Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B062502.287ON37337319770.0
NDAI0B035502.287ON37237418130.0
Smik_9.852.287ON37137317530.0
YIL094C (LYS12)2.287ON37137317340.0
KNAG0A054202.287ON37237317300.0
Suva_9.1052.287ON37137317280.0
Skud_9.792.287ON37137317230.0
TDEL0G021802.287ON36937317210.0
SAKL0E07656g2.287ON36837316300.0
KAFR0J013602.287ON37337416260.0
CAGL0G02585g2.287ON37237416160.0
KLTH0G10384g2.287ON36737316140.0
KLLA0E08339g2.287ON36937316100.0
Kwal_27.115282.287ON36737315990.0
Kpol_1003.392.287ON37037315880.0
ZYRO0A01914g2.287ON36837315690.0
TBLA0B059402.287ON36937415640.0
TPHA0C034102.287ON37135915290.0
Ecym_33262.287ON36637314860.0
ADL214C2.287ON36735613870.0
ADL223W2.278ON3623504864e-57
Smik_15.3165.473ON3693554832e-56
Suva_8.1885.473ON3693554795e-56
Ecym_23135.473ON3703764771e-55
TPHA0D015602.278ON3603524761e-55
KLLA0F04103g2.278ON3613684751e-55
NDAI0C014105.473ON3693544752e-55
NCAS0H022505.473ON4223534758e-55
YOR136W (IDH2)5.473ON3693554701e-54
Skud_15.3005.473ON3693554701e-54
KLLA0E03125g5.473ON3683534692e-54
Ecym_33162.278ON3623504682e-54
Kwal_23.50122.278ON3613834672e-54
KNAG0B040705.473ON3733524665e-54
SAKL0E07876g2.278ON3613504655e-54
KAFR0B063705.473ON3783534613e-53
TBLA0B022405.473ON3733964595e-53
KLTH0G10186g2.278ON3603534542e-52
NCAS0B062902.278ON3593514515e-52
Smik_14.2902.278ON3603784516e-52
KLTH0F15048g5.473ON3683554526e-52
Kpol_440.125.473ON3683604518e-52
YNL037C (IDH1)2.278ON3603514509e-52
TPHA0J027705.473ON3763534501e-51
TDEL0C038402.278ON3613894491e-51
AFR137C5.473ON3673554491e-51
Kpol_543.85.473ON3683564491e-51
Kwal_55.212735.473ON3683904482e-51
Skud_14.2932.278ON3613514482e-51
CAGL0I07227g5.473ON3683544473e-51
SAKL0G03520g5.473ON3693874473e-51
Kpol_1039.352.278ON3593714439e-51
NDAI0B035902.278ON3593514342e-49
TBLA0B069102.278ON3653524342e-49
ZYRO0D02838g2.278ON3613734342e-49
TDEL0A033705.473ON3713534342e-49
ZYRO0D11220g5.473ON3683554317e-49
TPHA0E014805.473ON3773554256e-48
KNAG0A052802.278ON3613774212e-47
CAGL0G02673g2.278ON3583774202e-47
KAFR0J014102.278ON3503794027e-45
TBLA0C015001.402ON3653723942e-43
Ecym_12961.402ON3633623897e-43
KLTH0H12188g1.402ON3643643775e-41
TDEL0B060001.402ON3623703652e-39
KLLA0D04906g1.402ON3623703643e-39
NDAI0G042301.402ON3633683626e-39
Kwal_0.2251.402ON3643683619e-39
AAL012C1.402ON3723683592e-38
Kpol_1048.631.402ON3643653574e-38
Suva_14.3022.278ON3002933524e-38
KNAG0I012801.402ON4473643597e-38
CAGL0H03795g1.402ON3653663495e-37
YCL018W (LEU2)1.402ON3643643486e-37
KAFR0I022001.402ON3653643487e-37
Skud_3.431.402ON3643643433e-36
Smik_3.661.402ON3643643424e-36
Suva_3.31.402ON3643643401e-35
NCAS0C048701.402ON3653693391e-35
ZYRO0E04796g1.402ON3623703339e-35
SAKL0D08690g1.402ON3643693321e-34
TPHA0B037301.402ON3653733083e-31
Kwal_23.42104.254ON4222971505e-10
Kpol_1055.784.254ON4271151471e-09
KAFR0H031601.396ON4211281452e-09
CAGL0D00770g4.254ON4231301443e-09
TPHA0B022104.254ON4331821425e-09
KLTH0H12012g1.396ON4131941391e-08
Ecym_13061.396ON4151261391e-08
AAL022W1.396ON4151261391e-08
KAFR0G032604.254ON4211971381e-08
SAKL0H02860g4.254ON4212981381e-08
NDAI0D043604.254ON4241941382e-08
YDL066W (IDP1)4.254ON4281151382e-08
Skud_4.1894.254ON4291151372e-08
CAGL0H03663g1.396ON4181261372e-08
Smik_4.1694.254ON4281151372e-08
KNAG0H016701.396ON4241291363e-08
KNAG0I013201.396ON4121151363e-08
SAKL0D08426g1.396ON4111261354e-08
Smik_12.2351.396ON4121261354e-08
TBLA0C012901.396ON4181261354e-08
TDEL0E011604.254ON4231151345e-08
ZYRO0E05016g1.396ON4111271346e-08
KLLA0B03355g4.254ON4291161338e-08
Suva_4.1844.254ON4291151329e-08
NCAS0A087201.396ON4131301321e-07
NDAI0G008501.396ON4191261321e-07
TDEL0B061001.396ON4141271311e-07
YNL009W (IDP3)1.396ON4201261311e-07
Kpol_1048.701.396ON4191061311e-07
Skud_12.2391.396ON4121261311e-07
TBLA0A080104.254ON4281141311e-07
KAFR0I021301.396ON4081141302e-07
YLR174W (IDP2)1.396ON4121261292e-07
NCAS0G036201.396ON4181151292e-07
NCAS0A025104.254ON4261661292e-07
KLTH0D14476g4.254ON4201981292e-07
Skud_14.3181.396ON4201261283e-07
KNAG0D044104.254ON4281671283e-07
Suva_10.2711.396ON4121261273e-07
Kwal_0.1911.396ON4111271273e-07
Suva_14.3391.396ON4171261264e-07
KLLA0F12342g1.396ON4152011265e-07
CAGL0B04917g1.396ON4111971265e-07
ZYRO0B12496g4.254ON4221151257e-07
AER061C4.254ON4251571257e-07
TPHA0B036601.396ON4221261257e-07
Smik_14.3191.396ON4181261231e-06
Ecym_32654.254ON4241161185e-06
NDAI0G051601.396ON4201271114e-05
Suva_14.303singletonON5350923e-04
YPR134W (MSS18)3.470ON26838675.8
Skud_15.833.149ON45190686.1
Kwal_47.172528.141ON872167687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B06250
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   766   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   702   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   679   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   672   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              671   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   670   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   668   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   667   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   632   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   630   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   627   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   626   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   624   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   620   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   616   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   608   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   607   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   593   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   577   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   538   0.0  
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   191   4e-57
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   190   2e-56
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   189   5e-56
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   188   1e-55
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   187   1e-55
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   187   1e-55
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   187   2e-55
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    187   8e-55
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   185   1e-54
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   185   1e-54
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   185   2e-54
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   184   2e-54
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   184   2e-54
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   184   5e-54
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   183   5e-54
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   182   3e-53
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   181   5e-53
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   179   2e-52
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   178   5e-52
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   178   6e-52
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   178   6e-52
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   178   8e-52
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   177   9e-52
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   177   1e-51
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   177   1e-51
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   177   1e-51
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   177   1e-51
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   177   2e-51
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   177   2e-51
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   176   3e-51
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   176   3e-51
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   175   9e-51
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   171   2e-49
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            171   2e-49
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   171   2e-49
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   171   2e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   170   7e-49
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   168   6e-48
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              166   2e-47
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   166   2e-47
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   159   7e-45
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   156   2e-43
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   154   7e-43
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   149   5e-41
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   145   2e-39
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   144   3e-39
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   144   6e-39
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   143   9e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   142   2e-38
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   142   4e-38
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   140   4e-38
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   142   7e-38
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             139   5e-37
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   138   6e-37
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   138   7e-37
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   136   3e-36
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   136   4e-36
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      135   1e-35
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   135   1e-35
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   132   9e-35
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   132   1e-34
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   123   3e-31
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    62   5e-10
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    61   1e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    60   2e-09
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    60   3e-09
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    59   5e-09
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    58   1e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    58   1e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    58   1e-08
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    58   1e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    58   1e-08
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    58   2e-08
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    58   2e-08
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    57   2e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    57   2e-08
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    57   2e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    57   3e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    57   3e-08
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    57   4e-08
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    57   4e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    57   4e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    56   5e-08
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    56   6e-08
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    56   8e-08
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    55   9e-08
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    55   1e-07
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     55   1e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    55   1e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    55   1e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    55   1e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    55   1e-07
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    55   1e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    55   2e-07
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    54   2e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    54   2e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    54   2e-07
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    54   2e-07
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    54   3e-07
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    54   3e-07
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    54   3e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    54   3e-07
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    53   4e-07
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    53   5e-07
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    53   5e-07
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    53   7e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    53   7e-07
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    53   7e-07
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    52   1e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    50   5e-06
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    47   4e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    40   3e-04
YPR134W Chr16 (798051..798857) [807 bp, 268 aa] {ON}  MSS18Nucle...    30   5.8  
Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W...    31   6.1  
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    31   7.1  

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 361 TTQQVTEDVLARL 373
           TTQQVTEDVLARL
Sbjct: 361 TTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/374 (91%), Positives = 357/374 (95%), Gaps = 3/374 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLRT ASR AT  CR YATNA+RKNLTIGLIPGDGIGKEVIPAGKQVL+NLNSKHGL FD
Sbjct: 1   MLRTTASRLAT--CRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFD 58

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAGFQTFLDTGKALPDET+QVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRKEMG
Sbjct: 59  FIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 118

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLY-IKIEKTYIDKATGTRVAEATKRISEIA 179
           L+ANVRPVKSV GT D+PVDMVIVRENT     IK+E+TYID+ATGTRVAEATKRISEIA
Sbjct: 119 LYANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIA 178

Query: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239
           TRRIATIALDIALQRLK NGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG I Y
Sbjct: 179 TRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINY 238

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299
           NEQIVDSMVYRMFREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP
Sbjct: 239 NEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 298

Query: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           CHGSAPDIAGKGI+NPIATIRSTALMLEFLGHN+AAQDIHRAVEAN++ENK+KTPDLGG 
Sbjct: 299 CHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGK 358

Query: 360 STTQQVTEDVLARL 373
           STTQ+VTEDVLARL
Sbjct: 359 STTQEVTEDVLARL 372

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/373 (87%), Positives = 352/373 (94%), Gaps = 2/373 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR+ A+R   STCR  ATNA RK+LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGL F+
Sbjct: 1   MLRSVATRL--STCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFN 58

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL AGFQTF +TGKALPDETV+VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMG
Sbjct: 59  FIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           LFANVRPVKSV G KD+P+DMVIVRENTEDLYIKIEKTYIDKATGTRVA+ATKRISEIAT
Sbjct: 119 LFANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIAT 178

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           RRIATIA+DIAL+RL+  G+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYG I YN
Sbjct: 179 RRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYN 238

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 239 EQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 298

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDI++AV+AN+RE  IKTPDLGG +
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKA 358

Query: 361 TTQQVTEDVLARL 373
           +TQQV EDVL+RL
Sbjct: 359 STQQVVEDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/373 (86%), Positives = 349/373 (93%), Gaps = 2/373 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           M R+ A+R   S CR  A+NA RK+LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGL F+
Sbjct: 1   MFRSVATRL--SACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFN 58

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL AGFQTF +TGKALPDETV+VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMG
Sbjct: 59  FIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           LFANVRPVKSV G K +P+DMVIVRENTEDLYIKIEKTYIDKATGTRVA+ATKRISEIAT
Sbjct: 119 LFANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIAT 178

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           RRIATIALDIAL+RL+  G+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYG I YN
Sbjct: 179 RRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYN 238

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 239 EQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 298

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDI++AV+AN+RE  IKTPDLGG +
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKA 358

Query: 361 TTQQVTEDVLARL 373
           +TQQV +DVL+RL
Sbjct: 359 STQQVVDDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/373 (86%), Positives = 351/373 (94%), Gaps = 2/373 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR+AA++ A   CR  ATNA RK+LTIGLIPGDGIGKEVIPAGKQVL++LN KHGL FD
Sbjct: 2   MLRSAANKLAG--CRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFD 59

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAGFQTF DTGKALPDETVQ+LK +CQGALFGAVQSPTTKVEGYSSPIVALRK MG
Sbjct: 60  FIDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMG 119

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+AN+RPVKSV G+ +RPVDM+IVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT
Sbjct: 120 LYANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 179

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           +RIATIALDIALQRL+ NGKATLTVTHKSNVLSQSDGLFRE+C+++YE+NKDKY  ITYN
Sbjct: 180 QRIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYN 239

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYRMFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 240 EQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDIH+AV+AN+R+  +KT DLGGN+
Sbjct: 300 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNA 359

Query: 361 TTQQVTEDVLARL 373
           TTQ V +D+LARL
Sbjct: 360 TTQNVVDDILARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/373 (86%), Positives = 348/373 (93%), Gaps = 2/373 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           M R+ A+R   S CR  A+NA RK+LTIGLIPGDGIGKEVIPAGKQ+LENLNSKHGL F+
Sbjct: 1   MFRSVATRI--SACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFN 58

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL AGFQTF +TGKALPDET++VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMG
Sbjct: 59  FIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+ANVRPVKSV GTKD+P+DMVIVRENTEDLYIKIEKTYIDKATGTRVA+A KRISE+AT
Sbjct: 119 LYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVAT 178

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           RRIA IALDIALQRL+  G+ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG I YN
Sbjct: 179 RRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYN 238

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPC
Sbjct: 239 EQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPC 298

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDI++AV+AN+RE  I TPDLGG +
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKA 358

Query: 361 TTQQVTEDVLARL 373
           +TQQV +DVL+RL
Sbjct: 359 STQQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/373 (86%), Positives = 348/373 (93%), Gaps = 2/373 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           M R+ A+R   S CR  ATNA RK+LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGL F+
Sbjct: 1   MFRSVATR--VSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFN 58

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL AGFQTF +TGKALPDETV VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMG
Sbjct: 59  FIDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           LFANVRPVKSV G++++P+DMVIVRENTEDLYIKIEKTYIDKATGTRVA+ATKRISEIAT
Sbjct: 119 LFANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIAT 178

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           RRIATIALDIAL+RL+  G+ATLTVTHKSNVLSQ+DGLFREICK+VYESNKDKYG I YN
Sbjct: 179 RRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYN 238

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 239 EQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 298

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHN AAQDI++AV+AN+RE  I TPDLGG +
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKA 358

Query: 361 TTQQVTEDVLARL 373
           +TQQV +DVL+RL
Sbjct: 359 STQQVVDDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/373 (86%), Positives = 348/373 (93%), Gaps = 4/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR+A  R AT   R YA+    K++ IGLIPGDGIGKEVIPAGKQVLENL+ KHGL FD
Sbjct: 1   MLRSAIGRLATR--RAYASAP--KSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFD 56

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAG+ TF +TGKALP++TVQVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRKE+G
Sbjct: 57  FIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELG 116

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+ANVRPVKSV GTKDRPVDMVIVRENTEDLYIK+EKTY+DKATGTRVAEATKRISE+AT
Sbjct: 117 LYANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVAT 176

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           RRIATIALDIALQRLK NG ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG + YN
Sbjct: 177 RRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYN 236

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 237 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 296

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDI+RAV+AN+RE+K+KTPDLGGNS
Sbjct: 297 HGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNS 356

Query: 361 TTQQVTEDVLARL 373
           TTQQV ED+L++L
Sbjct: 357 TTQQVVEDILSKL 369

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/373 (80%), Positives = 342/373 (91%), Gaps = 5/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR+  S+FA    R+YA+ A  K LTIGLIPGDGIGKEVIPAGK VLENL+SKH LKF+
Sbjct: 1   MLRSTVSQFAR---RSYASAA--KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFN 55

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAG+QTFLDTGKALPDET+++LKS CQGALFGAVQSPT KVEGYSSPIVALRK++G
Sbjct: 56  FIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+ANVRPVKSV GT DRPVDM+IVRENTEDLYIK EKTYID+ TGTRVAEA KRISE AT
Sbjct: 116 LYANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 175

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
             IA IAL+I+LQRLK NGKATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG+I YN
Sbjct: 176 TDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYN 235

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPC
Sbjct: 236 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPC 295

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGI+NPIATIRSTALMLEF+G+ +AAQDIH+AV+ N+REN+IKTPDLGG S
Sbjct: 296 HGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKS 355

Query: 361 TTQQVTEDVLARL 373
           TTQQV +D+L+++
Sbjct: 356 TTQQVVDDILSKM 368

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/374 (80%), Positives = 341/374 (91%), Gaps = 4/374 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR+  ++  ++T R  +T  + K+LTIGLIPGDGIGKEVIPAGKQVL+NL+S+HGL F+
Sbjct: 1   MLRSVVTK--SATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFN 58

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL+AGFQTFLDTGKALPDETV+VLK QCQG LFGAVQSPTT+V+ YSSPIVALRKE+ 
Sbjct: 59  FIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQ 118

Query: 121 LFANVRPVKSVSGTKD-RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIA 179
           L+AN+RPVKSV+G    +PVDMVIVRENTEDLYIKIEK+Y D+  G RVAEATKRI+E+A
Sbjct: 119 LYANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVA 177

Query: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239
           TR+IA IALD+ALQRLK NGKATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  I Y
Sbjct: 178 TRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINY 237

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299
           NEQI+DSMVYRMFREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEP
Sbjct: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP 297

Query: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           CHGSAPDIAGKGIANPIATIRSTALMLEFLGH +AAQDIH+AVE+NMRENKIKTPDLGGN
Sbjct: 298 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGN 357

Query: 360 STTQQVTEDVLARL 373
           S+TQ V +DVL +L
Sbjct: 358 SSTQNVVDDVLEKL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/374 (81%), Positives = 338/374 (90%), Gaps = 3/374 (0%)

Query: 1   MLRTAASRFATSTCRTYATNAL-RKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKF 59
           MLR +A+R   +  R +++  L +K LTIGLIPGDGIGKEVIPAGKQ+LE +  K  L F
Sbjct: 1   MLRGSATRL--TAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDF 58

Query: 60  DFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEM 119
            FIDL AG++TF +TGKALPDETV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALRK M
Sbjct: 59  KFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAM 118

Query: 120 GLFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIA 179
           GLFANVRPVK+V GT DRPVDMVIVRENTEDLYIKIEKTY D ATGTRVAEATKRISE+A
Sbjct: 119 GLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVA 178

Query: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239
           TRRIATIALDIALQRL+  G ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG I Y
Sbjct: 179 TRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQY 238

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299
           NEQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP
Sbjct: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 298

Query: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           CHGSAPDIAG+GIANPIATIRSTALMLEFLG+ +AAQ I++AV++N+REN+IKTPDLGG 
Sbjct: 299 CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGK 358

Query: 360 STTQQVTEDVLARL 373
           STTQQV +D+L+++
Sbjct: 359 STTQQVVDDILSKI 372

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/373 (80%), Positives = 342/373 (91%), Gaps = 6/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR + ++ A    R+YA+ +  K+LTIGLIPGDGIGKEVIPAG+QVLENL+SKHGLKFD
Sbjct: 1   MLRASFTQLAR---RSYASAS--KSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFD 55

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAG+QTF +TGKALPDET+ +L++QCQGALFGAVQSPT KVEGYSSPIVALRK++G
Sbjct: 56  FIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+ANVRPVKSV   ++RPVDM+IVRENTEDLYIK EKTYID+ TGTRVAEA KRISE AT
Sbjct: 116 LYANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 174

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           + IA IAL+IALQR KVNG+ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+GSI YN
Sbjct: 175 KNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYN 234

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYRMFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPC
Sbjct: 235 EQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPC 294

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGI+NP+ATIRSTALMLEF+GH +AAQDIH+AV+AN+R+N IKTPDLGG S
Sbjct: 295 HGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKS 354

Query: 361 TTQQVTEDVLARL 373
           TTQQV EDVL+R+
Sbjct: 355 TTQQVVEDVLSRM 367

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/373 (80%), Positives = 340/373 (91%), Gaps = 5/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           M+RT   RF   + R YA+NA  KNLTIGLIPGDGIGKEVIPAGK++LE+LN K+GL F 
Sbjct: 1   MMRT---RFIQLSRRAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFK 55

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDLQAG++TF +TGKALPDET+ +LK+QC+GALFGAVQSPTTKVEGYSSPIVALRK +G
Sbjct: 56  FIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLG 115

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           LFANVRPVKSV GTKDR VD+VIVRENTEDLYIK+EK+YID+ATGTRVA+ATKRI+EIAT
Sbjct: 116 LFANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIAT 175

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           + IATIAL IA QRL+ NG ATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG + YN
Sbjct: 176 KNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYN 235

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPC
Sbjct: 236 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPC 295

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGI+NPIATIRSTALMLEFLG+ + A+DIH+AV+AN+RE K  TPDLGGNS
Sbjct: 296 HGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNS 355

Query: 361 TTQQVTEDVLARL 373
           TTQQV EDVL++L
Sbjct: 356 TTQQVLEDVLSKL 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/373 (79%), Positives = 342/373 (91%), Gaps = 6/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLRT+ ++ A    R+Y +    K+LTIGLIPGDGIG+EVIPAGK VLENL+SKHGLKF+
Sbjct: 1   MLRTSFNQLAR---RSYTSAT--KSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFN 55

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL+AG+QTFLDTGKALPDET+ +LK++CQGALFGAVQSPT KVEGYSSPIVALRK++G
Sbjct: 56  FIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+ANVRPVKSV  ++++P+DMVIVRENTEDLYIK EKTYID+ TGTRVAEA KRISE+AT
Sbjct: 116 LYANVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVAT 174

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           R IA IAL+IALQR KVNG ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+GSI YN
Sbjct: 175 RNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYN 234

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPC
Sbjct: 235 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPC 294

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGI+NP+ATIRSTALMLEF+GH +AAQDIH+AV+AN+R+N +KTPDLGG S
Sbjct: 295 HGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKS 354

Query: 361 TTQQVTEDVLARL 373
           TTQQV +DVL+R+
Sbjct: 355 TTQQVVDDVLSRM 367

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/373 (78%), Positives = 334/373 (89%), Gaps = 3/373 (0%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR    R   +  R    N  R NLTIGLIPGDGIGKEVIPAGK+VLE +  K+ + F 
Sbjct: 1   MLRNGVYR---ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFK 57

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL AG+QTFLDTGKALPDETV +LK QCQGALFGAVQSPTTKVEGYSSPIVALRK++G
Sbjct: 58  FIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+AN+RPVKSVSGT DRPVDMVIVRENTEDLYIK E+TYID+ATGT+VAEATKRISE+AT
Sbjct: 118 LYANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVAT 177

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           R+IA IALDIALQRLK  GKATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG+++YN
Sbjct: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYN 237

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPC
Sbjct: 238 EQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPC 297

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDI+G+GI+NP+ATIRS ALML+FLG+N+AA+DI  AV+ N+R  KIKTPDLGG+S
Sbjct: 298 HGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDS 357

Query: 361 TTQQVTEDVLARL 373
           +T +VT+D+L++L
Sbjct: 358 STTEVTDDILSKL 370

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/373 (78%), Positives = 330/373 (88%), Gaps = 5/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           M R++ ++ A    R Y+     K++ IGLIPGDGIGKEVIPAGKQVLE L SKHGL+FD
Sbjct: 1   MFRSSVAKVAAR--RAYSAP---KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFD 55

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           FIDL+AG++ F   GKALPD+TV+VLK QCQGALFGAVQSPTTKV GYSSPIVALRKE+G
Sbjct: 56  FIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELG 115

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+ANVRPVKSV    DR VDM+IVRENTEDLYIK EKTY+D+ATGTRVAEA KRISE+AT
Sbjct: 116 LYANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVAT 175

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           R+IATIALDI+LQRLK  G ATLTVTHKSNVLSQSDGLFREICKDVYE NKDKYG + YN
Sbjct: 176 RKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYN 235

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 236 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 295

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDIAGKGI+NPIATIRSTALMLEFLGH + AQDI++AV+AN+ +  + TPDLGG +
Sbjct: 296 HGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKA 355

Query: 361 TTQQVTEDVLARL 373
           TTQQV +D+L+++
Sbjct: 356 TTQQVVDDILSKI 368

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/374 (78%), Positives = 331/374 (88%), Gaps = 6/374 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALR-KNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKF 59
           MLRT+  +F+ S     A NA   K LTIGLIPGDGIGKEVIPAGKQVL+NLN KHGL F
Sbjct: 1   MLRTSVRQFSVS-----ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAF 55

Query: 60  DFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEM 119
           +FIDLQAG+QTFLDTG ALP +TV +LK++CQGALFGAVQSPTTKVEGYSSPIV LRKE+
Sbjct: 56  EFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKEL 115

Query: 120 GLFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIA 179
           GLFANVRPVK+V GT  +P+D+VIVRENTEDLYIKIEKTY D   G+R+AEATKRI+E A
Sbjct: 116 GLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETA 175

Query: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239
           T+RIA  ALDIALQRLK  G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + Y
Sbjct: 176 TKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAY 235

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299
           NEQIVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEP
Sbjct: 236 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP 295

Query: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           CHGSAPDIAGKGIANPIATIRSTA MLE+LG+++ AQDI++AV+AN+R+NKIKT DLGG+
Sbjct: 296 CHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGD 355

Query: 360 STTQQVTEDVLARL 373
           STTQQV +D+L +L
Sbjct: 356 STTQQVIDDILGKL 369

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/359 (79%), Positives = 318/359 (88%)

Query: 15  RTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDT 74
           RT    + + NLTIGLIPGDGIGKEVIP+G+QVLE +  KHGL F+FIDLQAG+QTFLDT
Sbjct: 13  RTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDT 72

Query: 75  GKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGT 134
           GKALP ETV+ L+  C GALFGAVQSPTTKVEGYSSPIVALRKE+GL+AN+RPVKSV   
Sbjct: 73  GKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTP 132

Query: 135 KDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQR 194
            ++ VDMVIVRENTEDLYIK+EKTYID+ TGTRVA+ATKRISE+ATRRIA IALDIALQR
Sbjct: 133 GNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQR 192

Query: 195 LKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFRE 254
           LK NG   LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  I YNEQI+DSMVYR+FRE
Sbjct: 193 LKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFRE 252

Query: 255 PQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIAN 314
           P+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSAPDIAGKGI+N
Sbjct: 253 PECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISN 312

Query: 315 PIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           PIATIRSTALMLEFLGH+ AAQDI  AV++N+RE+KIKTPDLGG ++T  V  DV+ RL
Sbjct: 313 PIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/373 (75%), Positives = 321/373 (86%), Gaps = 7/373 (1%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR    + +T   RTY T+   K+ TIGLIPGDGIGKEVIP G++VLE +  K+G+ F 
Sbjct: 1   MLRVGRGQLST---RTYVTS---KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFK 54

Query: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120
           +IDLQAG+QTFLDTGKALPD+TV+ L++ CQGALFGAVQSPTTKV+GYSSPIVALRK +G
Sbjct: 55  YIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALG 114

Query: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180
           L+AN+RPVKSV GT DRPVD+VI RENTEDLYIK E+TYIDK TG RVAEA KRISE AT
Sbjct: 115 LYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHAT 174

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240
           R IA IAL+IALQRLK  G ATLTVTHKSNVLSQSDGLFREICK VY+SNK K+ ++ YN
Sbjct: 175 RNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYN 233

Query: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300
           EQIVDSMVYR+F+EPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPC
Sbjct: 234 EQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPC 293

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
           HGSAPDI G+GIANPIATIRS AL+LEFLG  +AA+ I + V+ N+RENKIKTPDLGGNS
Sbjct: 294 HGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNS 353

Query: 361 TTQQVTEDVLARL 373
           T +QV  D+L+R+
Sbjct: 354 TGEQVANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/356 (70%), Positives = 307/356 (86%), Gaps = 1/356 (0%)

Query: 18  ATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKA 77
           AT A  K LTIGLIPGDGIGKEVIPAG++VLE +  KH ++F +  L AG+QTFL+TG A
Sbjct: 13  ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNA 72

Query: 78  LPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR 137
           LP  TV+ L+ +CQGALFGAVQSPTTKVEGYSSPIVALR+++GL+AN+RPVKSVSGT  +
Sbjct: 73  LPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGT-GQ 131

Query: 138 PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKV 197
           PVD+VIVRENTEDLY++ E+TY+D ATG RVAEA KRISE AT RIA I+L +ALQR ++
Sbjct: 132 PVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRM 191

Query: 198 NGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQC 257
            G+  LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YGSI YNEQIVDSMVYR+F+EP C
Sbjct: 192 GGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHC 251

Query: 258 FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIA 317
           FDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSAPDIAG+GIANPIA
Sbjct: 252 FDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIA 311

Query: 318 TIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           TIRS +LML+FLG  +AA DI +AV  N+++ ++ +PDLGG +TTQ+V +D+LAR+
Sbjct: 312 TIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  191 bits (486), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 132/350 (37%), Positives = 186/350 (53%), Gaps = 24/350 (6%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+ LIPGDGIGKEV  +  Q+ E  N    + ++ ++L A     L+       + V+ L
Sbjct: 31  TVTLIPGDGIGKEVTDSVVQIFEAENVP--VDWESVELSA-----LEENHEGVQKAVESL 83

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSG--TKDRPVDMVIV 144
           K    G L G   +P  +  G+ S  VA RK++ +FANV   KS  G  TK + VD+VI+
Sbjct: 84  KRNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVII 141

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  +E   +       V E+ K +++  + RIA  A D AL+    N +  + 
Sbjct: 142 RENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALK----NNRKAVC 192

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVAP 264
             HK+N++   DGLFR     V E    +Y  +  +  IVD+   +   +P  FDV+V P
Sbjct: 193 AVHKANIMKLGDGLFRNT---VSEIGAKEYPEVNVSSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 265 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 323
           NLYG IL +  AAL+G  G+VP AN G E  + EP C     DI G+ +ANP A I S+ 
Sbjct: 250 NLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSST 309

Query: 324 LMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           LML  LG N+ A  I RA    + E K  T D+GG +TT + T  V+ +L
Sbjct: 310 LMLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKL 359

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  190 bits (483), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 191/355 (53%), Gaps = 31/355 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDGIG E+  + K++    N    ++++F D+   F   L T   +PD  VQ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSAANVP--IEWEFCDVNPIFVNGLTT---IPDPAVQSI 92

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KSV G K     VD+V++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   +DGLF  + K++      +Y  IT   +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSV 256

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G  + A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 317 SVMMLNHMGLTNYADQIQNAVLSTIASGPEN--RTGDLAGAATTSSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  189 bits (479), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 133/355 (37%), Positives = 189/355 (53%), Gaps = 31/355 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDGIG E+  + K++    +    + ++F D+   F   L T   +PD  VQ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+V++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   +DGLF  + K++      +Y  IT+  +++D+ V  +   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAGK  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G    A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  188 bits (477), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 137/376 (36%), Positives = 199/376 (52%), Gaps = 28/376 (7%)

Query: 5   AASRFATSTCR-TYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFID 63
           +ASR   S  R T   N      T+  I GDGIG E+  + K +     +K  +++++ D
Sbjct: 16  SASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCD 73

Query: 64  LQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFA 123
           +   F   L T   +PD  VQ +      AL G + +P  K  G+ S  + LRK  GLFA
Sbjct: 74  VTPIFINGLTT---IPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFA 127

Query: 124 NVRPVKSVSGTKD--RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATR 181
           NVRP KS+ G K     VD+V++RENTE  Y  IE           V ++ K I+  A+ 
Sbjct: 128 NVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASE 182

Query: 182 RIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNE 241
           R+   A + A    +  G+  + V HKS +   +DGLF  + ++V      +Y  I    
Sbjct: 183 RVIRYAFEYA----RAVGRPKVVVVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQP 234

Query: 242 QIVDSMVYRMFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGE 298
           +++D+ V  +  +P+ +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E
Sbjct: 235 ELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFE 294

Query: 299 PCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANM-RENKIKTPDLG 357
             HGSAPDIAG+  ANP A + S+ +ML  +G ++ A  I  AV A +  + K +T DL 
Sbjct: 295 AVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLA 354

Query: 358 GNSTTQQVTEDVLARL 373
           G +TT   T+ V+ RL
Sbjct: 355 GTATTSSFTKAVIERL 370

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  187 bits (476), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 132/352 (37%), Positives = 189/352 (53%), Gaps = 29/352 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDF--IDLQAGFQTFLDTGKALPDETVQ 84
           T+ LIPGDGIGKEV  +  ++     +  GL  D+  ID+  G     +  KA     V+
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIF----ASQGLPIDWERIDV-PGMSNENEVKKA-----VE 79

Query: 85  VLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMV 142
            LK    G     +   +    GY S  VALRK++ +FANV   KS+ G K +   VD+V
Sbjct: 80  SLKRNKIG--LKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLV 137

Query: 143 IVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKAT 202
           ++RENTE  Y  +E   +       V E+ K I++  T RIA  A D AL+    N ++T
Sbjct: 138 VIRENTEGEYSGLEHESVPG-----VVESLKIITKPKTERIARFAFDFALE----NNRST 188

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIV 262
           +T  HK+N++  SDGLF+    +V E    +Y  I  N  IVD+   +   +P  FDV+V
Sbjct: 189 VTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDIKVNTIIVDNASMQAVAKPHQFDVMV 245

Query: 263 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRS 321
            P++YG IL +  AAL+G  G++P AN G E  + EP       DI  + IANP A I S
Sbjct: 246 TPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILS 305

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
             LML  LG  + ++ I  AV A + E K  T D+GGN++T + T+ V+ +L
Sbjct: 306 ATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  187 bits (475), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/368 (35%), Positives = 192/368 (52%), Gaps = 25/368 (6%)

Query: 9   FATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGF 68
           FAT               T+ LIPGDG+GKEV  +  ++ EN N    + ++ ID+ +G 
Sbjct: 13  FATLAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDI-SGL 69

Query: 69  QTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPV 128
           +   +  +A     V+ LK    G L G   +P  +  G+ S  VALRK++ +FANV   
Sbjct: 70  ENTENVQRA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALF 122

Query: 129 KSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATI 186
           KS+ G K R   +DMVI+RENTE  Y  +E   +       V E+ K ++   + RIA  
Sbjct: 123 KSIPGVKTRLNNIDMVIIRENTEGEYSGLEHESVPG-----VVESLKIMTRAKSERIARF 177

Query: 187 ALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDS 246
           A D AL+    N + ++   HK+N++   DGLFR    ++     ++Y  +     IVD+
Sbjct: 178 AFDFALK----NNRKSVCAVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDN 230

Query: 247 MVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAP 305
              +   +P  FDV+V PNLYG IL +  +AL+G  G+VP AN G E  + EP       
Sbjct: 231 ASMQAVAKPHQFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGL 290

Query: 306 DIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           DI G+ +ANP A I S+ LML  LG N  A  I +A    + E K  T D+GG+++T + 
Sbjct: 291 DIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEF 350

Query: 366 TEDVLARL 373
           T  V+ +L
Sbjct: 351 TNAVIEKL 358

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  187 bits (475), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/354 (37%), Positives = 192/354 (54%), Gaps = 27/354 (7%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+  I GDGIG E+  + KQ+ +   +K  + ++  D+   F   L T   +P+  VQ 
Sbjct: 37  FTVSFIEGDGIGPEISQSVKQIFDA--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQS 91

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVI 143
           +      AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+VI
Sbjct: 92  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  +
Sbjct: 149 IRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAYEYA----RAIGRPRV 199

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VI 261
            V HKS +   +DGLF ++ K++ +    +Y  I    +++D+ V  +   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVDVAKELSQ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255

Query: 262 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIR 320
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 321 STALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
           S+ +ML  +G N+ A  I +AV + +    + +T DL G +TT   T+ V+ RL
Sbjct: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  187 bits (475), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 190/353 (53%), Gaps = 27/353 (7%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDGIG E+  + KQ+     +K  ++++  D+      F+D    +P+  VQ +
Sbjct: 91  TVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP +SV G K     VD+V++
Sbjct: 146 NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+    +  A +  +  G+  L 
Sbjct: 203 RENTEGEYSGIEHVVTPG-----VVQSIKLITREASERV----IRYAFEYCRAIGRPRLV 253

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   SDGLF  + K++      +Y  I +  +++D+ V ++   P  +   V V
Sbjct: 254 VVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PS N+G EI I E  HGSAPDIAGK +ANP A + S
Sbjct: 310 CPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G +  A  I  AV + +    + +T DL G +TT   T+ V+ +L
Sbjct: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  185 bits (470), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 190/355 (53%), Gaps = 31/355 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDGIG E+  + K++    N    ++++  D+   F   L T   +PD  VQ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IPDPAVQSI 92

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+V++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   +DGLF  + K++      +Y  +T   +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G  + A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  185 bits (470), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/355 (37%), Positives = 190/355 (53%), Gaps = 31/355 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDGIG E+  + K++    N    ++++  D+   F   L T   +PD  VQ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFNAANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSI 92

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
            +    AL G + +P  K  G+ S  + LRK  GLFANVRP KSV G K     VD+V++
Sbjct: 93  TNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G  + A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  185 bits (469), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 195/353 (55%), Gaps = 27/353 (7%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDG+G E+  + K +     +K  ++++  D+   F   L T   +PD  V  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASI 91

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     V++V++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE      A G  V ++ K I++ A+ R+   A + A    +   ++ + 
Sbjct: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVL 199

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   +DGLF ++ K +      +Y  I    +++D+ V +  + P+ +D  V+V
Sbjct: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G  + A  I +AV   +  + K +T DLGG+++T   T+ V+ RL
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  184 bits (468), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/350 (36%), Positives = 185/350 (52%), Gaps = 24/350 (6%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+ LIPGDG+GKEV  +   + E  N         ID ++   + L+       + V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEAENVP-------IDWESVELSGLEENMEGVQKAVESL 83

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSG--TKDRPVDMVIV 144
           K    G L G   +P  +  G+ S  VA RK++ +FANV   KS  G  TK + VD+VI+
Sbjct: 84  KRNKVG-LKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVII 141

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  +E   +       V E+ K +++  + RIA  A D AL+    N + ++ 
Sbjct: 142 RENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALK----NNRRSVC 192

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVAP 264
             HK+N++   DGLFR    ++      +Y  +     IVD+   +   +P  FDV+V P
Sbjct: 193 AVHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 265 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 323
           NLYG IL +  AAL+GS G+VP AN G E  + EP       DI G+ +ANP A I S+ 
Sbjct: 250 NLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSST 309

Query: 324 LMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           LML  LG ND A  I +A    + E K  T D+GG+++T Q T+ ++ +L
Sbjct: 310 LMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  184 bits (467), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 134/383 (34%), Positives = 194/383 (50%), Gaps = 35/383 (9%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNL----TIGLIPGDGIGKEVIPAGKQVLENLN---S 53
           MLR+       S     A   L K      T+ LIPGDG+GKEV  +   + E+ N    
Sbjct: 1   MLRSGLGVSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPID 60

Query: 54  KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIV 113
              ++   +D Q G Q           + V+ LK    G L G   +P+ +  G+ S  V
Sbjct: 61  WETVEISGLDNQEGVQ-----------KAVESLKRNKVG-LKGIWHTPSDQT-GHGSLNV 107

Query: 114 ALRKEMGLFANVRPVKSVSGTKDRP--VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEA 171
           ALRK++ +FANV   KSV G   R   VDMV++RENTE  Y  +E   +       V E+
Sbjct: 108 ALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPG-----VVES 162

Query: 172 TKRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK 231
            K +++  + RI   A D A++    N + ++   HK+N++   DGLFR    +V     
Sbjct: 163 LKIMTKAKSERIGRFAFDFAVK----NNRKSVCAVHKANIMKLGDGLFRNCINEV---GA 215

Query: 232 DKYGSITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 291
            +Y  I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G
Sbjct: 216 KEYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFG 275

Query: 292 PEIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENK 350
            E  + EP       DI G+ +ANP A I S++LML  LG N  A  I +A    + E K
Sbjct: 276 REYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAK 335

Query: 351 IKTPDLGGNSTTQQVTEDVLARL 373
             T D+GG+++T + TE ++++L
Sbjct: 336 TTTQDIGGSASTTEFTEAIISKL 358

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  184 bits (466), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 190/352 (53%), Gaps = 27/352 (7%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLK 87
           +  I GDGIG E+  + K + +   ++  + ++F D+   F   L T   +PD  V  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IPDPAVASIN 97

Query: 88  SQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIVR 145
                AL G + +P  K  G+ S  + LRK   LFANVRP KS+ G K     VD+V++R
Sbjct: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 146 ENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLTV 205
           ENTE  Y  IE      A G  V ++ K I+  A+ R+   A + A    K  G+  + V
Sbjct: 155 ENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205

Query: 206 THKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIVA 263
            HKS +   +DGLF  + K++ +    +Y  I    +++D+ V  +   P  +   V V 
Sbjct: 206 VHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261

Query: 264 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRST 322
           PNLYGDILSD  + L  GSLG+ PSAN+G EI I E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321

Query: 323 ALMLEFLGHNDAAQDIHRAVEANM-RENKIKTPDLGGNSTTQQVTEDVLARL 373
            +ML  +G  D A  I RAV   +   +K +T DLGG++TT   T+ V+  L
Sbjct: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 129/350 (36%), Positives = 186/350 (53%), Gaps = 25/350 (7%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+ LIPGDG+GKEV  +   + E  N         ID +    T +D+ + +  + V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFEAENVP-------IDWETINITGVDSEEGV-QKAVESL 82

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIV 144
           K    G L G   +P  +  G+ S  VA RK++ +FANV   K+V G K +   +D+V++
Sbjct: 83  KRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLVVI 140

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  +E   +       V E+ K I++  + RIA  A D AL+    N + ++ 
Sbjct: 141 RENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIARFAFDFALK----NNRKSVC 191

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVAP 264
             HK+N++   DGLFR    +V  S   +Y  I     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEVGAS---EYPEIDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 265 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 323
           NLYG IL +  AAL+G  G+VP AN G E  + EP       DI GK +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSST 308

Query: 324 LMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           LML  LG N  A  I +A    + E K  T D+GG+S+T + T+ V+ +L
Sbjct: 309 LMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  182 bits (461), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 188/353 (53%), Gaps = 25/353 (7%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDGIG E+  + K + +  +    + ++  D+       +D    +PDE V+ +
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIV 144
                G L G + +P  K  G+ S  + LRK   LFANVRP KSV G K     VD+V++
Sbjct: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    K  G+  + 
Sbjct: 157 RENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGRPKVI 207

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   SDGLF  + K++ +  +  + +I  + +++D+ V  +   P  +   V V
Sbjct: 208 VVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 266 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLLS 325

Query: 322 TALMLEFLGHNDAAQDIHRAVEANM-RENKIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G N+    I  AV   +   +K +T DLGG +TT   TE V+  L
Sbjct: 326 SVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  181 bits (459), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 140/396 (35%), Positives = 208/396 (52%), Gaps = 46/396 (11%)

Query: 1   MLRTAASR------FATS-TCRTY--------ATNALRKNLTIGLIPGDGIGKEVIPAGK 45
           MLRT A++      F+TS T R          + N      T+  I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 46  QVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKV 105
            + +   ++  + +++ D+       L T   +P+  VQ +    + AL G + +P  K 
Sbjct: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT---IPEPAVQQINKH-KIALKGPLATPIGK- 113

Query: 106 EGYSSPIVALRKEMGLFANVRPVKSVSG--TKDRPVDMVIVRENTEDLYIKIEKTYIDKA 163
            G+ S  + LRK  GLFANVRP +S+ G  T  + VD+V++RENTE  Y  IE      A
Sbjct: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169

Query: 164 TGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREIC 223
            G  V ++ K I+  A+ R+   A + A    +  G+  L V HKS +   +DGLF  I 
Sbjct: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223

Query: 224 KDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIVAPNLYGDILSDGAAAL-VG 280
           K++      ++  I    +++D+ V  + R+P  +   V V PNLYGDILSD  + L  G
Sbjct: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAG 279

Query: 281 SLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHR 340
           SLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    +  I  
Sbjct: 280 SLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339

Query: 341 AVE---ANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           A+    A+  EN  +T DL G +TT   TE V+  L
Sbjct: 340 AILNTIASGSEN--RTGDLAGTATTSSFTESVIKNL 373

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 185/353 (52%), Gaps = 31/353 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLN---SKHGLKFDFIDLQAGFQTFLDTGKALPDETV 83
           T+ LIPGDG+GKEV  +   + E+ N       ++   +D + G Q  +D+         
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEISGLDNEEGVQKAVDS--------- 80

Query: 84  QVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDRP--VDM 141
             LK    G L G   +P+ +  G+ S  VALRK++ +FANV   K+V G   R   VD+
Sbjct: 81  --LKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 142 VIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKA 201
           V++RENTE  Y  +E   +       V E+ K +++  + RI   A D AL+    N + 
Sbjct: 137 VVIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSDRIGRFAFDFALK----NNRK 187

Query: 202 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVI 261
           ++   HK+N++   DGLFR  C  + E    +Y  I     IVD+   +   +P  FDV+
Sbjct: 188 SVCAVHKANIMKLGDGLFRN-C--INEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFDVL 244

Query: 262 VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIR 320
           V PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A I 
Sbjct: 245 VTPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMIL 304

Query: 321 STALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           S+ALML  LG N  A  I +A    + E K  T D+GG+++T   T+ ++ +L
Sbjct: 305 SSALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  178 bits (451), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 191/351 (54%), Gaps = 26/351 (7%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
           +T+ L+PGDG+GKE+  +   + +  N    + ++ +D+       LD    + +  V+ 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP--IDWETVDISQ-----LDHEDGV-NAAVES 80

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVI 143
           LK    G L G   +   +V G+ S  VA RK++ ++ANV   KS+ G K +   VD+VI
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  Y  +E   +       V E+ K ++++ + RIA  A D A++    + +  +
Sbjct: 139 IRENTEGEYSGLEHESVPG-----VVESLKIVTKVNSERIAKFAFDFAMR----HDRKMV 189

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA 263
           T  HK+N++  SDGLFR     V E+    Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 264 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRST 322
           P++YG IL +  AAL+G  G+VP  N G E  + EP       DI G+ +ANP A I S+
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 323 ALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
            L+L+ LG ND A  I +AV   ++E    T D+GGN++T + T+ V+ +L
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  178 bits (451), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 200/378 (52%), Gaps = 31/378 (8%)

Query: 3   RTAASRFATSTCRTYATNALRKN----LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLK 58
           RT A R   +  +  A  AL K      T+ LIPGDG+GKE+  + K + E    K  + 
Sbjct: 4   RTIAKRTLATAAQ--AERALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFEA--EKIPVD 59

Query: 59  FDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKE 118
           ++ ++++   QT    G     E V+ LK    G L G   +P  +  G+ S  VALRK+
Sbjct: 60  WETVNIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQ 111

Query: 119 MGLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRIS 176
           + ++ANV   KS+ G K R   +D++++RENTE  +  +E   +       V E+ K ++
Sbjct: 112 LDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKIMT 166

Query: 177 EIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGS 236
              T RIA  A D A    K N KA +T  HK+N++   DGLFR I  ++    + +Y  
Sbjct: 167 RPKTERIARFAFDFAK---KYNRKA-VTAVHKANIMKLGDGLFRNIITEI---GQKEYPD 219

Query: 237 ITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI 296
           I  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  +
Sbjct: 220 IDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAV 279

Query: 297 GEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPD 355
            EP       DI G+ +ANP A I S+ LML  LG N+ A  I +AV   + E K  T D
Sbjct: 280 FEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKD 339

Query: 356 LGGNSTTQQVTEDVLARL 373
           +GG+S+T   T +++ +L
Sbjct: 340 IGGSSSTTDFTNEIINKL 357

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  178 bits (452), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 190/355 (53%), Gaps = 31/355 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDG+G E+  A K +     +K  ++++  D+   F   L T   +P      +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWESCDVSPLFINGLTT---IPQPAQDSI 91

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KSV G K     VD+V++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIA--LQRLKVNGKAT 202
           RENTE  Y  IE           V ++ K I++ A+ R+   A + A  ++R KV     
Sbjct: 149 RENTEGEYSGIEHV-----VSPGVVQSIKLITQDASERVIRYAFEYARAVERPKV----- 198

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--V 260
             V HKS +   +DGLF  + + + +    +Y  I    +++D+ V    R+P  +   V
Sbjct: 199 -VVVHKSTIQRLADGLFVSVAEQLSK----EYPDIELQTELIDNTVLHTVRDPTKYSDVV 253

Query: 261 IVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATI 319
           +V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A +
Sbjct: 254 VVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 320 RSTALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
            S+ +ML  +G  + A  I +AV   +    + +T DLGG+++T    E V++RL
Sbjct: 314 LSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  178 bits (451), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 125/360 (34%), Positives = 192/360 (53%), Gaps = 27/360 (7%)

Query: 20  NALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALP 79
           N +    T+  I GDG+G E+  + K +     +K  ++++  D+   F   L T   +P
Sbjct: 30  NPVTGKYTVPFIEGDGVGPEISKSVKDIFAA--AKVPIEWEPCDVGPIFVNGLTT---IP 84

Query: 80  DETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--R 137
           D  VQ +      AL G + +P  K  G+ S  + LRK   LFANVRP +SV   K   +
Sbjct: 85  DAAVQSINKHLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQ 141

Query: 138 PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKV 197
            VD+V++RENTE  Y  IE           V ++ K I++ A+ R+    +  A +  + 
Sbjct: 142 NVDLVLIRENTEGEYSGIEH-----VISPGVIQSIKLITKDASERV----IRYAFEYTRA 192

Query: 198 NGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQC 257
            G+  L V HKS +   +DGLF  + K++      +Y  I    +++D+ +  +   P+ 
Sbjct: 193 IGRPRLVVVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPES 248

Query: 258 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIAN 314
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  AN
Sbjct: 249 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKAN 308

Query: 315 PIATIRSTALMLEFLGHNDAAQDIHRAVEANMRE-NKIKTPDLGGNSTTQQVTEDVLARL 373
           P A + S+ +ML  +G N+ A  I  A+ + +   ++ +T DL G +TT   TE V+ +L
Sbjct: 309 PTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  177 bits (450), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 189/351 (53%), Gaps = 25/351 (7%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+ LIPGDG+GKE+  + + + E  N    + ++ I+++   QT    G     E V+ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEAENIP--IDWETINIK---QTDHKEGVY---EAVES 80

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVI 143
           LK    G L G   +P  +  G+ S  VALRK++ ++ANV   KS+ G K R   +D+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  +  +E   +       V E+ K ++   T RIA  A D A    K   + ++
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKVMTRPKTERIARFAFDFA----KKYNRKSV 189

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA 263
           T  HK+N++   DGLFR I  ++    + +Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 264 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRST 322
           P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ +ANP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 323 ALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
            LML  LG N+ A  I +AV   + E K  T D+GG+S+T   T +++ +L
Sbjct: 307 TLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  177 bits (450), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 187/353 (52%), Gaps = 27/353 (7%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDG+G E+  + K +    N    +++   D+   F   L T   +P+  V+ +
Sbjct: 45  TVPFIEGDGVGPEISKSVKDIFSAANVP--IQWQPCDVGPIFVNGLTT---IPEPAVKAI 99

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
           K     AL G + +P  K  G+ S  + LRK   LFANVRP KSV   K     VD+V++
Sbjct: 100 KESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLI 156

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ ++   A + A+      G+  L 
Sbjct: 157 RENTEGEYSGIEHIVTPG-----VVQSIKLITREASEKVIRYAYEYAIAV----GRPRLI 207

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +    DGLF +I  ++    + +Y SI    QI+D+ V  +   P  +   V V
Sbjct: 208 VVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSV 263

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 264 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 323

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G  + A  I  AV + +    + +T DLGG++TT   TE V+ +L
Sbjct: 324 SVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 193/389 (49%), Gaps = 47/389 (12%)

Query: 1   MLRTAASR--FATSTCRTYATNALRKN----LTIGLIPGDGIGKEVIPAGKQVLENLNSK 54
           MLR+A  +  FA+      A   L K       + LIPGDG+GKEV  +   + E  N  
Sbjct: 1   MLRSAVGKRMFASVAA---AEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAEN-- 55

Query: 55  HGLKFDF-------IDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEG 107
             L  D+       +D + G Q  +D+           LK    G L G   +      G
Sbjct: 56  --LPIDWDRVDISGLDHEEGVQAAVDS-----------LKRNKIG-LKGIWHTSAADQAG 101

Query: 108 YSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATG 165
             S  VALRKE+ ++ANV   KSV G K +   VD+V++RENTE  Y  +E   +     
Sbjct: 102 KGSLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG--- 158

Query: 166 TRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKD 225
             V E+ K ++E  T RIA  A D A    K   +  +T  HK+N++   DGLFR +   
Sbjct: 159 --VVESLKIMTEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNVVTR 212

Query: 226 VYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVV 285
           V E    +Y  +     IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V
Sbjct: 213 VGEQ---EYPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLV 269

Query: 286 PSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEA 344
             AN G E  + EP       DI  K IANP A I S +LML+ LG + +A  I  AV  
Sbjct: 270 AGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQ 329

Query: 345 NMRENKIKTPDLGGNSTTQQVTEDVLARL 373
            + E K  TPD+GG+++T + T+ V+ +L
Sbjct: 330 VIAEGKSTTPDIGGSASTTEFTQAVIEKL 358

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 191/355 (53%), Gaps = 31/355 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDG+G E+  + K +    +    +++++ D+       L T   +P+  V  +
Sbjct: 36  TVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI 90

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+V++
Sbjct: 91  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 148 RENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKVV 198

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA- 263
           V HKS +   +DGLF  + +++      +Y  I    +++D+ V  +  +P+ +  +VA 
Sbjct: 199 VVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAV 254

Query: 264 -PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 255 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLS 314

Query: 322 TALMLEFLGHNDAAQDIHRAVE---ANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G ++ A  I +AV    A+ REN  +T DL G ++T   T  V+ RL
Sbjct: 315 SVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTNAVIERL 367

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 191/356 (53%), Gaps = 31/356 (8%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+  I GDG+G E+  + K++     S   +  +++    G   F++    +P+  V++
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIF----SAAKVPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVI 143
           +      AL G + +P  K  G+ S  + LRK   LFANVRP +S+   K     VD+V+
Sbjct: 91  INKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  Y  IE           V ++ K I+  AT R+    +  A +  +  G+  L
Sbjct: 148 IRENTEGEYSGIEHVITPG-----VIQSIKLITREATERV----VRYAFEYTQAIGRPRL 198

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VI 261
            V HKS +   +DGLF ++ +++      +Y  I    +I+D  +  +  +P+ +   V 
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAVS 254

Query: 262 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIR 320
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 321 STALMLEFLGHNDAAQDIHRAVE---ANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           S+ +ML+ +G ++ A  I  AV    A+  EN  +T DL G ++T   TE+V+ RL
Sbjct: 315 SSVMMLKHMGLDEHANKIENAVLTTIASGSEN--RTADLSGTASTSSFTEEVIQRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 203/390 (52%), Gaps = 48/390 (12%)

Query: 7   SRFATSTCRTYAT-------------NALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNS 53
           S+F  +T R +AT             +      T+  I GDG+G E+  A K +     +
Sbjct: 4   SQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA--A 61

Query: 54  KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIV 113
           K  ++++  D+   F   L T   +P      +      AL G + +P  K  G+ S  +
Sbjct: 62  KAPIQWETCDVTPLFINGLTT---IPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNL 115

Query: 114 ALRKEMGLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEA 171
            LRK  GLFANVRP KS+ G K     VD+V++RENTE  Y  IE      A G  V ++
Sbjct: 116 TLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVV---APG--VVQS 170

Query: 172 TKRISEIATRRIATIALDIA--LQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYES 229
            K I++ A+ R+   A + A  ++R KV       V HKS +   +DGLF  + + + + 
Sbjct: 171 IKLITQDASERVIRYAFEYARAVERPKV------LVVHKSTIQRLADGLFVSVAEKLAK- 223

Query: 230 NKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVP 286
              +Y  I    +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ P
Sbjct: 224 ---EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTP 280

Query: 287 SANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANM 346
           SAN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I +AV + +
Sbjct: 281 SANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTI 340

Query: 347 R---ENKIKTPDLGGNSTTQQVTEDVLARL 373
               EN  +T DL G+++T    E V++RL
Sbjct: 341 ASGPEN--RTGDLAGSASTSSFAEAVISRL 368

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 192/351 (54%), Gaps = 25/351 (7%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+ LIPGDG+GKE+  + + + E    +  + ++ I+++   QT    G     E V+ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEA--ERIPVDWETINIK---QTDHKEGVY---EAVES 80

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVI 143
           LK    G L G   +P  +  G+ S  VALRK++ ++ANV   KS+ G K R   +D+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  +  +E   +       V E+ K +++  T RIA  A D A    K N KA +
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKVMTKPKTERIARFAFDFAK---KYNRKA-V 189

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA 263
           T  HK+N++   DGLFR I  ++ ++   +Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQT---EYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 264 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRST 322
           P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ +ANP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 323 ALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
            LML  LG N+ A  I +AV   + E K  T D+GG+S+T   T +V+ +L
Sbjct: 307 VLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  176 bits (447), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 189/354 (53%), Gaps = 27/354 (7%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+  I GDGIG E+  + K++ +  +    ++++  D+   F   L T   +PD  VQ 
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRIFQAADVP--VEWETCDVTPIFVNGLTT---IPDPAVQS 90

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVI 143
           +      AL G + +P  K  G+ S  + LRK   LFANVRP KS+ G K     VD+V+
Sbjct: 91  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVL 147

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  L
Sbjct: 148 IRENTEGEYSGIEHL-----VSPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 198

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VI 261
            V HKS +   +DGLF  + K++      +Y  I    +++D+    +   P  +   V 
Sbjct: 199 IVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNVVSNPSSYTDAVS 254

Query: 262 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIR 320
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 321 STALMLEFLGHNDAAQDIHRAVEANMR-ENKIKTPDLGGNSTTQQVTEDVLARL 373
           S+ +ML  +G  + A  I +AV   +   ++ +T DLGG+++T   T+ ++ +L
Sbjct: 315 SSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  176 bits (447), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 135/387 (34%), Positives = 199/387 (51%), Gaps = 37/387 (9%)

Query: 1   MLRTAASRFATSTCR------TYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSK 54
           +LR    RF +S  +      T   N      T+  I GDG+G E+  + K +     ++
Sbjct: 6   VLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAA--AE 63

Query: 55  HGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVA 114
             ++++  D+   F   L T   +P   V  +      AL G + +P  K  G+ S  + 
Sbjct: 64  VPVEWESCDVTPLFINGLTT---IPQPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLT 117

Query: 115 LRKEMGLFANVRPVKSVSGTKD--RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEAT 172
           LRK  GLFANVRP KSV G K     VD+V++RENTE  Y  IE           V ++ 
Sbjct: 118 LRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHV-----VSPGVVQSI 172

Query: 173 KRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKD 232
           K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF ++ K++      
Sbjct: 173 KLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL----SS 224

Query: 233 KYGSITYNEQIVDSMVYRMFREPQCF--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSAN 289
           +Y  I    Q++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN
Sbjct: 225 EYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSAN 284

Query: 290 VGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMR-- 347
           +G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I +AV + +   
Sbjct: 285 IGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASG 344

Query: 348 -ENKIKTPDLGGNSTTQQVTEDVLARL 373
            EN  +T DL G+++T   TE V+ RL
Sbjct: 345 PEN--RTADLAGSASTSSFTEAVIKRL 369

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  175 bits (443), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 192/371 (51%), Gaps = 35/371 (9%)

Query: 15  RTYATNALRKNL---------TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQ 65
           R + + A R+N+         T+ L+PGDG+G+E+  +   + E  N    + ++ ++L 
Sbjct: 9   RAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLP--IDWERVELS 66

Query: 66  AGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANV 125
              Q  + T        V+ LK    G     +   +   +G++S  VALRKE+ ++ANV
Sbjct: 67  GLEQEDVHTA-------VESLKRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANV 117

Query: 126 RPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRI 183
              KS  G   R   VD+VI+RENTE  Y  +E   +       V E+ K ++   T RI
Sbjct: 118 AIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPG-----VVESLKIMTAQKTERI 172

Query: 184 ATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQI 243
           A  A D A+   K N K ++T  HK+N++   DGLFR +   V E    +Y  +  +  I
Sbjct: 173 ARFAFDYAM---KYNRK-SVTAVHKANIMKLGDGLFRNL---VTEIGAKEYPEVGVSSII 225

Query: 244 VDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHG 302
           VD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G +  + EP    
Sbjct: 226 VDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRH 285

Query: 303 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTT 362
              DI  + IANP A I S  LML  LG  + A  I +AV   + E K  T D+GG++TT
Sbjct: 286 VGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATT 345

Query: 363 QQVTEDVLARL 373
            + T  V+A+L
Sbjct: 346 TEFTNAVIAKL 356

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/351 (33%), Positives = 188/351 (53%), Gaps = 25/351 (7%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+ L+PGDG+GKE+  +   + ++ N    + ++ +D+       LD  + +    V  
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKSENVP--IDWETVDISG-----LDHTEGV-KAAVDS 79

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVI 143
           LK    G L G   +P  +V G+ S  VA RK++ ++ANV   KS+ G K +   VD+V+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  Y  +E   +       V E+ K I++  + RIA  A D A    K N + ++
Sbjct: 138 IRENTEGEYSGLEHESVPG-----VVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA 263
           T  HK+N++  SDGLFR     + E   ++Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 264 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRST 322
           P++YG I+ +  AAL+G  G+VP  N G +  + EP       DI G+ +ANP A + S 
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 323 ALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
            L+L+ LG   +A  I  AV   + E K  T D+GG+++T + T+ V+ +L
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 188/352 (53%), Gaps = 29/352 (8%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVL--ENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQ 84
           T+ LIPGDG+GKEV  +   +   ENL     + ++ +D+       LD  + + +  V 
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNAENLP----IDWERVDISG-----LDHEEGV-EAAVN 84

Query: 85  VLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMV 142
            LK    G     +   +     + S  VALRK++ ++ANV   K++ G K R   VD+V
Sbjct: 85  SLKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 143 IVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKAT 202
           I+RENTE  Y  +E   +       V E+ K I++  + RIA  A D A +R     +  
Sbjct: 143 IIRENTEGEYSGLEHESVPG-----VVESLKIITKEKSERIARFAFDFA-KRFD---RKL 193

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIV 262
           +T  HK+N++   DGLFR     + E+   +Y  I  +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 263 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRS 321
            P++YG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           + L+L+ LG N+ A+ I  AV   + E K+ T D+GG+++T + T +++ +L
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 193/373 (51%), Gaps = 33/373 (8%)

Query: 13  TCRTYATNALRKNL---------TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFID 63
           T RT AT A  + +         T+ LIPGDG+GKEV  +   + +  N    + +D +D
Sbjct: 7   TKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVP--VDWDRVD 64

Query: 64  LQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFA 123
           + +G     D   A     V+ LK    G L G   +      G+ S  VALRKE+ ++A
Sbjct: 65  I-SGVDRAEDVKSA-----VESLKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYA 117

Query: 124 NVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATR 181
           NV   KS+ G + +   VD+V++RENTE  +  +E   +       V E+ K +++    
Sbjct: 118 NVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPG-----VVESLKIMTQDNIE 172

Query: 182 RIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNE 241
           RIA  A D A    K N +  +   HK+N++   DGLF+ + ++V E    +Y  +    
Sbjct: 173 RIARFAFDYA----KKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEK---EYPELQVGN 225

Query: 242 QIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-C 300
            IVD+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN G ++ + EP  
Sbjct: 226 IIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGS 285

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360
                DI G+ +ANP A I S+ L+L  LG N +A  I +AV A + E K  T D+GG +
Sbjct: 286 RHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTA 345

Query: 361 TTQQVTEDVLARL 373
           +T + TE V+ +L
Sbjct: 346 STTEFTEAVINKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 179/353 (50%), Gaps = 27/353 (7%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           T+  I GDG+G E+  + K +          K   +         L  G     E  Q  
Sbjct: 40  TVSFIEGDGVGPEISKSVKDIFA------AAKVPIVWESCPVTPLLVNGVTTIPEQAQES 93

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP KSV G K     VD+V++
Sbjct: 94  INRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151

Query: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204
           RENTE  Y  IE   +       V ++ K I+  A+ R+   A + A    +  G+  L 
Sbjct: 152 RENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLV 202

Query: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262
           V HKS +   +DGLF  + K++     D    I    +++D+ V  +   P  +   V V
Sbjct: 203 VVHKSTIQRLADGLFVTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKYSDVVYV 258

Query: 263 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321
            PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 259 CPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 318

Query: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
           + +ML  +G  + A  I +AV   +    + +T DL G+++T   TE V++RL
Sbjct: 319 SVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  170 bits (431), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 191/355 (53%), Gaps = 27/355 (7%)

Query: 25  NLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQ 84
           N  +  I GDGIG E+  + K +     +K  + F+ + ++      ++   ++P+E  +
Sbjct: 35  NYKVSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQK 89

Query: 85  VLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMV 142
            + +    AL G + +P  K  G+ S  + LRK  GLFAN+RP KSV G K     V++V
Sbjct: 90  SINTNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLV 146

Query: 143 IVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKAT 202
           ++RENTE  Y  IE   +       V ++ K I+  A+ R+   A + A    +   +  
Sbjct: 147 LIRENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYA----RAAERPR 197

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--V 260
           L V HKS +   SDGLF ++ K++    + ++  I    +++D+ V     +P  +   V
Sbjct: 198 LIVVHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAV 253

Query: 261 IVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATI 319
            V PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIAGK  ANP A +
Sbjct: 254 SVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALL 313

Query: 320 RSTALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373
            S+ +ML  +G ++ A  I +AV   +    + +T DL G+++T   TE V+ +L
Sbjct: 314 LSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  168 bits (425), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 186/355 (52%), Gaps = 28/355 (7%)

Query: 25  NLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQ 84
           N T+  I GDG+G E+  + + + +       +  D+++   G    ++    +P   V 
Sbjct: 44  NYTVPFIEGDGVGPEISKSVRTIFK----AAKVPIDWVNCDIG-PLLINGETTIPQTAVD 98

Query: 85  VLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVS--GTKDRPVDMV 142
            + +    AL G + +P    +G+ S  + LRK  GLFANVRP KS+    +    VD++
Sbjct: 99  QINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLI 155

Query: 143 IVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKAT 202
           ++RENTE  Y  IE   +       V ++ K I+  A+ ++    +  A +  +  G++ 
Sbjct: 156 VIRENTEGEYSGIEHEIVPG-----VVQSIKLITRKASEKV----IKYAFEYTRSIGRSN 206

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCF--DV 260
           L V HK+ +  + DGLF +  +++     DKY  +    +++D+ V      P+ +   V
Sbjct: 207 LIVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSV 262

Query: 261 IVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATI 319
            V PNLYGDILSD  + L  GSLG+ PSAN+G E V+ E  HGSAPDIAG+  ANP A +
Sbjct: 263 SVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALL 321

Query: 320 RSTALMLEFLGHNDAAQDIHRAVEANMRENK-IKTPDLGGNSTTQQVTEDVLARL 373
            S+ +ML  +G    A  I  AV   +   K  +T DLGG++TT   T+ V+  L
Sbjct: 322 LSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 190/377 (50%), Gaps = 25/377 (6%)

Query: 1   MLRTAASRFATSTC-RTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKF 59
           MLR   S+ + +T   T   N      T+ L+PGDG+GKE   +   V    N    + +
Sbjct: 1   MLRRLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIP--IDW 58

Query: 60  DFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEM 119
           + +++       LD  + +    VQ L+    G L G   +      G+ S  VA RK++
Sbjct: 59  EIVNISG-----LDHKEGVA-AAVQSLRRNKIG-LKGLWHTSNADQSGHGSLNVAFRKQL 111

Query: 120 GLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISE 177
            ++ANV   KS+ G K     VD+V++RENTE  +  +E   ++      V E+ K  + 
Sbjct: 112 DIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEG-----VVESLKVTTL 166

Query: 178 IATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSI 237
             T RIA  A + A +    NG+  +   HK+N++   DGLFR     + E    +Y  I
Sbjct: 167 PKTERIARFAFNYAQK----NGRKAVCAVHKANIMKLGDGLFRNTVTSIGEK---EYPDI 219

Query: 238 TYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 297
             +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G E  + 
Sbjct: 220 ETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFGREYAVF 279

Query: 298 EP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDL 356
           EP       DI G+ IANP A + S+ALML  LG   + + I  AV   + E  ++T D+
Sbjct: 280 EPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDVRTKDI 339

Query: 357 GGNSTTQQVTEDVLARL 373
           GG++TT + T+ V+ +L
Sbjct: 340 GGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  166 bits (420), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/377 (32%), Positives = 191/377 (50%), Gaps = 26/377 (6%)

Query: 1   MLRTAASRFATSTCRTYAT-NALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKF 59
           M RT   R   S  +            T+ LIPGDG+GKE+  +   + E  N    + +
Sbjct: 1   MFRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP--VDW 58

Query: 60  DFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEM 119
           + +D+        D  +A     V+ LK    G     +   +  +  + S  VALRK++
Sbjct: 59  ERVDISTS-DNIQDVSQA-----VESLKRNKIG--LKGIWHTSADIADHGSFNVALRKQL 110

Query: 120 GLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISE 177
            +FA+V   KSV G K +   VD+V++RENTE  Y  +E   +       V E+ K I++
Sbjct: 111 DMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VVESLKIITK 165

Query: 178 IATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSI 237
             + RIA  A D A    K N K+   V HK+N++   DGLFR     V E   ++Y  I
Sbjct: 166 AKSERIARFAFDFAK---KYNRKSVCAV-HKANIMKMGDGLFRNT---VTEIGANEYPDI 218

Query: 238 TYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 297
             +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G E  + 
Sbjct: 219 QTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVF 278

Query: 298 EP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDL 356
           EP       DI GK +ANP A I S+ LML+ LG  ++A+ I +A    +   ++ T D+
Sbjct: 279 EPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTKDI 338

Query: 357 GGNSTTQQVTEDVLARL 373
           GG+++T + TE ++ RL
Sbjct: 339 GGSASTTEFTEAIIKRL 355

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  159 bits (402), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 192/379 (50%), Gaps = 39/379 (10%)

Query: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60
           MLR    R + ST    +         I LIPG+GIGKEV  + + + +  N    + ++
Sbjct: 1   MLRNTLLRRSISTI---SPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLP--IDWE 55

Query: 61  FIDLQA---GFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRK 117
            +++++   G +T +D+ K            + + AL G   S    ++G  S  VALRK
Sbjct: 56  IVNIESHRDGIKTAVDSIK------------RNKIALKGIWSS--DPIDG--SLNVALRK 99

Query: 118 EMGLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRI 175
           ++ +FANV   KS      R   VD+V++RENTE  +  +E   +D      V E+ K +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIV 154

Query: 176 SEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG 235
           ++  T RIA  A D A    K + +  +T  HK+N++   DGLF+ I   +     ++Y 
Sbjct: 155 TKPKTERIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNIVAHI---GNNEYP 207

Query: 236 SITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIV 295
            I  +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G +  
Sbjct: 208 EIKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYA 267

Query: 296 IGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTP 354
           + EP       DI G+ +ANP A I S   ML  LG    A+ I  AV+  + +    T 
Sbjct: 268 VFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTK 327

Query: 355 DLGGNSTTQQVTEDVLARL 373
           D+GG ++T + T+ V+  L
Sbjct: 328 DIGGTASTTEFTDAVINEL 346

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 124/372 (33%), Positives = 198/372 (53%), Gaps = 40/372 (10%)

Query: 24  KNLTIGLIPGDGIGKEVIPAGKQVLENLNSK-HGLKFDFIDLQAGFQTFLDTGKALPDET 82
           KN+ +  +PGD +G+E++    +VL+ +  K HG+KF+F     G      TG  LPDET
Sbjct: 5   KNIVV--LPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDET 62

Query: 83  VQVLKSQCQGALFGAVQSP---TTKVEGYSSPIVALRKEMGLFANVRPVKSVSGT----- 134
           ++  K Q    L GAV  P   T KV      ++ +RKE+GL+ N+RP K +S       
Sbjct: 63  LEAAK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLS 120

Query: 135 --KD---RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALD 189
             K+   +  D V+VRE    +Y   E+   D   G+ VA  +++ S    +RI  +A  
Sbjct: 121 PLKEEVCKGTDFVVVRELVGGIYFG-ERQEDD---GSGVAWDSEKYSIEEVKRITKMAAF 176

Query: 190 IALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVY 249
           ++LQ    +    +    K+NVL+ S      + +   +    ++ ++    Q++DS   
Sbjct: 177 LSLQN---DPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAM 228

Query: 250 RMFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHG 302
            + + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHG
Sbjct: 229 MLVKNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHG 288

Query: 303 SAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNST 361
           SAPD+A +G  NP+ATI S A+ML+  L      + I RAV   + +  I+T DLGGNST
Sbjct: 289 SAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVL-DRGIRTADLGGNST 346

Query: 362 TQQVTEDVLARL 373
           T ++ + V   L
Sbjct: 347 TSELGDAVAQEL 358

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  154 bits (389), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 126/362 (34%), Positives = 192/362 (53%), Gaps = 37/362 (10%)

Query: 30  LIPGDGIGKEVIPAGKQVLENLN-SKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKS 88
           ++PGD IG+EVI    +VL  +  ++  + F+F     G      TG  L D+T++  K+
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAKA 68

Query: 89  QCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPV----KSVSGTKD-RP-- 138
                L GAV  P     G   P   ++A+RKE+GL+AN+RP     KS+ G    +P  
Sbjct: 69  -ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 139 ---VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRL 195
               D VI+RE    +Y    K   D   G         +SE+   RI  +   +ALQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERKE--DDGDGVAWDSEKYTVSEV--ERITRMGAFLALQH- 181

Query: 196 KVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREP 255
             +    L    K+NVL+ S  L+R   + V E+ K ++  ++   Q++DS    M + P
Sbjct: 182 --DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 256 QCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE------IVIGEPCHGSAPDIA 308
           + F+ +++  N++GDI+SD A+ + GSLG++PSA++  E        + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 309 GKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTE 367
            KG ANPIA I S A+ML+  L   D  + I  AV+  + E+ I+T DLGGN+TT +V +
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGGNNTTTEVGD 353

Query: 368 DV 369
            V
Sbjct: 354 AV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  149 bits (377), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 193/364 (53%), Gaps = 37/364 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++  +  +KF+F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRP----------VKSVSG 133
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP          +  +  
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 134 TKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
              R  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
               N    +    K+NVL+ S  L+R   K V E+ K+++ ++T   Q++DS    M +
Sbjct: 181 H---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 254 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P Q   VI+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  KG  NPIATI S A+MLE  L   +    +  AV   + ++ I+T DL G+++TQ+V
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVR-RVLDSGIRTGDLRGSNSTQEV 351

Query: 366 TEDV 369
            + V
Sbjct: 352 GDAV 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  145 bits (365), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 199/370 (53%), Gaps = 39/370 (10%)

Query: 22  LRKNLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPD 80
           + KN+ +  +PGD +G+E+     +VL+ ++  +    F+F     G      TG  LPD
Sbjct: 1   MSKNIVV--LPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPD 58

Query: 81  ETVQVLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT--K 135
           E ++  K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +  +
Sbjct: 59  EALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLE 116

Query: 136 DRPV--------DMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIA 187
             P+        D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A
Sbjct: 117 LSPLKAQYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMA 172

Query: 188 LDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSM 247
             +ALQ    N    +    K+NVL+ S  L+R   K V ++ K+++ +++ N Q++DS 
Sbjct: 173 AFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSA 225

Query: 248 VYRMFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPC 300
              + + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPC
Sbjct: 226 AMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPC 285

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           HGSAPD+A KG  NP+ATI S A+ML+  L   +    I +AV+  + ++ I+T DLGG+
Sbjct: 286 HGSAPDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVK-KVLDDGIRTGDLGGS 343

Query: 360 STTQQVTEDV 369
           ++T +V + V
Sbjct: 344 NSTSEVGDAV 353

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  144 bits (364), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 193/370 (52%), Gaps = 39/370 (10%)

Query: 22  LRKNLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPD 80
           + KN+ +  +PGD +GKEV     +VL  +   +  +KF+F     G      TG  LPD
Sbjct: 1   MSKNIVV--LPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPD 58

Query: 81  ETVQVLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT--- 134
           E ++  K +    L GAV  P     G   P   ++ +RKE+GL+AN+RP    S +   
Sbjct: 59  EALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLD 116

Query: 135 -------KDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIA 187
                    +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A
Sbjct: 117 LSPLKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMA 172

Query: 188 LDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSM 247
             +ALQ+   N    +    K+NVL+ S  L+R   K V E+ K ++  +T   Q++DS 
Sbjct: 173 AFLALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSA 225

Query: 248 VYRMFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPC 300
              + + P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPC
Sbjct: 226 AMILVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPC 285

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           HGSAPD+    + NPIATI S A+ML+  L   +  + +  AV  N+ +  ++T DLGG+
Sbjct: 286 HGSAPDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGS 343

Query: 360 STTQQVTEDV 369
           ++T +V + +
Sbjct: 344 NSTTEVGDAI 353

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  144 bits (362), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 121/368 (32%), Positives = 196/368 (53%), Gaps = 45/368 (12%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ +    + + FDF     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPV----KSVSGTKD-RP 138
           K+     L GAV  P     G   P   ++ +RKE+GL+AN+RP     +S+ G    RP
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 139 -----VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
                 D ++VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
               N    +    K+NVL+ S  L+R   K V E+ K+++ ++T   Q++DS    + +
Sbjct: 180 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 254 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 307 IAGKGIANPIATIRSTALMLE----FLGHNDAAQD-IHRAVEANMRENKIKTPDLGGNST 361
           +  KG  NPIATI S A+ML+     +   DA ++ + + ++A +R     T DLGG+++
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGIR-----TGDLGGSNS 346

Query: 362 TQQVTEDV 369
           T +V + +
Sbjct: 347 TTEVGDAI 354

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  143 bits (361), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 192/368 (52%), Gaps = 37/368 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNSKHGLK-FDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++     K F+F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGTK-------- 135
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +         
Sbjct: 67  K-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 136 --DRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
              R  D V+VRE    +Y    K    + TG  VA  +++ S    +RI  +A  +ALQ
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
               +    +    K+NVL+ S  L+R   K V E+ K+++ ++T   Q++DS    + +
Sbjct: 181 H---SPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 254 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P Q   VI+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  KG  NPIATI S A+ML+  L   +    +  AV   + ++ ++T DL G STT +V
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVR-KVLDSGVRTADLKGTSTTSEV 351

Query: 366 TEDVLARL 373
            E V+  L
Sbjct: 352 GEAVVKAL 359

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  142 bits (359), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 199/368 (54%), Gaps = 45/368 (12%)

Query: 28  IGLIPGDGIGKEVIPAGKQVL----ENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETV 83
           I ++PGD IG+EV+    +VL    ++L+  H   FDF     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 84  QVLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGTK----- 135
              K +    L GAV  P  +  G   P   ++ LR+E+G++AN+RP    + +      
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 136 -----DRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDI 190
                 R  D+++VRE     Y    + + D+  G  VA  T + +    +RIA +A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFL 177

Query: 191 ALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYR 250
           ALQ    +    +    K+NVL+ S  L+R+  ++ ++S   ++ ++    Q++DS    
Sbjct: 178 ALQH---DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMI 230

Query: 251 MFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 303
           + + P+ F+ V+V  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 231 LVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGS 290

Query: 304 APDI-AGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNST 361
           APD+ AGK  ANPI  I S A+ML+  L    A + + +AV+  + ++ ++T DL G+S+
Sbjct: 291 APDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQ-EVLDSGVRTGDLLGSSS 347

Query: 362 TQQVTEDV 369
           T +V + +
Sbjct: 348 TSEVGDAI 355

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  142 bits (357), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 122/365 (33%), Positives = 193/365 (52%), Gaps = 38/365 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENL--NSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
           I ++PGD +G+E++    +VLE +  +S  G+KF+F     G  +   TG  LPDE +  
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT-------K 135
            K+     L GAV  P     G   P   ++ +RKE+ L+AN+RP   VS +       K
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 136 D---RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIAL 192
           +   +  D  +VRE    +Y    K   D   G+        I E+  +RI  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAAFLAL 179

Query: 193 QRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMF 252
           Q    +    +    K+NVL+ S  L+R   K V E+ K+++ ++    Q++DS    + 
Sbjct: 180 QH---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 253 REP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 305
           + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 306 DIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQ 364
           D+  KG  NPIATI S A+ML+  L   D    I +AV+  + +  I+T DL G+++T +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVK-QVLDAGIRTADLKGSNSTSE 350

Query: 365 VTEDV 369
           V + V
Sbjct: 351 VGDAV 355

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  140 bits (352), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 158/293 (53%), Gaps = 25/293 (8%)

Query: 26  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQV 85
            T+ LIPGDG+GKEV  + K + E  N    + ++ I+++   QT    G    +E V+ 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAENIP--IDWETINIK---QTDHKEGV---NEAVES 80

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVI 143
           L+    G L G   +P  +  G+ S  VALRK++ ++ANV   KS+ G K R   +D+++
Sbjct: 81  LRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203
           +RENTE  +  +E   +       V E+ K +++  T RIA  A D A    K N KA +
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKIMTKPKTERIARFAFDFAK---KYNRKA-V 189

Query: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA 263
           T  HK+N++   DGLFR I   + E  + +Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNI---ITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 264 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANP 315
           P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ +ANP
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  142 bits (359), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 195/364 (53%), Gaps = 37/364 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL  ++S +  + FDF     G      TG  LPDE ++  
Sbjct: 90  IVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEAS 149

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT-----KDRP 138
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +       +P
Sbjct: 150 K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 207

Query: 139 -----VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
                 D+ IVRE    +Y    K   D+  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 208 EIVKGTDICIVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVSEVQRITRMAGFLALQ 263

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
               N    +    K+NVL+ S  L+R   K V E+ K+++ ++T   Q++DS    + +
Sbjct: 264 H---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 316

Query: 254 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P   + V++A N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 317 NPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 376

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  KG  NP+ATI S A+ML+  L   +    + +AV+  + ++ ++T DL G+++T +V
Sbjct: 377 LP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVK-QVLDSGVRTADLRGSNSTSEV 434

Query: 366 TEDV 369
            + +
Sbjct: 435 GDAI 438

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  139 bits (349), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 188/366 (51%), Gaps = 38/366 (10%)

Query: 27  TIGLIPGDGIGKEVIPAGKQVLENLNS--KHGLKFDFIDLQAGFQTFLDTGKALPDETVQ 84
           TI ++PGD +G+E+     +VL  +       + F F     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 85  VLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGTK------ 135
             K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +       
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 136 ----DRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIA 191
                R  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 192 LQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRM 251
           LQ    N    +    K+NVL+ S  L+R   K V E+ K+++  +T   Q++DS    +
Sbjct: 180 LQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 252 FREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 304
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 305 PDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQ 363
           PD+  KG  NP+ATI S A+ML+  L   +  + I +AV+  + ++ I+T DL G ++T 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVK-KVLDSGIRTADLKGTNSTT 350

Query: 364 QVTEDV 369
           +V + V
Sbjct: 351 EVGDAV 356

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  138 bits (348), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 192/364 (52%), Gaps = 37/364 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++  +  +KFDF +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT-----KDRP 138
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +       +P
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 139 -----VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
                 D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
                    +    K+NVL+ S  L+R   K V E+ K+++ ++    Q++DS    + +
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 254 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  K   NPIATI S A+ML+  L   +  + I  AV+  + +  I+T DLGG+++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVK-KVLDAGIRTGDLGGSNSTTEV 351

Query: 366 TEDV 369
            + V
Sbjct: 352 GDAV 355

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  138 bits (348), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 123/364 (33%), Positives = 189/364 (51%), Gaps = 39/364 (10%)

Query: 24  KNLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDET 82
           KN+T+   PGD IG E++    +VL+ +      + F +     G      TG+ L DE 
Sbjct: 5   KNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEA 62

Query: 83  VQVLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGTK---- 135
           +QV K+     L GAV  P     G   P   ++ +RKE+G++AN+RP + VS T     
Sbjct: 63  LQVAKNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLS 120

Query: 136 --DRPV----DMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALD 189
              R +    D VIVRE    +Y    +   D   G    + +  + EI  +RI  +A  
Sbjct: 121 PLKREIVQGTDFVIVRELVGGIYFGERQEAGDD--GVAWDKESYSVPEI--QRITRMAAF 176

Query: 190 IALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVY 249
           +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++ ++T N  ++DS   
Sbjct: 177 LALQH---NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAM 229

Query: 250 RMFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHG 302
            + + P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+    + + EPCHG
Sbjct: 230 TLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHG 289

Query: 303 SAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNST 361
           SAPD+     ANPIATI S A+M +  L        I  AV+  + +  IKT DLGG +T
Sbjct: 290 SAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGGKNT 347

Query: 362 TQQV 365
           T +V
Sbjct: 348 TTEV 351

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 191/364 (52%), Gaps = 37/364 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++  +  +KFDF +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT-----KDRP 138
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +       +P
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 139 -----VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
                 D V+VRE    +Y    K    +  G  VA   ++ +    +RI  +A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
                    +    K+NVL+ S  L+R   K V E+ K+++ ++    Q++DS    + +
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 254 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  K   NP+ATI S A+ML+  L   +  + I  AV+  + +  I+T DLGG+++T +V
Sbjct: 294 LP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVK-RVLDAGIRTGDLGGSNSTTEV 351

Query: 366 TEDV 369
            + V
Sbjct: 352 GDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  136 bits (342), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 191/364 (52%), Gaps = 37/364 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++  +  + FDF +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT-----KDRP 138
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +       +P
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 139 -----VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
                 D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
                    +    K+NVL+ S  L+R   K V E+ K+++ ++    Q++DS    + +
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 254 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  K   NPIATI S A+ML+  L   +  + I  AV+  + +  I+T DLGG+++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVK-KVLDAGIRTGDLGGSNSTTEV 351

Query: 366 TEDV 369
            + V
Sbjct: 352 GDAV 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  135 bits (340), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 188/364 (51%), Gaps = 37/364 (10%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++  +  +KFDF     G      TG  L DE ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGTK-------- 135
           K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +         
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 136 --DRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
              R  D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A  +ALQ
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
                    +    K+NVL+ S  L+R   K V E+ K+++ ++    Q++DS    + +
Sbjct: 181 H---QPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 254 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQV 365
           +  K   NPIATI S A+ML+  L      Q I  AV+  + +  I+T DLGG+++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVK-KVLDAGIRTGDLGGSNSTIEV 351

Query: 366 TEDV 369
            + V
Sbjct: 352 GDAV 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  135 bits (339), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/369 (31%), Positives = 189/369 (51%), Gaps = 46/369 (12%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNSKHG--LKFDFIDLQAGFQTFLDTGKALPDETVQV 85
           I ++PGD +G E+     +VL+ +       +KFDF     G       G  L DE ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 86  LKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSG-----TKDR 137
            K +    L GAV  P     G   P   ++ +RKE+GL+AN+RP    S      +  R
Sbjct: 67  SK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 138 P-----VDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIAL 192
           P      D ++VRE    +Y    K    +  G  VA  +++ S     RI  +A  +AL
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 193 QRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMF 252
           Q    N    +    K+NVL+ S  L+R   K V  + K+++ ++T   Q++DS    + 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 253 REP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 305
           + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 306 DIAGKGIANPIATIRSTALMLEF----LGHNDAAQD-IHRAVEANMRENKIKTPDLGGNS 360
           D+  K   NP+ATI S A+ML+     +   +A ++ + R ++A +R     T DLGG++
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAGVR-----TGDLGGSN 347

Query: 361 TTQQVTEDV 369
           +TQ+V + +
Sbjct: 348 STQEVGDAI 356

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  132 bits (333), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 192/370 (51%), Gaps = 39/370 (10%)

Query: 22  LRKNLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPD 80
           + KN+ +  +PGD  G+E+     +VLE ++      KF+F     G      TG  LPD
Sbjct: 1   MSKNIVV--LPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPD 58

Query: 81  ETVQVLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT--- 134
           + +   K      L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +   
Sbjct: 59  DALAAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLD 116

Query: 135 -------KDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIA 187
                    +  D V+VRE    +Y    K    +  G  VA  +++ ++   +R+  +A
Sbjct: 117 LSPLKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMA 172

Query: 188 LDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSM 247
             +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++  +  N Q++DS 
Sbjct: 173 AFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSA 225

Query: 248 VYRMFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPC 300
              + + P Q   +++  NL+GDI+SD A+ + GSLG++PSA++   P+      + EPC
Sbjct: 226 AMILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPC 285

Query: 301 HGSAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359
           HGSAPD+  KG  NPIA I S A+ML+  L  +   + + +AV+  + ++ ++T DLGG+
Sbjct: 286 HGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVK-QVLDSGVRTGDLGGS 343

Query: 360 STTQQVTEDV 369
           ++T +V + +
Sbjct: 344 NSTSEVGDAI 353

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  132 bits (332), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 189/369 (51%), Gaps = 45/369 (12%)

Query: 28  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86
           I ++PGD +G+E+     +VL+ ++  +  +KFD+     G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 87  KSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT--------- 134
           K      L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +         
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 135 -KDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQ 193
              +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFR 253
           +   N    +    K+NVL+ S  L+R   K V E+ K+++ ++T   Q++DS    + +
Sbjct: 181 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 254 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 306
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 307 IAGKGIANPIATIRSTALMLEFLGH-----NDAAQDIHRAVEANMRENKIKTPDLGGNST 361
           +  K   NPIATI S A+ML+   +     N   + + R ++A +R     T DL G ++
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAGIR-----TADLRGENS 347

Query: 362 TQQVTEDVL 370
           T +V + V+
Sbjct: 348 TSEVGDAVV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  123 bits (308), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 186/373 (49%), Gaps = 48/373 (12%)

Query: 24  KNLTIGLIPGDGIGKEVIPAGKQVLENLNS--KHGLKFDFIDLQAGFQTFLDTGKALPDE 81
           KN+ +  +PGD +G EV     ++L+ +     + +KF+F     G      TG  LPDE
Sbjct: 5   KNIVV--LPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDE 62

Query: 82  TVQVLKSQCQGALFGAVQSPTTKVEGYSSP---IVALRKEMGLFANVRPVKSVSGT---- 134
           +++  K +    L GAV  P     G   P   ++ +RKE+ L+AN+RP    S +    
Sbjct: 63  SLEASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDL 120

Query: 135 ------KDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIAL 188
                   +  D  +VRE    +Y    K    +  G  VA  +++ S    +RI  +A 
Sbjct: 121 SPLKEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAA 176

Query: 189 DIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMV 248
            +A+Q    N    +    K+NVL+ S  L+R   K V E+ ++++ S+  + Q++DS  
Sbjct: 177 FLAMQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAA 229

Query: 249 YRMFREP-QCFDVIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPEIVIGEP 299
             + + P Q   +I+  N++GDI+SD A+ + G        SL  +P  N      + EP
Sbjct: 230 MILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYEP 287

Query: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDL 356
           CHGSAPD+  KG  NPI TI S A+ML+ L  N   + I  AVE  +R   +N I+T DL
Sbjct: 288 CHGSAPDLP-KGKVNPIGTILSVAMMLK-LSLNLKEEGI--AVEEAVRRVLDNNIRTADL 343

Query: 357 GGNSTTQQVTEDV 369
           GG+++T  + + V
Sbjct: 344 GGSNSTSDIGDAV 356

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 133/297 (44%), Gaps = 40/297 (13%)

Query: 105 VEGYSSPIVALRKEMGLFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKAT 164
           V G+  PI+     +G  A+    ++     ++   + +V    +    KI + +  K T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 165 GTR-VAEATKRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREIC 223
           G R VA A     E + R  A  +  +AL +     +  L ++ K+ +L Q DG F++I 
Sbjct: 184 GARGVALAMYNTDE-SIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIF 237

Query: 224 KDVYESNKD---KYGSITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVG 280
           ++VY        +   I+Y  +++D MV +M +    F V+   N  GD+LSD  A   G
Sbjct: 238 QEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFG 296

Query: 281 SLGVVPSANVGPE--IVIGEPCHGSA-----PDIAGKGIA-NPIATIRSTALMLEFLGHN 332
           SLG++ S  V P+      E  HG+          GK  + N IA+I + +  L   G  
Sbjct: 297 SLGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGEL 356

Query: 333 DAAQDI---HRAVEA----NMRENKIKTPDLG---GNS------TTQQVTEDVLARL 373
           D   D+    R +EA     ++++ I T DL    GN+      TT +  + V ARL
Sbjct: 357 DGTPDVVEFARKLEAATIETVQQHGIMTKDLALACGNANRDAYVTTNEFLDAVEARL 413

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 66/115 (57%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L +N K  L ++ K+ +L + DG F++I +++YES+ K ++ +  I+Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 322

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGSIT 238
            A  + ++AL+R     K  L  T K+ VL + DG F++I +++YES+     D+ G I 
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIG-IL 248

Query: 239 YNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 296
           Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 249 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFE 307

Query: 297 GEPCHGSA 304
            E  HG+ 
Sbjct: 308 SEAAHGTV 315

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 70/130 (53%), Gaps = 11/130 (8%)

Query: 179 ATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG-- 235
           + R  A  +  +ALQ+     K  L ++ K+ +L + DG F++I ++VY+S  K K+   
Sbjct: 200 SIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAEL 254

Query: 236 SITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 293
           +ITY  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 255 NITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 313

Query: 294 IVIGEPCHGS 303
               E  HG+
Sbjct: 314 TFESEAAHGT 323

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 91/182 (50%), Gaps = 19/182 (10%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F+++ ++V++S  KDK+ +  I Y  +++D MV +
Sbjct: 220 KLAIDKKLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQ 279

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSA---- 304
           M +    + ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 280 MIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 338

Query: 305 -PDIAGKGIA-NPIATIRSTALMLEFLGHNDA-------AQDIHRAVEANMRENKIKTPD 355
                GK  + N IA+I + +  L   G  D        AQ + +A    ++E+ I T D
Sbjct: 339 RQHQQGKQTSTNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKD 398

Query: 356 LG 357
           L 
Sbjct: 399 LA 400

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 24/194 (12%)

Query: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GSI 237
           R  A  + ++ALQR     K  L  T K+ +L + DG F++  + +YE+  ++++    I
Sbjct: 192 RGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGI 246

Query: 238 TYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IV 295
            Y  +++D MV +M +    F VI   N  GD+ SD  A   GSLG++ S  V P+    
Sbjct: 247 WYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAF 305

Query: 296 IGEPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIH---RAVE--- 343
             E  HG+          GK  + N IA+I +    L   G  D   ++    RA+E   
Sbjct: 306 ESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTPEVEGFARALETAT 365

Query: 344 -ANMRENKIKTPDL 356
            A + E+ I T DL
Sbjct: 366 VATVNEDGIMTKDL 379

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITY 239
            A  + ++AL+R     K  L  T K+ +L + DG F++I + +YE   K K+ +  I Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 308 EAAHGT 313

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GSITY 239
            A  + ++ALQR     K  L  T K+ +L + DG F++I + +Y +  K+K+    I Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 308 EAAHGT 313

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 89/197 (45%), Gaps = 23/197 (11%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           ++ +N K  L +  K+ +L + DG F++I + +Y    K K+    ITY  +++D MV +
Sbjct: 210 QVALNKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQ 269

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----- 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 270 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGTVTRHF 328

Query: 304 -----APDIAGKGIANPIATIRSTALMLEFLGHNDA---AQDIHRAVEANMRENKIKTPD 355
                  + +   IA+  A  R  A   E  G  D    A  +  A   +++E+ I T D
Sbjct: 329 RRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLDSVQEDGIMTKD 388

Query: 356 L----GGNSTTQQVTED 368
           L    G N+ +  V  D
Sbjct: 389 LALASGKNNRSDYVNTD 405

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 131/298 (43%), Gaps = 46/298 (15%)

Query: 105 VEGYSSPIVALRKEMGLFANVRPVKSVSGTKDRP--VDMVIVRENTEDLYIKIEKTYIDK 162
           V G+  PI+     +G  A+    K+       P  +++V   EN  +   K+ + Y  K
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE---KVMEVYDYK 184

Query: 163 ATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREI 222
             G  +A      +E + R  A  +  +AL +     K  L ++ K+ +L + DG F++I
Sbjct: 185 GPGVALAMYN---TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDI 236

Query: 223 CKDVYESNKDKY---GSITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALV 279
            +++Y++   K      I Y  +++D MV +M +    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 280 GSLGVVPSANVGPE--IVIGEPCHGSA-----PDIAGKGIA-NPIATIRSTALMLEFLGH 331
           GSLG++ S  V P+      E  HG+          GK  + N IA+I + +  L   G 
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGLAKRGE 355

Query: 332 NDAAQDIHR-------AVEANMRENKIKTPDL---GGNS------TTQQVTEDVLARL 373
            D    + R       A    ++++ I T DL   GGN+      TT +  + V ARL
Sbjct: 356 LDNTPQVVRFANILEAATLNTVQQDGIMTKDLALAGGNTDRSAYVTTNEFLDAVEARL 413

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 91/194 (46%), Gaps = 21/194 (10%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--SITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F++I + +YE++ K K+   +I Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----- 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHF 333

Query: 304 -----APDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEA----NMRENKIKTP 354
                  + +   IA+  A  R      E L  ND        +EA     ++++ I T 
Sbjct: 334 RKFQKGEETSTNSIASIFAWSRGLLKRGE-LDKNDQLCKFANLLEAATLNTVQQDGIMTK 392

Query: 355 DLGGNSTTQQVTED 368
           DL   S +Q V  D
Sbjct: 393 DLALASGSQYVNTD 406

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F++I ++VYE+  K K+    I Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQ 274

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F++I ++VYE+  K K+    I Y  +++D MV +
Sbjct: 216 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQ 275

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN---KDKYGSITY 239
            A  + ++A++R     K  L  T K+ +L + DG F++I + +Y+ +   K K   I+Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P+  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 307 EAAHGT 312

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F++I + VYE+  K K+ +  I Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQ 274

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 17/129 (13%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGS------ 236
            A  + ++AL+R     K  L    K+ +L + DGLF++I + +Y   KD Y +      
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLY---KDHYKTKFEELG 246

Query: 237 ITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--I 294
           IT+  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+  +
Sbjct: 247 ITFEHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSV 305

Query: 295 VIGEPCHGS 303
              E  HG+
Sbjct: 306 FESEAAHGT 314

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L V  K  L  T K+ +L + DG+F++I + +YE   K+K+    I Y  +++D MV +
Sbjct: 201 QLAVERKMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWYEHRLIDDMVAQ 260

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    + +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 261 MLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 314

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--SITY 239
            A  + ++AL+R     K  L  T K+ +L + DG F++I + +Y S+ +DK+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGS--ITY 239
            A  + ++A++R     K  L  T K+ +L + DG F+++ + +Y ES K+K+ S  I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--SITY 239
            A  + + AL+R     K  L  T K+ +L Q DG F++I +++Y +  +DK+   +I Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 312 EAAHGT 317

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 65/115 (56%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GSITYNEQIVDSMVYR 250
           +L +N K  L ++ K+ +L + DG F++I ++++++  K ++   +I+Y  +++D MV +
Sbjct: 210 KLALNKKLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQ 269

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 270 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 323

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYE----SNKDKYGSIT 238
            A  + ++AL+R     K  L  T K+ +L + DG F++I + +YE    S  +K G I 
Sbjct: 193 FAKASFELALER-----KQPLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IW 246

Query: 239 YNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 296
           Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 247 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 305

Query: 297 GEPCHGS 303
            E  HG+
Sbjct: 306 SEAAHGT 312

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 8/116 (6%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGSITYNEQIVDSMVY 249
           +L +  K  L ++ K+ +L + DG F++I +++Y+S      +K G I Y  +++D MV 
Sbjct: 216 KLAITKKLNLYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEFEKLG-IWYEHRLIDDMVA 274

Query: 250 RMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 QMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKAFESEAAHGT 329

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           ++ ++ K  L ++ K+ +L + DG F++I +++YE+  K K+    I Y  +++D MV +
Sbjct: 216 KMAIDKKLNLFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQ 275

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 179 ATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS- 236
           A    A  +  +AL+R     +  L  T K+ +L + DG F+ + +D+YE   K ++   
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 237 -ITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 293
            I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 294 IVIGEPCHGS 303
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGSI--TY 239
            A  +  +AL+R     K  L +  K+ +L + DG F+ I  D+Y++  K+K+  +  TY
Sbjct: 195 FAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTY 249

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 250 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQS 308

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 309 EAAHGT 314

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICK----DVYESNKDKYGSIT 238
            A  + ++AL+R     K  L  T K+ +L + DG F+++ +    D Y+S  ++ G I 
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELG-IW 244

Query: 239 YNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 296
           Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 245 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFE 303

Query: 297 GEPCHGS 303
            E  HG+
Sbjct: 304 SEAAHGT 310

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITY 239
            A  + ++AL+R     K  L  T K+ +L   D  F++I  ++++   K+K+ +  ITY
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYRMFREPQCFD 259
           L  T K+ +L + DG +++I  D+YE + KDK+ +  I Y  +++D MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 260 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           VI   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITY 239
            A  + ++A++R     K  L  T K+ +L + DG F+++ + +Y  N K+K+ S  I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 6/114 (5%)

Query: 195 LKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG---SITYNEQIVDSMVYRM 251
           L VN    L +  K+ +L + DG F++I +++YE+   K     +ITY  +++D MV +M
Sbjct: 214 LAVNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQM 273

Query: 252 FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
            +    + ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 274 IKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 195 LKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYRM 251
           + +  K  L  T K+ +L Q DG F++I K VYE+  K+ +    I Y  +++D MV +M
Sbjct: 197 MAIERKLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMVAQM 256

Query: 252 FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
            +    F +I   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 257 LKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGT 309

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGS--ITY 239
            A  + ++A++R     K  L  T K+ +L + DG F+++ + +Y  S K+K+ S  I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGS--ITYNEQIVDSMVYR 250
           ++ +  K  L  T K+ +L + DG F++I  ++Y    KD++    I Y  +++D MV +
Sbjct: 202 QMAIKKKIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQ 261

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 262 MLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGT 315

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 81/166 (48%), Gaps = 14/166 (8%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITYNEQIVDSMVYR 250
           +L +  K  L ++ K+ +L + DG F++I +++++   K K+ +  I+Y  +++D MV +
Sbjct: 213 KLALTKKLNLFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKFANLGISYEHRLIDDMVAQ 272

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIA 308
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 273 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 331

Query: 309 GK------GIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRE 348
            K         N IA+I + +  L   G  D   D+ R   AN+ E
Sbjct: 332 RKFQKGEETSTNSIASIFAWSRGLAKRGELDGTPDVVRF--ANLLE 375

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 25/198 (12%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDK---YGSITYNEQIVDSMVYR 250
           RL ++ +  L +  K+ +L Q DG F+++ + +Y++   +      I+Y  +++D MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----- 303
           M +    F V+   N  GD+ SD  A   GSLG++ S  + P+      E  HG+     
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGTVTRHF 325

Query: 304 -----APDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEA----NMRENKIKTP 354
                  + +   IA+  A  R  A   +  G   A  D   A+E      ++++ I T 
Sbjct: 326 RLHQQGKETSTNSIASIFAWTRGLARRADLDG-TPAVADFAHALEGATLRTVQDDAIMTK 384

Query: 355 DL----GGNSTTQQVTED 368
           DL    G    T  VT D
Sbjct: 385 DLALACGKTDRTAYVTTD 402

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITY 239
            A  + ++AL+R     +  L  T K+ +L   D  F+EI   ++++  K+K+ +  ITY
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 82/167 (49%), Gaps = 14/167 (8%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GSITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F+++ ++++++  K ++    I Y  +++D MV +
Sbjct: 215 KLALSKKLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQ 274

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIA 308
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 333

Query: 309 GK------GIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMREN 349
            K         NPIA+I +    +   G  D   D+ R   AN+ E+
Sbjct: 334 RKYQRGEETSTNPIASIFAWTRGIAKRGELDGTPDVVRF--ANILES 378

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGS--ITY 239
            A  + ++AL+R     K  L  T K+ +L + DG F+++ + +Y E  K+K+ +  I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY----ESNKDKYGSIT 238
            A  + ++ALQR     +  L  T K+ +L + DG F+++ + +Y    +S  ++ G I 
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELG-IW 245

Query: 239 YNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 296
           Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 246 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 304

Query: 297 GEPCHGS 303
            E  HG+
Sbjct: 305 SEAAHGT 311

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS--ITY 239
            A  + ++AL+R     K  L  T K+ +L   D  F++I   ++++  K+++ +  ITY
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 34/201 (16%)

Query: 203 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGS------ITYNEQIVDSMVYRMFREPQ 256
           L  T K+ +L + DG F+++ + +YES   +Y S      I Y  +++D MV +M +   
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYES---QYKSAFEAKGIWYEHRLIDDMVAQMLKSKG 266

Query: 257 CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSA-----PDIAG 309
            + +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+          G
Sbjct: 267 GY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQG 325

Query: 310 KGIA-NPIATIRSTALMLEFLGHNDAAQDIHRAVEA-------NMRENKIKTPDLG---- 357
           K  + N IA+I +    L   G  D+  D+ +  E         ++E++I T DL     
Sbjct: 326 KETSTNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLALILG 385

Query: 358 -----GNSTTQQVTEDVLARL 373
                   TT++  E V  RL
Sbjct: 386 KTDRSSYVTTEEFIEAVHKRL 406

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 91/197 (46%), Gaps = 24/197 (12%)

Query: 179 ATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGS- 236
           + R  A  + ++AL+      +  L  T K+ +L + DG F++  + +YE+  K+++ + 
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 237 -ITYNEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 293
            I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 294 IVIGEPCHGSA-----PDIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDI-------HR 340
               E  HG+          GK  + N IA+I +    +   G  D   D+        R
Sbjct: 302 TFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIQRGKLDETADVVKFGELLER 361

Query: 341 AVEANMRENKIKTPDLG 357
           A    ++E+ I T DL 
Sbjct: 362 ATVDTVQEDGIMTKDLA 378

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKD---KYGSITYNEQIVDSMVYR 250
           +L ++ K  L ++ K+ +L + DG F++I +++Y++      +   I Y  +++D MV +
Sbjct: 209 KLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFYEHRLIDDMVAQ 268

Query: 251 MFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGSITYNEQIVDSMVY 249
           RL +  +  L ++ K+ +L Q DG F+++ +++Y++      ++ G I Y  +++D MV 
Sbjct: 215 RLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLG-IYYEHRLIDDMVA 273

Query: 250 RMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSA--- 304
           +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+    
Sbjct: 274 QMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRH 332

Query: 305 --PDIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDI 338
                AGK  + N IA+I +    L   G  D   D+
Sbjct: 333 FRQHQAGKETSTNSIASIFAWTRGLAKRGELDNTPDV 369

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGS--ITY 239
            A  + + AL+R     K  L  T K+ +L + DG F++I + +Y E  ++K+ +  I Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 317 EAAHGT 322

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGS--ITY 239
            A  + ++AL+R     K  L  T K+ +L   D  F++I   ++ E  ++K+ +  I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 298 EPCHGS 303
           E  HG+
Sbjct: 306 EAAHGT 311

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 194 RLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGSITYNEQIVDSMVY 249
           +L +  K  L ++ K+ +L   DG F++I +++Y++      + +G I Y  +++D MV 
Sbjct: 211 KLALTKKLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHG-IYYEHRLIDDMVA 269

Query: 250 RMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 303
           +M +    F ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 270 QMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 183 IATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGS---ITY 239
            A  +  +AL+R     K  L  T K+ +L + DG F++I +++YE    +      I Y
Sbjct: 200 FALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWY 254

Query: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 297
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 255 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFES 313

Query: 298 EPCHGSA 304
           E  HG+ 
Sbjct: 314 EAAHGTV 320

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%)

Query: 324 LMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373
           LML  LG N++A  I +AV   + E K  T D+GG+S+T   T +++ +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>YPR134W Chr16 (798051..798857) [807 bp, 268 aa] {ON}  MSS18Nuclear
           encoded protein needed for efficient splicing of
           mitochondrial COX1 aI5beta intron; mss18 mutations block
           cleavage of 5' exon - intron junction; phenotype of
           intronless strain suggests additional functions
          Length = 268

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 104 KVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDRPVDM 141
           KVE + SP + L+++  L    RPV+ VS T+   VD+
Sbjct: 131 KVEVHDSPFLQLQRDSNLLFAERPVRYVSTTEGEGVDI 168

>Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 10/90 (11%)

Query: 142 VIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKA 201
           ++  E+  D  I+I  T I+++     AEA K +S++  RR  T+  ++ +Q+  + G  
Sbjct: 234 IVELESNRDKLIRISNTDIEES-----AEAIKELSDLLVRRKKTLQ-NLTIQQENLQG-- 285

Query: 202 TLTVTHKSNVLSQSDGLFREICKDVYESNK 231
             TVT    ++S+   + R I  +V ESN+
Sbjct: 286 --TVTTFETIISELYDVLRIISSEVQESNR 313

>Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180W
           (APG1) - Protein kinase [contig 211] FULL
          Length = 872

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 67/167 (40%), Gaps = 19/167 (11%)

Query: 96  GAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKI 155
            +++     VE  S  + AL  E     N  P       KDR     I    T+ L + +
Sbjct: 422 ASIEREYVMVEKKSVEVNALADEFASLGNCSPTD-----KDR----RIPNPKTQQLPVPL 472

Query: 156 EKTYIDKA------TGTRVAEATKR--ISEIATRRIATIALDIALQRLKVN-GKATLTVT 206
           + T + K+      T  R +   +R  IS ++     T AL IA  RL  N   + L+V+
Sbjct: 473 QSTAVRKSSSSGGNTSKRPSLVERRLSISSLSPSNALTKALGIASTRLFGNQNNSGLSVS 532

Query: 207 HKSNVLSQ-SDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMF 252
              N+    S  LF E+ ++V  S      S  YNE   D+ +  M 
Sbjct: 533 PNHNLQPLLSRQLFHELTENVVLSADHHADSAKYNETCSDAEIVSML 579

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,298,190
Number of extensions: 1455503
Number of successful extensions: 4430
Number of sequences better than 10.0: 146
Number of HSP's gapped: 4204
Number of HSP's successfully gapped: 146
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)