVKLGDFG-VSGQIK--------ATLKKDTFVG-TPYWMAPEVVK 185

Query: 217 LYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPI---YTDKLKN 273
                  NEK+DIW+LG+ +Y+L     P  K     ++ S  +  A  +   Y++  K+
Sbjct: 186 KDES-GYNEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKS 244

Query: 274 LIRATLMEDPSKRPN 288
            I   L++DP+ RPN
Sbjct: 245 FISHCLIKDPNARPN 259

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 97/200 (48%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++++MEYC GG   D +     N L E+++  I+ Q   G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEM----LDLYRG 220
           +L++ +G  K+ DFG V  +IR        +  + D     T  + APE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS-------RYQYPAFPIYTDKLKN 273
              NEK+DIW+LG+  Y+L     P  K     ++ +       + Q P    +++  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKE 247

Query: 274 LIRATLMEDPSKRPNICQLL 293
            +   L++ P+ RP+   LL
Sbjct: 248 FVAGCLVKTPADRPSAYDLL 267

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 94/181 (51%), Gaps = 27/181 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM-----NTRL 125
           V+ + ++K+++H  +V++I+S+      L    +++++MEY +GG L D +     N   
Sbjct: 649 VNEIHVMKDSKHKNIVNFIESY------LKTEDDLWVVMEYMEGGSLTDIIENSPTNGST 702

Query: 126 QNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI 185
            + LTE +I  I+ +T QG+  +H     +IHRDIK +NVL+      KI DFG  C+ +
Sbjct: 703 HSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTHARVKITDFG-FCAKL 759

Query: 186 RPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
              RN +             T  + APE++   +    +EK D+W+LG+   ++     P
Sbjct: 760 TDQRNKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMAIEMLESEPP 808

Query: 246 F 246
           +
Sbjct: 809 Y 809

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 109/233 (46%), Gaps = 38/233 (16%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MKLL++  +V+S  D     S +       ++++EY + G L + +  +    L E
Sbjct: 84  EIIIMKLLRH-ANVLSLYDVWETNSNL-------YMILEYAEKGELFNLLVEK--GPLPE 133

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
           KE +    Q + G+S  HAL   ++HRD+K EN+L+  K   KI DFG            
Sbjct: 134 KEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMA---------- 181

Query: 192 QELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTTPF- 246
              A    D L  T+     Y APE++    G+P +  +SD+W+ GV L+ L     PF 
Sbjct: 182 ---ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLPFD 235

Query: 247 EKGGEAAILHSRYQYPAFPIYTD-----KLKNLIRATLMEDPSKRPNICQLLE 294
           E+ G    L  + Q   F +  D       ++LI   L  DP+KR    ++L+
Sbjct: 236 EEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 24/204 (11%)

Query: 97  TVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALI 156
           T +     ++++MEYC GG   D +     N L E+++  I+ Q   G+  +H  +   I
Sbjct: 76  TTMLEDVSMWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--I 133

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEM-- 214
           HRDIK  N+L++ +G  K+ DFG V  ++R        + ++ D     T  + APE+  
Sbjct: 134 HRDIKAANILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWMAPEVVC 183

Query: 215 --LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS--RYQYPAFP-IYTD 269
             +D Y     NEK+DIW+LG+  Y+L     P  K     ++ +  + + P     ++D
Sbjct: 184 CEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSD 238

Query: 270 KLKNLIRATLMEDPSKRPNICQLL 293
             K  +   L++ P+ RP+   LL
Sbjct: 239 AAKEFVAGCLVKVPADRPSAYDLL 262

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (46%), Gaps = 20/196 (10%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++L MEYC GG     + TR   R+TE++     S+ V  +  +H L    I+RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLL--GFIYRDLKPEN 450

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNP--QELAYVQHDVLKN--------TTAQYRAPEM 214
           +L+   G   + DF  +       R+P  ++  Y+   V  +         T +Y APE+
Sbjct: 451 ILLHQSGHVMLSDF-DLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEV 509

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE----AAILHSRYQYPAFPIYTDK 270
           +   RG       D W LG+ +Y++ +  TPF+        + IL    ++P     +  
Sbjct: 510 I---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKH 566

Query: 271 LKNLIRATLMEDPSKR 286
            K+LI+  L ++ SKR
Sbjct: 567 CKDLIKRLLNKNESKR 582

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 109/233 (46%), Gaps = 38/233 (16%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D       V   A ++++++EY + G L + +  R    L E
Sbjct: 78  EIIIMKLL-NHPNVLRLYD-------VWETAQDLYMVLEYVEKGELFNLLVQR--GPLPE 127

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E +    Q + G+S  HAL   ++HRD+K EN+L+  K   K+ DFG            
Sbjct: 128 NEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMA---------- 175

Query: 192 QELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTTPF- 246
              A    D L  T+     Y APE++    GLP +  +SD+W+ GV LY L     PF 
Sbjct: 176 ---ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 229

Query: 247 -EKGGEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
            E G    +L      +Y+ P     + + ++LI   L  +P +R    ++L+
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 95/201 (47%), Gaps = 29/201 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           +L  +  + +++EY  GG    ++  + + RL E     + SQ V GV  MH+    L+H
Sbjct: 128 ILQNSKYIGIVLEYASGGEFYKYI--QRKRRLKEVNASRLFSQLVSGVHYMHS--KGLVH 183

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ---YRAPEM 214
           RD+K+EN+L+       I DFG V              +   +VL  T+     Y APE+
Sbjct: 184 RDLKLENLLLDKNENLMITDFGFVNE------------FSNENVLMKTSCGSPCYAAPEL 231

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE------KGGEAAILHSRYQYP--AFPI 266
           + + R   +  K DIW+ GV LY +     P++       G + + L+S        FP 
Sbjct: 232 V-VSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPD 290

Query: 267 YTDKL-KNLIRATLMEDPSKR 286
           Y + L ++L+R  L+ DP +R
Sbjct: 291 YVNPLPRDLLRRILVADPRRR 311

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 111/237 (46%), Gaps = 27/237 (11%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D+  +  ++ EV  +  +K   ++  Y  S+   +T+       ++++EYC GG L   +
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLL 117

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
                 ++ EK I  I+ + +  +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 118 R---PGKIDEKYIGIIMREVLIALKYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVA 172

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
               +     Q +A          T  + APE+  +  G+  + K DIW+LG+  Y++  
Sbjct: 173 AQLNQSSLKRQTMA---------GTPYWMAPEV--IMEGVSYDTKVDIWSLGITTYEIAT 221

Query: 242 YTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKRPNICQLLE 294
              P+   +   A  L ++ + P      Y+  LK  I   L EDP +R +   LL+
Sbjct: 222 GNPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLLK 278

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 111/234 (47%), Gaps = 35/234 (14%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E++A+K L N+ ++V   +       VL  +  + +++EY  GG    ++  +   RL E
Sbjct: 95  EINALKHL-NHPNIVRLEE-------VLQNSKYIGIVLEYASGGEFYKYIQKK--RRLKE 144

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
                + +Q + GV  MH+    L+HRD+K+EN+L+       I DFG V  ++  P N 
Sbjct: 145 GPACRLFAQLISGVYYMHS--KGLVHRDLKLENLLLDKNENLLITDFGFVNEFL--PEN- 199

Query: 192 QELAYVQHDVLKNTTAQ--YRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKG 249
                   +++K +     Y APE++   R      K+D+W+ GV LY +     P++  
Sbjct: 200 --------ELMKTSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDD 250

Query: 250 GE---AAILHSRYQYPA-----FPIYTDKL-KNLIRATLMEDPSKRPNICQLLE 294
            E      +   Y+Y       FP Y   + ++L+R  L+ DP +R  I + L+
Sbjct: 251 PENPDGDDIGKLYRYITRTPLKFPDYIAPVPRDLLREILIPDPKRRITISKTLK 304

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 24/204 (11%)

Query: 97  TVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALI 156
           T +     ++++MEYC GG   D +     N L E+++  I+ Q   G+  +H  +   I
Sbjct: 76  TTMLEDVSMWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--I 133

Query: 157 HRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEM-- 214
           HRDIK  N+L++ +G  K+ DFG V  +IR        + ++ D     T  + APE+  
Sbjct: 134 HRDIKAANILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVC 183

Query: 215 --LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHS--RYQYPAFP-IYTD 269
             +D Y     NEK+DIW+LG+  Y+L     P  K     ++ +  + + P     +++
Sbjct: 184 CEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSE 238

Query: 270 KLKNLIRATLMEDPSKRPNICQLL 293
             K  +   L++ P+ RP+   LL
Sbjct: 239 AAKEFVAGCLVKAPADRPSAYDLL 262

>CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa]
           {ON} some similarities with uniprot|Q03497 Saccharomyces
           cerevisiae YHL007c ser/thr protein kinase of the
           pheromone pathway
          Length = 867

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 97/180 (53%), Gaps = 34/180 (18%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           V+ + ++ +++H  +V+YIDS+      L+G  +++++MEY +GG L D +   +   LT
Sbjct: 610 VNEIMVMSSSKHQNIVNYIDSY------LSG-LDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  + +QG+  +H+    ++HRDIK +NVL+S  G+ K+ DFG  C        
Sbjct: 660 EGQIGAVCREVLQGLEFLHS--KGVLHRDIKSDNVLLSMNGDIKLTDFG-FC-------- 708

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A V   V+K TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 709 ----AQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 133/294 (45%), Gaps = 36/294 (12%)

Query: 10  PPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNTL 69
           PP  + T G  Y +   +L  GGFA+ +  +      +     A L   I  +K    T 
Sbjct: 90  PPSLIKTRGRDYHRG-HFLGEGGFARCFQIKDDSGKIFAAKTVAKLS--IKTEK----TR 142

Query: 70  RAEVDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQN 127
           +  +  +++ K+ RH  +V +ID     + V       ++L+E C  G L++ +  R   
Sbjct: 143 KKLLSEIQIHKSMRHANIVQFIDCFEDETNV-------YILLEICPNGSLMELLKKR--K 193

Query: 128 RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP 187
            LTE E+    +Q   G+  MH+ +  +IHRD+K+ N+        KI DFG        
Sbjct: 194 TLTEPEVRFFTTQICGGIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA-- 249

Query: 188 PRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE 247
             N +E  Y         T  Y APE+L + +    + + DIW++GV +Y L     PF+
Sbjct: 250 --NDRERKYTV-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ 301

Query: 248 KGGEAAILHSR-----YQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296
              +   ++ R     + +P     + + + L++  L  DP +RP+I ++L+ +
Sbjct: 302 -AKDVNTIYERIKCCDFVFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 103/214 (48%), Gaps = 26/214 (12%)

Query: 106 FLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENV 165
           ++L EY  GG L+D++       L E             +  +HA    ++HRD+KIEN+
Sbjct: 240 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENI 295

Query: 166 LISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLP-IN 224
           +IS  GE KI DFG   S +  PR  Q   +         +  + APE+L   +  P + 
Sbjct: 296 MISTSGEIKIIDFG--LSNMFDPRT-QLHTFC-------GSLYFAAPELL---KASPYVG 342

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQ-----YPAFPIYTDKLKNLIRATL 279
            + D+W+ GV LY L     PF+    +++LH + +     YP     + ++ +L+   L
Sbjct: 343 PEVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQH--LSIEVISLLSKML 399

Query: 280 MEDPSKRPNICQLLEEISRIQGIPCPINNFYLSR 313
           + DP KR ++ Q++E    I+G   P  ++  +R
Sbjct: 400 VVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 107/229 (46%), Gaps = 27/229 (11%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D+  +  ++ EV  +  LK   ++  Y  S+   +++       +++MEYC GG L   +
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 125

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
                 ++ EK I  I+ + +  +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 126 R---PGKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
               +     Q +A          T  + APE+  +  G+  + K DIW+LG+  Y++  
Sbjct: 181 AQLNQSTLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIAT 229

Query: 242 YTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKR 286
              P+   +   A  L ++ + P      YT  LK  I   L EDP +R
Sbjct: 230 GNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (46%), Gaps = 28/180 (15%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +    +  +TE E   +  Q V GV  +H     ++HRDIK EN+++ ++G  K
Sbjct: 1168 GSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVK 1225

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQ---HDVLKNTTAQYRAPEMLDL--YRGLPINEKSDI 229
            I DFGS              AYV+    DV   T   Y APE+L    Y G P     DI
Sbjct: 1226 IIDFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVLGGSPYEGKP----QDI 1267

Query: 230  WALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNI 289
            WA+G+ LY + +   PF    E  IL    ++ +  + +++   LI   L  +  KRP I
Sbjct: 1268 WAIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 96/180 (53%), Gaps = 34/180 (18%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLT 130
           ++ + ++K +RH  +V++IDS+     +L G  +++++MEY +GG L D +   +   LT
Sbjct: 726 INEILVMKGSRHNNIVNFIDSY-----LLKG--DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 131 EKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRN 190
           E +I  +  +T++G+  +H+    +IHRDIK +N+L+S  G  K+ DFG  C        
Sbjct: 776 EGQIAAVSRETLRGLHFLHS--KGVIHRDIKSDNILLSMDGNIKLTDFG-FC-------- 824

Query: 191 PQELAYVQHDVLKNTTA----QYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 825 ----AQINETNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 118/245 (48%), Gaps = 39/245 (15%)

Query: 21  YCKIIKYLTSGGFAQIYTTEISPINP----YNNSQTACLKRVIVPDKAGLNTL------R 70
           + K+I+    G    +Y  E   + P     NN++        + DK  +  +      R
Sbjct: 636 FFKMIEKAGQGASGSVYLAERIRLPPDPISNNNAKYTTENSSQIGDKVAIKQMILSKQPR 695

Query: 71  AE--VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQ 126
            E  V+ + +++++RH  +V++++++      L    +++++MEY +GG L D +    +
Sbjct: 696 KELIVNEILVMQDSRHKNIVNFLEAY------LKTEDDLWVVMEYMEGGSLTDIIENSPE 749

Query: 127 N-----RLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
           N      LTE +I  I+ +T QG+  +H     +IHRDIK +NVL+  +G  KI DFG  
Sbjct: 750 NVTNKSPLTEPQIAYIVRETCQGLKFLHERH--IIHRDIKSDNVLLDNQGRVKITDFG-F 806

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
           C+ +   R+ +             T  + APE++   +    +EK D+W+LG+   ++  
Sbjct: 807 CAKLTDQRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLE 855

Query: 242 YTTPF 246
              P+
Sbjct: 856 GEPPY 860

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 93/201 (46%), Gaps = 29/201 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  +   RL E     + +Q V GV+ MH+    L+H
Sbjct: 112 VLQNSKYIGIVLEYASGGEFYKYIQRK--RRLKEAIACRLFAQLVSGVNYMHSK--GLVH 167

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ---YRAPEM 214
           RD+K+EN+L+       I DFG V              +V H+ L  T+     Y APE+
Sbjct: 168 RDLKLENLLLDKHENLVITDFGFVNE------------FVSHNELMKTSCGSPCYAAPEL 215

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFE---KGGEAAILHSRYQYPA-----FPI 266
           +   +      KSD+W+ GV LY +     P++   K  +   +   Y Y       FP 
Sbjct: 216 VVSTKPYEA-RKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFPE 274

Query: 267 YTDKL-KNLIRATLMEDPSKR 286
           Y   L ++L+R  L+ DP KR
Sbjct: 275 YITPLSRDLLRRILVSDPKKR 295

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 129/292 (44%), Gaps = 41/292 (14%)

Query: 6   IPTYPPGTLLTVGS-HYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKA 64
           I  +  G  L +GS    ++ +  ++G  A +     +  N  N S T+ +     PD  
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGST-TPDAL 74

Query: 65  GLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTR 124
                R E+  MKLL N+ +V+   D       V     +++L++EY + G L + +  R
Sbjct: 75  PYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVER 125

Query: 125 LQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSY 184
               L E E +    Q + GVS  HAL   ++HRD+K EN+L+  K   KI DFG     
Sbjct: 126 --GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA-- 179

Query: 185 IRPPRNPQELAYVQHDVLKNTTA--QYRAPEMLDL--YRGLPINEKSDIWALGVFLYKLC 240
                        +  +L+ +     Y APE++    Y+G      SD+W+ GV L+ L 
Sbjct: 180 ----------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFALL 225

Query: 241 YYTTPF-EKGGEAAILHSRYQYPAFPIYTD-----KLKNLIRATLMEDPSKR 286
               PF E+ G    L  + Q   F + +D     + ++LIR  L  DP +R
Sbjct: 226 TGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERR 277

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 127/282 (45%), Gaps = 43/282 (15%)

Query: 31   GGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLN--------TLRAEVDAMKLLKNN 82
            G F  +Y +    +N     +   +K+V VP+    N         LR+EV  +K L ++
Sbjct: 1347 GSFGSVYLS----LN-VTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKDL-DH 1400

Query: 83   RHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTV 142
             ++V Y+      +      Y +FL  EY  GG +   +  R+  R  E  I +  +Q +
Sbjct: 1401 INIVQYLGFEKKNNI-----YSLFL--EYVAGGSIGSLI--RMYGRFDESLIRHSTTQIL 1451

Query: 143  QGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVL 202
             G+S +H+    ++HRD+K +N+L+  +G  KI DFG         R  +++ Y   ++ 
Sbjct: 1452 AGLSYLHS--KGILHRDMKADNILLDGEGICKISDFGI-------SRKSKDI-YSNSEMT 1501

Query: 203  KNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEK-GGEAAILHSRYQY 261
               T  + APEM+D  +G   + K DIW+LG  + ++     P+      AA+       
Sbjct: 1502 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSK 1559

Query: 262  PAFPIYTDKL-------KNLIRATLMEDPSKRPNICQLLEEI 296
             A PI  D L       ++ +      DP KRP   Q+L+ +
Sbjct: 1560 SAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/332 (25%), Positives = 144/332 (43%), Gaps = 71/332 (21%)

Query: 8   TYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRV--------- 58
           +Y P +   + +HY +I+K L +G   ++   +    N     Q   +K V         
Sbjct: 80  SYDPVSKTQILNHY-EIVKELGNGQHGKVKLAKDIRAN-----QLVAIKMVNRYEKKTYF 133

Query: 59  IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYI---DSHAARSTVLAGAYEVFLLMEYCKGG 115
             P +   N ++ E+  MK   NN+HVV  I   D  ++R        +++L++EYC+ G
Sbjct: 134 AGPKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLSSR--------KIYLVLEYCEKG 184

Query: 116 GLIDF------MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISA 169
            ++        +++R   +L+ +    I    + G+  +H+    +IHRDIK  N+L+  
Sbjct: 185 PILWCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDK 242

Query: 170 KGEFKICDFG-SVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML------------- 215
            G  KI DFG S+ +      N  EL   +       T  + APE+              
Sbjct: 243 NGVVKISDFGVSLAANGNIDTNDDELELTK----TVGTPVFYAPEICLGAAAMERFNLDK 298

Query: 216 -DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE----AAILHSRYQYPAFPIYTDK 270
            +L+ G  I+ K DIWALG+ LY L +   PF    E      I++ + ++P F    D 
Sbjct: 299 DELFNGSCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDN 358

Query: 271 -------------LKNLIRATLMEDPSKRPNI 289
                         K+L+   L ++P+KR +I
Sbjct: 359 HISEISHIREFVHAKDLLNKLLEKNPAKRISI 390

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 132/300 (44%), Gaps = 44/300 (14%)

Query: 6   IPTYPPGTLLTVGSHYCKIIKY-LTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKA 64
           I  +  G+ L VGS    ++ Y  T G  A +     S  N   ++        ++P   
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLP--- 70

Query: 65  GLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTR 124
               +  E+  MKLL N+ +V+   D       V   + ++++++EY + G L + +  R
Sbjct: 71  --YGIEREIIIMKLL-NHPNVLRLYD-------VWETSKDLYMVLEYVEKGELFNLLVER 120

Query: 125 LQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSY 184
               L E E +    Q + G+S  HAL   ++HRD+K EN+L+  K   K+ DFG     
Sbjct: 121 --GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMA--- 173

Query: 185 IRPPRNPQELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLC 240
                     A    D L  T+     Y APE++    GLP +  +SD+W+ GV LY L 
Sbjct: 174 ----------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 220

Query: 241 YYTTPF--EKGGEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLE 294
               PF  E G    +L      +++ P     + + ++LI   L  DP +R    ++L+
Sbjct: 221 TGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 102/225 (45%), Gaps = 38/225 (16%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D     S +       ++++EY + G L + +  R    L E
Sbjct: 82  EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAQKGELFNLLVER--GPLPE 131

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
           KE +    Q V G+S  HAL   ++HRD+K EN+L+  K   KI DFG            
Sbjct: 132 KEAIRFFRQIVIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMA---------- 179

Query: 192 QELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTTPF- 246
              A    D L  T+     Y APE++    G+P +   SD+W+ GV L+ L     PF 
Sbjct: 180 ---ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALLTGRLPFD 233

Query: 247 -EKGGEAAIL----HSRYQYPAFPIYTDKLKNLIRATLMEDPSKR 286
            E G    +L      RY+ P     +   ++LI   L  DP +R
Sbjct: 234 DEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQR 278

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 108/236 (45%), Gaps = 27/236 (11%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D   +  ++ E+  +  LK   ++  Y  S+   +++       ++LMEYC GG L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
                 ++ EK I  I+ + +  +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
               +     Q +A          T  + APE+  +  G+  + K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKRPNICQLL 293
              P+   +   A  L  + + P      Y+  LK  I   L EDP +R +   LL
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKERLSADDLL 271

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 109/237 (45%), Gaps = 27/237 (11%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D   +  ++ E+  +  LK   ++  Y  S+   +++       +++MEYC GG L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
                 ++ EK I  I+ + +  +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
               +     Q +A          T  + APE+  +  G+  + K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKRPNICQLLE 294
              P+   +   A  L  + + P      Y+  LK  I   L EDP +R +   LL+
Sbjct: 216 GNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLK 272

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 129/291 (44%), Gaps = 39/291 (13%)

Query: 6   IPTYPPGTLLTVGS-HYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKA 64
           I  +  G  L +GS    ++ +  ++G  A +     +  N  N S T+ +   I PD  
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS-ITPDAL 74

Query: 65  GLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTR 124
                R E+  MKLL N+ +V+   D       V     +++L++EY + G L + +  R
Sbjct: 75  PYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVER 125

Query: 125 LQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSY 184
               L E E +    Q + GVS  HAL   ++HRD+K EN+L+  K   KI DFG     
Sbjct: 126 --GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA-- 179

Query: 185 IRPPRNPQELAYVQHDVLKNTTA--QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCY 241
                        +  +L+ +     Y APE++    G+P     SD+W+ GV L+ L  
Sbjct: 180 ----------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLT 226

Query: 242 YTTPF-EKGGEAAILHSRYQYPAFPIYTD-----KLKNLIRATLMEDPSKR 286
              PF E+ G    L  + Q   F + +D     + ++LI   L  DP +R
Sbjct: 227 GRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRR 277

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 94/198 (47%), Gaps = 31/198 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ +R   +L E+E ++   Q VQGVS  H+    + H
Sbjct: 210 VWENKSELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICH 265

Query: 158 RDIKIENVLISAKGE-FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNT--TAQYRAPE- 213
           RD+K EN+L+  K +  KI DFG                 V + +L+ +  +  Y +PE 
Sbjct: 266 RDLKPENLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEI 313

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L      ++  P     +
Sbjct: 314 VMGRPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQN--LS 367

Query: 269 DKLKNLIRATLMEDPSKR 286
            + K+L+   L+ +P KR
Sbjct: 368 AEAKDLMSKILVVNPFKR 385

>TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {ON}
           Anc_3.60 YNL298W
          Length = 885

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 97/181 (53%), Gaps = 27/181 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM-----NTRL 125
           V+ + ++K++RH  +V++++++      L    +++++MEY +GG L D +     +  +
Sbjct: 651 VNEILVMKDSRHKNIVNFLEAY------LKTEDDLWVVMEYMEGGSLTDIIENSPADESI 704

Query: 126 QNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI 185
            + LTE +I  I+ +T QG+  +H     +IHRDIK +NVL+  +G  KI DFG  C+ +
Sbjct: 705 NSPLTESQIAYIVRETCQGLKFLHDRH--IIHRDIKSDNVLLDTQGRVKITDFG-FCAKL 761

Query: 186 RPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
              R+ +             T  + APE++   +    +EK D+W+LG+   ++     P
Sbjct: 762 TDQRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEPP 810

Query: 246 F 246
           +
Sbjct: 811 Y 811

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 113/237 (47%), Gaps = 27/237 (11%)

Query: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121
           D+  +  ++ E+  +  LK   +V  Y  S+   +++       +++MEYC GG L   +
Sbjct: 77  DEDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNTSL-------WIIMEYCAGGSLRSLL 129

Query: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181
                 ++ EK I  I+ + +  +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 130 R---PGKIDEKYIGVIMRELLVALKFIH--KDNIIHRDIKAANVLITNEGGVKLCDFGVA 184

Query: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241
               +     Q +A          T  + APE+  +  G+  + K DIW+LG+  Y++  
Sbjct: 185 AQLNQRTLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIST 233

Query: 242 YTTPF--EKGGEAAILHSRYQYPAFP--IYTDKLKNLIRATLMEDPSKRPNICQLLE 294
              P+   +   A  L ++ + P      YT  +K  I   L EDP++R +  +LL+
Sbjct: 234 GNPPYCDVEALRAMQLITKSKPPRLEGRNYTPLIKEFIALCLDEDPNERLSADELLK 290

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 102/215 (47%), Gaps = 37/215 (17%)

Query: 105 VFLLMEYCKGGGL----IDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDI 160
           +F+ MEY  G  L    ++ +N  L  R+ EK +  I    ++G+S +H  +  +IHRDI
Sbjct: 310 IFIAMEYMGGRSLDAIYLNLLN--LGGRIGEKVLGKIAESVLRGLSYLH--ERKVIHRDI 365

Query: 161 KIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRG 220
           K +N+L++ KG+ K+CDFG     +        LA          T+ Y APE +   +G
Sbjct: 366 KPQNILLNEKGQVKLCDFGVSGEAV------NSLA-----TTFTGTSFYMAPERI---QG 411

Query: 221 LPINEKSDIWALGVFLYKLCYYTTPFEKGGEAA----------ILHSRYQYPAFP----I 266
            P +   D+W+LG+ L ++     PF      A          IL    Q    P    +
Sbjct: 412 QPYSVTCDVWSLGLTLLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIV 471

Query: 267 YTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQG 301
           ++   K+ I   L +DPS+RP+  Q+++    IQG
Sbjct: 472 WSKSFKSFIEYCLKKDPSERPSPRQMIQH-PWIQG 505

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 112/255 (43%), Gaps = 32/255 (12%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++ ++EY   G L+  +  R    L+     +  +Q +  + A+H++   +IHRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSV--GVIHRDIKPEN 274

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKN--TTAQYRAPEMLDLYRGLP 222
           VL+ +    K+ DFG+       P+    L  V   V  +   TA+Y  PE+L       
Sbjct: 275 VLLDSHYRAKLTDFGTAALL---PQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHA-- 329

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKGGE----AAILHSRYQYPAFPIYTDKLKNLIRAT 278
            +   D+WA    +++L     PF+   E      ++  RY YP  P +   LK+L+R  
Sbjct: 330 -DGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRV 386

Query: 279 LMEDPSKR---PNIC--QLLEEISRIQGI---PCPINNFYLSRTINVQASLMNPIITPTQ 330
           L  +P +R   P I   Q        + +   P P    Y S  I + +      I P  
Sbjct: 387 LRHEPRQRLLQPQITQHQFFAHTDFSEALWDKPPPPFGPYESERITLSS------ILPLD 440

Query: 331 QTALKHSQSSATISD 345
           Q   KHS+SS+  S+
Sbjct: 441 QNERKHSESSSRYSE 455

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 83/181 (45%), Gaps = 25/181 (13%)

Query: 116  GLIDFMN-TRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFK 174
            G ID  +   L+  +TE E   +  Q   G+  +H  +  ++HRDIK ENV++  +G  K
Sbjct: 1091 GSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVK 1148

Query: 175  ICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEML--DLYRGLPINEKSDIWAL 232
            I DFGS     R P           DV   T   Y APE+L  D Y G P     D+WA+
Sbjct: 1149 IIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAV 1193

Query: 233  GVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRP---NI 289
            GV LY + Y   PF    E  IL    +     + +++   LI   L    ++RP   +I
Sbjct: 1194 GVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

Query: 290  C 290
            C
Sbjct: 1252 C 1252

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 96/206 (46%), Gaps = 31/206 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E+FL++EY +GG L D++ ++   +L E+E ++   Q +QGV+  H     + H
Sbjct: 138 VWENKSELFLVLEYVEGGELFDYLVSK--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICH 193

Query: 158 RDIKIENVLISAKG-EFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTA--QYRAPE- 213
           RD+K EN+L+  K  + KI DFG                   + +L+ +     Y +PE 
Sbjct: 194 RDLKPENLLVDKKNHQIKIADFGMAA------------LETTNKLLETSCGSPHYASPEI 241

Query: 214 -MLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYT 268
            M   Y G P    SD+W+ G+ L+ L     PF       +L      +Y  P     +
Sbjct: 242 VMGKNYHGSP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKYHMPQN--IS 295

Query: 269 DKLKNLIRATLMEDPSKRPNICQLLE 294
            + ++LI   L+ DP  R  I ++L+
Sbjct: 296 SEAQDLISKILIVDPRGRITINEVLQ 321

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 98/204 (48%), Gaps = 29/204 (14%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    F+  +   RL E     + SQ +  V  +H+    L+H
Sbjct: 135 VLQNSKYIGIVLEYAAGGEFYKFIQRK--RRLKENHACRLFSQLISAVHYIHS--KGLVH 190

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+  +    I DFG V  ++R           Q+ ++K +     Y APE++
Sbjct: 191 RDLKLENLLLDNEENLIITDFGFVNEFLR-----------QNGMMKTSCGSPCYAAPELV 239

Query: 216 DLYRGLPIN-EKSDIWALGVFLYKLCYYTTPFE---KGGEAAILHSRYQY-----PAFPI 266
              R  P +  K+D W+ G+ L+ +     P++   K  +   +   Y Y       FP 
Sbjct: 240 VSNR--PYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPE 297

Query: 267 YTDKL-KNLIRATLMEDPSKRPNI 289
           Y + + ++L+R  L+ DP KR NI
Sbjct: 298 YINPVPRDLLRKILVIDPKKRINI 321

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 113/258 (43%), Gaps = 36/258 (13%)

Query: 51   QTACLKRVIVP-----DKAGLNTLRAEVDAMKLLKNNRHV--VSYIDSHAARSTVLAGAY 103
            +   +K+V VP     D+  L+ L A    +  LK+  HV  V Y+             Y
Sbjct: 1170 EMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVNIVQYLGFENKNH-----VY 1224

Query: 104  EVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIE 163
             +FL  EY  GG +   +  RL  R  E  I  +  Q ++G++ +H+    ++HRD+K +
Sbjct: 1225 SLFL--EYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLHS--KGILHRDMKAD 1278

Query: 164  NVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPI 223
            N+L+   G  KI DFG     I    N     Y   D+    T  + APEM+D  +G   
Sbjct: 1279 NLLLDVDGICKISDFG-----ISKKSNN---IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1328

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKGGEAAILHSRYQY---PAFPIYTDKL-----KNLI 275
            + K DIW+LG  + ++     P+      A +    ++   P  P  T KL     K+ +
Sbjct: 1329 SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFL 1388

Query: 276  RATLMEDPSKRPNICQLL 293
             A    DP KRP    LL
Sbjct: 1389 DACFEIDPEKRPTADDLL 1406

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 121/259 (46%), Gaps = 38/259 (14%)

Query: 51   QTACLKRVIVP-----DKAGLNT---LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGA 102
            +   +K+V VP     D+A ++T   LR+EV  +K L ++ ++V Y+             
Sbjct: 1238 EMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-DHLNIVQYLGFENK-----DNI 1291

Query: 103  YEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKI 162
            Y +FL  EY  GG +   +  R+  R  E  I ++ +Q ++G++ +H+    ++HRD+K 
Sbjct: 1292 YSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLRGLAYLHSR--GILHRDMKA 1345

Query: 163  ENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLP 222
            +N+L+   G  KI DFG         R  +++ Y   D+    T  + APEM+D  +G  
Sbjct: 1346 DNLLLDQDGVCKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY- 1396

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYP----AFPIYTDKLKNL 274
             + K DIW+LG  + ++     P+      A +     S+   P      P+ +   ++ 
Sbjct: 1397 -SAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRDF 1455

Query: 275  IRATLMEDPSKRPNICQLL 293
            + A    DP  RP    LL
Sbjct: 1456 LDACFEIDPDNRPTADNLL 1474

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 92/200 (46%), Gaps = 27/200 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  +   RL E     + +Q + GV  MH+    L+H
Sbjct: 116 VLQNSKYIGIVLEYASGGEFYKYIQKK--RRLKEAVACRLFAQLISGVQYMHSK--GLVH 171

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+       I DFG V  +           +   +++K +     Y APE++
Sbjct: 172 RDLKLENLLLDKHENLVITDFGFVNEF-----------FAHSELMKTSCGSPCYAAPELV 220

Query: 216 DLYRGLPINEKSDIWALGVFLYKLCYYTTPFE---KGGEAAILHSRYQYPA-----FPIY 267
              +      K+DIW+ GV LY +     P++   K  +   +   YQY       FP Y
Sbjct: 221 VSSKPYEA-RKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYITRTPLKFPEY 279

Query: 268 TDKL-KNLIRATLMEDPSKR 286
              L ++L+R  L  DP +R
Sbjct: 280 ITPLPRDLLRRILYPDPKRR 299

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 95/203 (46%), Gaps = 27/203 (13%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           V     E++L++EY  GG L D++ +R   +L E E ++   Q +QGVS  H+    + H
Sbjct: 220 VWENKSELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICH 275

Query: 158 RDIKIENVL-ISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPE--M 214
           RD+K EN+L    K   KI DFG     +     P++L           +  Y +PE  M
Sbjct: 276 RDLKPENLLIDKKKKSIKIADFGMAALEL-----PKKLLQTSCG-----SPHYASPEIVM 325

Query: 215 LDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGGEAAIL----HSRYQYPAFPIYTDK 270
              Y G P    SD+W+ G+ L+ L     PF       +L      +YQ P     +D+
Sbjct: 326 GKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPKN--LSDE 379

Query: 271 LKNLIRATLMEDPSKRPNICQLL 293
            K+LI   L+  PSKR    ++L
Sbjct: 380 AKDLISRILVVSPSKRLTTVEIL 402

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 104/225 (46%), Gaps = 38/225 (16%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D     S +       ++++EY + G L + +  R    L E
Sbjct: 78  EIVIMKLL-NHANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVER--GPLPE 127

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
            E +    Q + G+S  HAL   ++HRD+K EN+L+  K   KI DFG            
Sbjct: 128 NEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMA---------- 175

Query: 192 QELAYVQHDVLKNTTA---QYRAPEMLDLYRGLPINE-KSDIWALGVFLYKLCYYTTPF- 246
              A    D L  T+     Y APE++    G+P +   SD+W+ GV LY L     PF 
Sbjct: 176 ---ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALLTGRLPFD 229

Query: 247 EKGGEAAILHSRYQYPAFPIYTD-----KLKNLIRATLMEDPSKR 286
           E+ G    L  + Q   F +  D     + +NLI   L+ +P++R
Sbjct: 230 EEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 118/259 (45%), Gaps = 38/259 (14%)

Query: 51   QTACLKRVIVP-----DKAGLN---TLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGA 102
            +   +K+V VP     D+A ++    LR+EV  +K L ++ ++V Y+      S      
Sbjct: 1198 EMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKNL-DHLNIVQYLGFENKNSI----- 1251

Query: 103  YEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKI 162
            Y +FL  EY  GG +   +  RL  R  E  I  +  Q ++G+S +H+    ++HRD+K 
Sbjct: 1252 YSLFL--EYVAGGSVGSLI--RLYGRFDESLIRFLTVQVLRGLSYLHSR--GILHRDMKA 1305

Query: 163  ENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLP 222
            +N+L+   G  KI DFG         R   ++ Y   D+    T  + APEM+D  +G  
Sbjct: 1306 DNLLLDLDGVCKISDFGIS-------RKSNDI-YCNSDMTMRGTVFWMAPEMVDTKQGY- 1356

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEK----GGEAAILHSRYQYP----AFPIYTDKLKNL 274
             + K DIW+LG  + ++     P+           I  S+   P      P+ + + +  
Sbjct: 1357 -SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKTAPPIPEDTLPLISKEGREF 1415

Query: 275  IRATLMEDPSKRPNICQLL 293
            + A    DP +RP    LL
Sbjct: 1416 LDACFEIDPERRPTADTLL 1434

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 115/232 (49%), Gaps = 34/232 (14%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTE 131
           E + ++ LKN + ++S   +    S++       + L+EY   G L+  M  R    + E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 132 KEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPPRNP 191
           K      +Q +  +  MH     +IHRD+K EN+L+    + K+ DFG+  + +    + 
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGT--ARLLDSTSE 309

Query: 192 QELAYVQHDVLKNT-----TAQYRAPEML-DLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
            +L Y   D+L  +     TA+Y +PE+L D Y    ++ + DIWA G  L+++     P
Sbjct: 310 DDLKY---DLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPP 362

Query: 246 FEKGGE----AAILHSRYQYPA-FPIYTDKLKNLIRATLMEDPSKRPNICQL 292
           F+   E      ++  ++ + A FP+    +++L++  L+++P +R  I Q+
Sbjct: 363 FKANNEYLTFQKVMKVQFAFTAGFPM---TVRDLVKNILIKNPERRLLINQI 411

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 109/219 (49%), Gaps = 24/219 (10%)

Query: 105 VFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIEN 164
           ++ L+EY   G L+  +  +      E   +   +Q +  +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSM--GIIHRDIKPEN 389

Query: 165 VLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNT-----TAQYRAPEML-DLY 218
           +L++   + K+ DFG+    + P +  Q  +    ++L+ +     TA+Y +PE+L D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPINEKSDIWALGVFLYKLCYYTTPFEKGGE----AAILHSRYQYPA-FPIYTDKLKN 273
                + + DIWA G  L++L     PF+   E      I+  +Y + A FP     L++
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTI---LRD 501

Query: 274 LIRATLMEDPSKRPNICQLLEEI-SRIQGIPCPINNFYL 311
           LI+  L+++P+ R  I Q+   +  R +    P N +YL
Sbjct: 502 LIKKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 107/236 (45%), Gaps = 30/236 (12%)

Query: 66   LNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRL 125
            L  LR+EV  +K L ++ ++V Y+             Y   L +EY  GG +   +  RL
Sbjct: 1193 LEALRSEVATLKDL-DHTNIVQYLGFENKN-------YVYSLFLEYVAGGSVGSLI--RL 1242

Query: 126  QNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYI 185
              +  E  I  +  Q ++G+S +H+ +  ++HRD+K +N+L+   G  KI DFG     I
Sbjct: 1243 YGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDFG-----I 1295

Query: 186  RPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTP 245
                N     Y   D+    T  + APEM+D  +G   + K DIW+LG  + ++     P
Sbjct: 1296 SKKSNN---IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1350

Query: 246  FEKGGEAAILHSRYQY---PAFPIYTDKL-----KNLIRATLMEDPSKRPNICQLL 293
            +      A +    ++   P  P  T K+     K  + A    +P KRP   +LL
Sbjct: 1351 WSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 100/206 (48%), Gaps = 33/206 (16%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++E+  GG    ++  +   RL E     + +Q V GV  MH+    L+H
Sbjct: 112 VLQNSKYIGIVLEFASGGEFYKYIQKK--RRLKETPACRLFAQLVSGVHYMHS--KGLVH 167

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+       I DFG V  + +           +++++K +     Y APE++
Sbjct: 168 RDLKLENLLLDKHENLIITDFGFVNEFSQ-----------RNELMKTSCGSPCYAAPELV 216

Query: 216 ---DLYRGLPINEKSDIWALGVFLYKLCYYTTPFE------KGGEAAILHSRYQYPA--F 264
              + Y       K+D+W+ G+ LY +     P++       G + A L+      A  F
Sbjct: 217 VTTEPYEA----RKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYITKTALKF 272

Query: 265 PIYTDKL-KNLIRATLMEDPSKRPNI 289
           P Y + + ++L+R  L+ DP+KR NI
Sbjct: 273 PEYINPIQRDLLRKILVSDPTKRLNI 298

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 33/209 (15%)

Query: 98  VLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIH 157
           VL  +  + +++EY  GG    ++  +   RL E     + SQ V GV  +H+    L+H
Sbjct: 118 VLQNSRYIGIVLEYACGGEFYKYIQKK--RRLKETNACRLFSQLVSGVYYIHS--KGLVH 173

Query: 158 RDIKIENVLISAKGEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQ--YRAPEML 215
           RD+K+EN+L+       I DFG V  +             +++++K +     Y APE++
Sbjct: 174 RDLKLENLLLDKNENLVITDFGFVNEFCS-----------RNELMKTSCGSPCYAAPELV 222

Query: 216 ---DLYRGLPINEKSDIWALGVFLYKLCYYTTPFEKGG---EAAILHSRYQY-----PAF 264
              + Y       K+DIW+ GV LY +     P++      E + +   Y Y       F
Sbjct: 223 ISAEPYEA----RKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRLYNYINSTPLKF 278

Query: 265 PIYTDKL-KNLIRATLMEDPSKRPNICQL 292
           P Y   + ++L+R  L+ DP KR N+ Q+
Sbjct: 279 PDYILPIPRDLLRRILVPDPKKRMNLKQI 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,524,467
Number of extensions: 2801420
Number of successful extensions: 13325
Number of sequences better than 10.0: 1966
Number of HSP's gapped: 11797
Number of HSP's successfully gapped: 2033
Length of query: 723
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 606
Effective length of database: 40,065,477
Effective search space: 24279679062
Effective search space used: 24279679062
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)