Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B062402.290ON26026012930.0
NDAI0B035402.290ON2612618751e-119
TDEL0G022002.290ON2612618391e-113
ZYRO0A01958g2.290ON2632618051e-108
SAKL0E07590g2.290ON2602377861e-105
YIL093C (RSM25)2.290ON2642427661e-102
Smik_9.862.290ON2642427661e-102
Skud_9.802.290ON2642427651e-102
Suva_9.1062.290ON2642427641e-102
Kwal_27.115092.290ON2612357631e-102
KLTH0G10450g2.290ON2612597621e-101
KAFR0J013502.290ON2642467395e-98
KLLA0E08273g2.290ON2612417325e-97
CAGL0D04158g2.290ON2722547274e-96
Ecym_33292.290ON2582517125e-94
Kpol_1003.402.290ON2612617073e-93
TBLA0B059602.290ON2662407041e-92
TPHA0C034202.290ON2682446971e-91
KNAG0A054102.290ON2662426935e-91
ADL211C2.290ON2251835375e-68
ZYRO0G19206g8.148ON15596770.11
TDEL0A049105.625ON59350711.9
Skud_3.111.14ON41666674.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B06240
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   502   0.0  
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   341   e-119
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   327   e-113
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   314   e-108
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   307   e-105
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   299   e-102
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   299   e-102
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   299   e-102
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   298   e-102
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   298   e-102
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   298   e-101
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   289   5e-98
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   286   5e-97
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   284   4e-96
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   278   5e-94
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   276   3e-93
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   275   1e-92
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   273   1e-91
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   271   5e-91
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   211   5e-68
ZYRO0G19206g Chr7 (1593126..1593593) [468 bp, 155 aa] {ON} simil...    34   0.11 
TDEL0A04910 Chr1 complement(866033..867814) [1782 bp, 593 aa] {O...    32   1.9  
Skud_3.11 Chr3 complement(22077..23327) [1251 bp, 416 aa] {ON} Y...    30   4.2  

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  502 bits (1293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/260 (94%), Positives = 246/260 (94%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120
           RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL
Sbjct: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120

Query: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMITAYNQARFEFYRFRIXXX 180
           VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMITAYNQARFEFYRFRI   
Sbjct: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMITAYNQARFEFYRFRIQQE 180

Query: 181 XXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWIS 240
                      MFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWIS
Sbjct: 181 VEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWIS 240

Query: 241 AEAGATEENLDEQGSELLEL 260
           AEAGATEENLDEQGSELLEL
Sbjct: 241 AEAGATEENLDEQGSELLEL 260

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  341 bits (875), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 202/261 (77%), Gaps = 1/261 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N+VERTSAYL SGLL+NTPAWY+VVA IPPTKKFTREP++ NP+T  +    
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120
           +D+R  VN KG YKTR N++DRK ++N LYKPPKL Y+ED+LR+LFF+QHPWELSRPKIL
Sbjct: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120

Query: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTD-KMDMITAYNQARFEFYRFRIXX 179
           +ENSLEE FDWSHIQQ  K LDGESVVQRT+YLLK +  ++M+ AYN+ARFEFYR RI  
Sbjct: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180

Query: 180 XXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239
                       MFGS+F Q+  + GIEKEQKVI+QWKKKA QET+L+  R +NPSDSW 
Sbjct: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240

Query: 240 SAEAGATEENLDEQGSELLEL 260
           + E    EE+  E   E+L++
Sbjct: 241 APEEQDLEEDFTEGEPEILDI 261

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  327 bits (839), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 203/261 (77%), Gaps = 1/261 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N++ERTSAYL+SGLL+NTPAWY+VVA IPP  KFTREPRLINPS  + LA L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120
           +D+ +  N KGF+KTR + LD+K+N+ KLY+ PKL++VEDQLR +F+ QHPWELSRPK+L
Sbjct: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120

Query: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMIT-AYNQARFEFYRFRIXX 179
           VEN  EE FDWSHIQQL KPLDGESV+QRT++LLK ++   +T AY+QARFEFYR R+  
Sbjct: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQQ 180

Query: 180 XXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239
                       MFGS++  S IDFG+++EQK I  WK+KA +ET+L+AARRANPS++W 
Sbjct: 181 EVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240

Query: 240 SAEAGATEENLDEQGSELLEL 260
           + E    +++L++Q  E + L
Sbjct: 241 AGEEQPDKKDLEDQDIEEIVL 261

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  314 bits (805), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N++ERTSAYL+SGLL+ TPAWY+VVA +PPT KFTRE R INPST +     
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120
           ++  E +N+KGFYKTR +  DRK   ++LYK PKLQ++EDQLR +F+ QHPWE SRPK+L
Sbjct: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120

Query: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTD-KMDMITAYNQARFEFYRFRIXX 179
           VEN + E FDWS++ QLGKPLDGESVVQRT+YLL+ D ++ +I AY++ RFEFYR R+  
Sbjct: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQE 180

Query: 180 XXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239
                       MFGSVF+ S ID+G+E+EQ+VI  WK+KA +ETEL+AARRA+P++SW 
Sbjct: 181 EIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240

Query: 240 SAEAGATEENLDEQGSELLEL 260
             +        DE G E  EL
Sbjct: 241 QEKQEGEPNKSDEDGQETEEL 261

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 180/237 (75%), Gaps = 2/237 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M+VQTNA+N++ERTSAYL++GLL   PAWY VVA +PP+K F REP++ NPS N+++A L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  RDNREAVN-KKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119
            +  E V  K G YKTR +  DRKV+ NKLYK PKL Y ED+LR LF+ QHPWELSRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDK-MDMITAYNQARFEFYRFRIX 178
           L+EN+ EE +DWS IQQLGKPLDGESVVQRT+YLLK  K + ++ AY+QARFEFYR R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 179 XXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPS 235
                        MFGSVF  S I++G+EKEQKVI+ WKKKA Q+TEL+AAR + PS
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 179/242 (73%), Gaps = 4/242 (1%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N+++RTSAYLKSGLLK TPAWY VVA IPP+ KFTREPR  NPS    +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  RDNRE--AVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPK 118
            D  E    N KG YKTRPN  D++V   +LY+PPKL YVED+LR+LF+ QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 119 ILVENSL-EERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYRFR 176
           ILVEN + +E +DWSH+ Q+G+PLDGESV+QRTMYL+KT +  DM+ AY+ AR+EFY  R
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 177 IXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236
           +              MFGS+F  S I+ GI+KEQ+V+  W+KK  +ETEL+AAR +NP+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 237 SW 238
           SW
Sbjct: 241 SW 242

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 178/242 (73%), Gaps = 4/242 (1%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N+++RTSAYLKSGLLK+TPAWY VVA IPP+ KFTREP   NPS    +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  RD--NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPK 118
            D    +  N  G YKTRPN  D+++   KLYKPPKL YVED+LRTLF+ QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 119 ILVENSL-EERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMD-MITAYNQARFEFYRFR 176
           ILVEN + +E +DWSH+ QLGKPLDGESV+QRTMYLLKT + +  + AY+ AR+EFY  R
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 177 IXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236
           +              MFGS+F +S I+ GI+KEQ+V+  W+KK  +ETEL+AAR +NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 237 SW 238
           SW
Sbjct: 241 SW 242

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 179/242 (73%), Gaps = 4/242 (1%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N+++RTSAYLKSGLLK TPAWY VVA IPP+ KFTREPR  NPS  + +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  RD--NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPK 118
            D   R+  NK G YKTRPN  D++V+  KLYKPPKL YVED+LR LF+ QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 119 ILVENSL-EERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYRFR 176
           ILVEN + +E +DW  + QLGKPLDGESVVQRTM+LLKT +  DM+ AY+ AR+EFY  R
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 177 IXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236
           +              MFGS+F  S I+ GI+KEQ+V+  W+KK  +ETEL+AA+ +NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 237 SW 238
           SW
Sbjct: 241 SW 242

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  298 bits (764), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/242 (59%), Positives = 178/242 (73%), Gaps = 4/242 (1%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N+++RTSAYLKSGLLK+TPAWY VVA IPP+ KFTREPR  NPS    +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  RD--NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPK 118
            D   R+  N  G YKTRPN  DR+V   KLYKPPKL YVED+LR LF+ QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 119 ILVENSL-EERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYRFR 176
           ILVEN + +E +DWSH+ QLGK LDGESV+QRTM+LLKT +  DM+ AY+ AR+EFY  R
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 177 IXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236
           +              MFGS+F  S I+ GI+KEQ+V+  W+KK  +ETEL+AAR +NP+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 237 SW 238
           SW
Sbjct: 241 SW 242

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  298 bits (763), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 185/235 (78%), Gaps = 2/235 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M+VQ NA+N++ERTS+YL++G+LK TPAWYEVVA+IPP+K+F REPRL+NPSTN+++A L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  RDNREAVN-KKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119
            + RE+ N +   YKTR ++ D++V+ NKLYK PKL+Y ED+LR LFF+QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDK-MDMITAYNQARFEFYRFRIX 178
           LVENS  + +DWS +QQLGKPLDGESVVQRT+YLLK+ K  +++ AY+QARFEFYR RI 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 179 XXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRAN 233
                        M GSVF  S IDFG++KEQK+I  WK+KA  ++EL++AR  N
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  298 bits (762), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 191/259 (73%), Gaps = 2/259 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M+VQ NA+N++ERTS+YLK+GLLK TPAWY+VVA +PP+K+F REPRL+NPSTN++ A L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  RDNREAVNKKG-FYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119
            +  E  + +   YKTR ++ +R+V+ +KL+  PKL+Y ED+LR +F++QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTD-KMDMITAYNQARFEFYRFRIX 178
           LVENS    +DWS IQQLGKPLDGESVVQRT+YLL+T    +++ AY+QARFEFYR RI 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 179 XXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238
                        MFGSVF  S IDFG+EKEQK+I  WK+KA  +TE+++AR  NPS+SW
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 239 ISAEAGATEENLDEQGSEL 257
            + E+    +   E   EL
Sbjct: 241 SAQESQPQSDAKAEDTKEL 259

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  289 bits (739), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 132/246 (53%), Positives = 185/246 (75%), Gaps = 2/246 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA NI+ERTSAYL++GLL+N PA+Y+V+A++PP+ KFTREP+L+NPST +D    
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120
           R+  + VN +G YKTR    DR  + ++LYK  +L+Y+ED LR LF+DQHPWELSRPKI+
Sbjct: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120

Query: 121 VENSLE-ERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMD-MITAYNQARFEFYRFRIX 178
           +EN+++    DWS+IQQLGKP+DGESVVQRT++L+K  K D +   Y+QARFEFY+ R+ 
Sbjct: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180

Query: 179 XXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238
                        MFGS+F  + +++GI++EQ VI +WK++A +ETEL+ A+RANPSDSW
Sbjct: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240

Query: 239 ISAEAG 244
              E+ 
Sbjct: 241 AQEESS 246

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  286 bits (732), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 182/241 (75%), Gaps = 3/241 (1%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M+VQ  A+N++ERTSAYLKSG+LK TPAWY V+AK+PPTKKF R P+L +P   +    L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  RD-NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119
            D +    N  G YKTRPN L++K  ++KLY+ PKL Y+ED+LR LFF QHPWELSRPKI
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 120 LVENSLE-ERFDWSHIQQLGKPLDGESVVQRTMYLLKT-DKMDMITAYNQARFEFYRFRI 177
           LVEN+LE + +DWSHIQQLGKPLDGESVVQRT++LLK+ +K ++I AY+QARFEFYR RI
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 178 XXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDS 237
                         MFGSVF+ + I++GI KEQKVI  WK+KA Q+ EL+AAR ++PS S
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 238 W 238
           W
Sbjct: 241 W 241

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  284 bits (727), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 190/254 (74%), Gaps = 2/254 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA+N++ERTSAYL++G++K TPAWY VVA IPP  KFTREP  INPST++ ++ L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  RD-NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119
           +D + E+VN+ G YKTR N L+RKV + ++YKPPKL Y+ED++RTLF+ QHPWEL+RPKI
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMIT-AYNQARFEFYRFRIX 178
           + EN +    DW ++ QLG+PLDGE+VVQRT+YLLKT +   IT AY+QAR EFYR R+ 
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 179 XXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238
                        MFGSVF  S I+ G+ KEQ+VI++WK+ AE ++EL++A++ N S + 
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240

Query: 239 ISAEAGATEENLDE 252
             A A ++E+ +++
Sbjct: 241 GDASAVSSEKQVED 254

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  278 bits (712), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 182/251 (72%), Gaps = 6/251 (2%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++QTNA NI+ERTS++L+ GLL  TP WY+V+ K PP+ KF R+P+L+NPST    A L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  R---DNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRP 117
           R   DNR + +  G YKTR NK +++V+++ +Y+ PKL Y ED+LR+LF+ QHPWELSRP
Sbjct: 61  REFSDNRNSSS--GTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRP 118

Query: 118 KILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKT-DKMDMITAYNQARFEFYRFR 176
           KILVEN  +E+ DWS IQQLGKPLDGESVVQRT+YLL + +  ++I AY+QARFEFYR R
Sbjct: 119 KILVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLR 178

Query: 177 IXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236
           +              M GSVF  S ++FG+ KEQ+VI  WKKKA ++ EL++A+R++ S 
Sbjct: 179 MQQELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSA 238

Query: 237 SWISAEAGATE 247
           +W + E  A +
Sbjct: 239 NWGTREDNAND 249

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  276 bits (707), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 133/261 (50%), Positives = 178/261 (68%), Gaps = 1/261 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++Q NA+N++ERTSAYL++GLL   PAWY VVA +PP KKF R P+L NPS +     L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120
                +    G +KTR    DR   S +LY   KL Y+EDQLR +F+ QHPWELSRPKIL
Sbjct: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120

Query: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYRFRIXX 179
           +EN+ +E++DWSH+QQ+GKPLDGESVVQRT+YL+K  +   ++ AY+ AR+EFYR R+  
Sbjct: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180

Query: 180 XXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239
                       MFGSVF  S I++GI+KEQKVI  WK+KA  +TE++AARR NPS+SW 
Sbjct: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240

Query: 240 SAEAGATEENLDEQGSELLEL 260
           + E    + +  E+  E ++L
Sbjct: 241 TDEKDPKKNDDIEEDVEEIKL 261

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  275 bits (704), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 175/240 (72%), Gaps = 2/240 (0%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++Q NA+N++ERTSAYL++G++K  P WY+VVA  PP+KKFTREP+ INPSTN+     
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  RDNREAVNKK-GFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119
           +  ++ +N+  G YKTR N +D+K   + LYK PKL Y+ED+LR LF++QHPWEL+RPKI
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKT-DKMDMITAYNQARFEFYRFRIX 178
           ++EN  E  +DWS + QLGKPLDGESVVQRT++LLKT +   +I AYNQARFEFYR R+ 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 179 XXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238
                        MFG+VF  + I+FGIEKEQ++I  WK +A +ETE+  A+R+  S SW
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  273 bits (697), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 177/244 (72%), Gaps = 7/244 (2%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60
           M++Q NA+N++ERTS+YL+SGLL   PAWY VVA+IPP+KKF R P+  NPS N+ L  L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  R--DNREAVNKKG--FYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSR 116
           R  D R   ++ G   +K+R NKLD+K +S  +YKP KL Y+EDQLR +F+ QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 117 PKILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMITAYN--QARFEFYR 174
           PKI+VEN+ +E +DWSHIQQLGK LDGE+VVQR MYL+K  K+ MI   +  +AR+EFYR
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMK-KKLIMIFQKHTIKARYEFYR 179

Query: 175 FRIXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANP 234
            R+              MFGSVF  S I+FG+++EQKVI  WK+KA  ETEL+ A+R NP
Sbjct: 180 VRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239

Query: 235 SDSW 238
           S++W
Sbjct: 240 SETW 243

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  271 bits (693), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 175/242 (72%), Gaps = 6/242 (2%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNE---DL 57
           M++QTNA+NI+ERTSA+L+SG+++  PAWY VVA  PP KKF R+P  +NPST +   +L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 58  AVLRDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRP 117
               D++   N    YKTR +  D++V+ N LY+PPKL Y+EDQLR LF+DQHPWE SRP
Sbjct: 61  KSFLDSKR--NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRP 118

Query: 118 KILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMI-TAYNQARFEFYRFR 176
            IL+EN++  +FDWS IQQLGK LDGESVVQR ++LL+    D + TAY++ARFEFYR R
Sbjct: 119 MILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178

Query: 177 IXXXXXXXXXXXXXXMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236
           +              M+GSV+ QS I+FG+EKE KVI+ WK++  +ETE + ARRA+PS+
Sbjct: 179 MQQELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSE 238

Query: 237 SW 238
           SW
Sbjct: 239 SW 240

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  211 bits (537), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 136/183 (74%), Gaps = 12/183 (6%)

Query: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNE----- 55
           M++QTNA+N+++RTS YL++GLLK TPAWY VVA+IPP  KF REP+L +P + +     
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 56  DLAVLRDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELS 115
           D+   R NR        YKTR    DR+  +  ++KP KL+++ED+LR+LFF QHPWELS
Sbjct: 61  DIMTDRLNRNTET----YKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELS 114

Query: 116 RPKILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYR 174
           RPK+LVEN   E++DWS + QLGKPLDGESVVQRT+YLLK+    +M+ AY+QARFEFYR
Sbjct: 115 RPKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYR 174

Query: 175 FRI 177
            R+
Sbjct: 175 LRM 177

>ZYRO0G19206g Chr7 (1593126..1593593) [468 bp, 155 aa] {ON} similar
           to uniprot|P04037 Saccharomyces cerevisiae YGL187C COX4
           Subunit IV of cytochrome c oxidase which is the terminal
           member of the mitochondrial inner membrane electron
           transport chain N-terminal 25 residues of precursor are
           cleaved during mitochondrial import
          Length = 155

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 7/96 (7%)

Query: 53  TNEDLAVLRDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPW 112
           T   LA ++DN   +       T P  L++     +L    KL+ VE      FFD  P 
Sbjct: 33  TASSLAEVKDNETLIGPGAKEGTVPTDLEQATGLERLELLGKLEGVE------FFDTKPL 86

Query: 113 ELSRPKILVENSLEERF-DWSHIQQLGKPLDGESVV 147
           + SR   + +  + E + D+ ++   G P D  +++
Sbjct: 87  DSSRKGTMADPIVLESYEDYRYVGCTGSPADSHTIM 122

>TDEL0A04910 Chr1 complement(866033..867814) [1782 bp, 593 aa] {ON}
           Anc_5.625 YDR263C
          Length = 593

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 36  IPPTKKFTREPRLINPSTNEDLAVLRDNREAVNKKGFYKTRPNKLDRKVN 85
           I P+   T  PRL+  ST+ D ++L   R +  ++      PNK+DR VN
Sbjct: 491 IGPSAPRTAGPRLL--STSADFSILHQFRYSGTREPLQAKNPNKMDRMVN 538

>Skud_3.11 Chr3 complement(22077..23327) [1251 bp, 416 aa] {ON}
           YCL052C (REAL)
          Length = 416

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 78  NKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKILVE-NSLEERFDWSHIQQ 136
           +K++R   ++ LYKP  + Y      T  F + P  L  PK+ V+  SLEER    ++  
Sbjct: 192 SKMERCQKTSLLYKPGHIAYNHSIQTTSVFLEQPIGL-HPKVKVDLTSLEERSQCMYLMH 250

Query: 137 LGKPLD 142
           L  PL+
Sbjct: 251 LQLPLE 256

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,485,742
Number of extensions: 1123793
Number of successful extensions: 4004
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4059
Number of HSP's successfully gapped: 35
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)