Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B062302.292ON72372335390.0
NDAI0B035302.292ON73971925900.0
Suva_9.1082.292ON72274324760.0
Skud_9.822.292ON72272124500.0
YIL091C (UTP25)2.292ON72171624500.0
Smik_9.882.292ON72471924470.0
KAFR0J013402.292ON72873423660.0
SAKL0E07546g2.292ON71873023450.0
KNAG0A054002.292ON72172323130.0
TBLA0B059702.292ON71974022210.0
TDEL0G022202.292ON71071422100.0
Kpol_1039.462.292ON70456822070.0
KLTH0G10494g2.292ON74774221960.0
Ecym_33312.292ON70865321760.0
KLLA0E08229g2.292ON70471321750.0
Kwal_27.115032.292ON72773521730.0
CAGL0D04180g2.292ON70072021540.0
ZYRO0A02002g2.292ON70972821310.0
TPHA0D015202.292ON71656520930.0
ADL209C2.292ON70466020430.0
TBLA0C055802.164ON540289790.62
ZYRO0G11792g5.145ON84762752.5
TDEL0B035208.758ON146247752.5
SAKL0H16720g8.276ON22845732.8
NCAS0G025602.164ON556248717.2
NDAI0C045205.387ON33636707.2
Suva_14.2372.176ON147078708.7
CAGL0G05698g2.68ON1095127708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B06230
         (723 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...  1367   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...  1002   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   958   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   948   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   948   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   947   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   915   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   907   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   895   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   860   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   855   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   854   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   850   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   842   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   842   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   841   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   834   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   825   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   810   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   791   0.0  
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...    35   0.62 
ZYRO0G11792g Chr7 (935438..937981) [2544 bp, 847 aa] {ON} some s...    33   2.5  
TDEL0B03520 Chr2 complement(626658..631046) [4389 bp, 1462 aa] {...    33   2.5  
SAKL0H16720g Chr8 (1472129..1472144,1472210..1472880) [687 bp, 2...    33   2.8  
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...    32   7.2  
NDAI0C04520 Chr3 (1026605..1027615) [1011 bp, 336 aa] {ON} Anc_5...    32   7.2  
Suva_14.237 Chr14 (426951..431363) [4413 bp, 1470 aa] {ON} YNL10...    32   8.7  
CAGL0G05698g Chr7 complement(541468..544755) [3288 bp, 1095 aa] ...    32   8.9  

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score = 1367 bits (3539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/723 (92%), Positives = 670/723 (92%)

Query: 1   MSKRSHEGSQHAGSKKRGRQELRTIRRSAGAKVSSQEVFNSSIVXXXXXXXXXXXXXXXX 60
           MSKRSHEGSQHAGSKKRGRQELRTIRRSAGAKVSSQEVFNSSIV                
Sbjct: 1   MSKRSHEGSQHAGSKKRGRQELRTIRRSAGAKVSSQEVFNSSIVDDEEQELNESNESEQE 60

Query: 61  XXXXXXXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXX 120
                  KKNKVYGALLTILKSEHPEL      RVDDSKSGEDKGSELASDDGK      
Sbjct: 61  EDIDEEEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDE 120

Query: 121 XXXXXXGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAF 180
                 GLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAF
Sbjct: 121 AQQIEDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAF 180

Query: 181 NTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVAND 240
           NTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVAND
Sbjct: 181 NTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVAND 240

Query: 241 MLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRIL 300
           MLDSKKDPLGPLQKELVDPMFQYRDILC            RDLYALHALNHVYKTRDRIL
Sbjct: 241 MLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRIL 300

Query: 301 KDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQF 360
           KDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQF
Sbjct: 301 KDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQF 360

Query: 361 HDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV 420
           HDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV
Sbjct: 361 HDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV 420

Query: 421 ENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMW 480
           ENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMW
Sbjct: 421 ENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMW 480

Query: 481 YINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQ 540
           YINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQ
Sbjct: 481 YINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQ 540

Query: 541 TFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKE 600
           TFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKE
Sbjct: 541 TFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKE 600

Query: 601 KTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPT 660
           KTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPT
Sbjct: 601 KTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPT 660

Query: 661 NPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVY 720
           NPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVY
Sbjct: 661 NPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVY 720

Query: 721 EFQ 723
           EFQ
Sbjct: 721 EFQ 723

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/719 (69%), Positives = 566/719 (78%), Gaps = 14/719 (1%)

Query: 15  KKRGRQELRTIRRSAGAK-------VSSQEVFNSSIVXXXXXXXXXXXXXXXXXXXXXXX 67
           +KRGRQELRTIRRSA  K           +                              
Sbjct: 25  RKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDEDE 84

Query: 68  KKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXXG 127
           +K KVYGALLTIL++EHPE       +    K      +   + D +             
Sbjct: 85  RKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEEDETEQ 144

Query: 128 LARG---SDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGS 184
           +  G    D + SDD++ ND++    D++S+DEQDPFESHFN+ +E+  D L+ AF +  
Sbjct: 145 IENGLLDRDDEQSDDDQLNDSN----DVESDDEQDPFESHFNKPTEQFVDKLHAAFESRE 200

Query: 185 VKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDS 244
           +KYK+TK VI D+ +VISS PTI G+E       S+    SI SYF+KQRL++ N++L+ 
Sbjct: 201 IKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNP 260

Query: 245 KKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDNG 304
           K DPL PLQKEL+DPMFQY+DIL             RDLYALHALNHVYKTRDRILK+N 
Sbjct: 261 KVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQ 320

Query: 305 RLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDET 364
           RLQDN+DTEY DQGFTRPKVLIVVPTRDTAYEV  KII KSGLDQVDKKGKF DQF D++
Sbjct: 321 RLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDS 380

Query: 365 LPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTD 424
           LPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTD
Sbjct: 381 LPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTD 440

Query: 425 KKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYIND 484
           KK RQDDFLSSIE+LI+DQLHS+EYQNLAH+FTIFDHLNKIP +QH+ADFSRIRMWYIND
Sbjct: 441 KKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYIND 500

Query: 485 QARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQR 544
           QA+LFRQTM+FTKYV+PAANA+INNRCRNW GRWKNH+I+ PE S+I +LGLK+KQ FQR
Sbjct: 501 QAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQR 560

Query: 545 FDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTL 604
           FD+MGGS++DEPDYRFKHF+SVIIPSIVKSTSY DGILIYIPDYTDYVRIRNYLKEKT +
Sbjct: 561 FDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRI 620

Query: 605 LFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEF 664
           LFGDINEYSEQRELNSNRSL QQGRVKVLLYTERLHHYRRYE+KGVKSVVFYKPPTNPEF
Sbjct: 621 LFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEF 680

Query: 665 YNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           YNEVVR+IGK+AFLGN DLNISTVRT+YCKLDGLSLERIVG+KRAGILCHAQNEVYEF+
Sbjct: 681 YNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/743 (63%), Positives = 563/743 (75%), Gaps = 46/743 (6%)

Query: 3   KRSHEGSQH-AGSKKRGRQELRTIRRSAGAK---VSSQEV---FNSSIVXXXXXXXXXXX 55
           K + E  +H  G +KRGRQE+R I+R+   +   V + EV      S+            
Sbjct: 4   KSARENDEHFRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAG 63

Query: 56  XXXXXXXXXXXXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKX 115
                       K+ KVY ALLTILKSEHPE       R     +GE+  +         
Sbjct: 64  SESDLDIGDEEEKQEKVYDALLTILKSEHPE-----PKRKKTKATGENNEA--------- 109

Query: 116 XXXXXXXXXXXGLARGSDGQPSDDEED---------------NDAHSNVEDIDSEDEQDP 160
                      G+   +D +P DD+ +               +   +  +++DSEDEQDP
Sbjct: 110 -------VDQTGVNENTDSEPVDDQLEIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDP 162

Query: 161 FESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSA 220
           FESHFNQVSEK  DD++ AF   ++KYKS KS +GD+++ I S P + G E   E     
Sbjct: 163 FESHFNQVSEKYVDDVSNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDETPVER---P 219

Query: 221 PKSSSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXX 280
            KSSSI+SYFLKQRL++ N +LD K DPL  LQK+LVDPMFQY+DIL             
Sbjct: 220 YKSSSIYSYFLKQRLKIQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEY 279

Query: 281 RDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISK 340
           RDLY LHALNH+YKTRDRILK+N RLQDN DTE+ DQGFTRPKVLIVVPTRD AY V+ K
Sbjct: 280 RDLYTLHALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDK 339

Query: 341 IISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLY 400
           II KSG+DQVDKKGKF DQF D++LPPSSKPKSFQHIF+GNT+DFFV+G+KFTRKAIKLY
Sbjct: 340 IIKKSGIDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLY 399

Query: 401 SNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFD 460
           SNFYQSDIIVCSPLG+QMI+ENTDKK RQDDFLSSIE+++IDQLHSIEYQN++H+FTIFD
Sbjct: 400 SNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 459

Query: 461 HLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKN 520
           H+NKIP+QQHEADFSRIRMWYIN+QA+L RQTM+FTKY++PAAN+LIN RCRN AGRWKN
Sbjct: 460 HINKIPDQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKN 519

Query: 521 HEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDG 580
           H++IE E S+I QLGLK++Q FQRFD++G S+I+EPDYRFK F+SVIIPSIVKST Y DG
Sbjct: 520 HKVIESETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDG 579

Query: 581 ILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLH 640
           ILIYIPDYTD++RIRNY+KEKTT+LFGDINEYS Q++LN+NRSLFQQGRVKVLLYTERLH
Sbjct: 580 ILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLH 639

Query: 641 HYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSL 700
           HYRRYE+KGVK+V+FYKPP NPEFYNE VRYIGK+AFLGN DLNISTVR +Y KLDGLSL
Sbjct: 640 HYRRYEIKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSL 699

Query: 701 ERIVGSKRAGILCHAQNEVYEFQ 723
           ERIVG+KRAG+L HAQ EVYEF+
Sbjct: 700 ERIVGTKRAGVLSHAQKEVYEFK 722

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/721 (63%), Positives = 546/721 (75%), Gaps = 17/721 (2%)

Query: 10  QHAGSKKRGRQELRTIRRSAGAKVSSQE------VFNSSIVXXXXXXXXXXXXXXXXXXX 63
            H G +KRGRQELR I+RS+G +    +      V    +                    
Sbjct: 12  HHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDVG 71

Query: 64  XXXXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXX 123
               KK KVY ALLTILKSEHPE               E+        DG          
Sbjct: 72  DEDEKKKKVYDALLTILKSEHPEPKRMKT-------KAEESSDRTTQSDGNENAESEPVD 124

Query: 124 XXXGLARGSDGQPSDDEEDNDAHSNV-EDIDSEDEQDPFESHFNQVSEKTADDLNTAFNT 182
               +  G  G   D+ ED+ +     +D+DSEDEQDPFESHFNQV EK  DDL+ AF +
Sbjct: 125 DQLEIENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKS 184

Query: 183 GSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDML 242
            +++YKS K+ +  +++ I + P ++G+E++ E   S  KSSSI+SYFLKQRL++ N + 
Sbjct: 185 KNIRYKSVKAPLNGDESYIYAQPVVVGEESSVE---SPYKSSSIYSYFLKQRLKIQNGLQ 241

Query: 243 DSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKD 302
           D K DPL  LQ++LVDPMFQY+DIL             RDLY LH LNH+YKTRDRILK+
Sbjct: 242 DKKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKN 301

Query: 303 NGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHD 362
           N RLQDN DTE+ DQGFTRPKVLIVVPTRD AY V+ KIISKSG+DQVDKKGKF DQF D
Sbjct: 302 NQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRD 361

Query: 363 ETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVEN 422
           ++LPP SKP+SFQHIFKGNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+EN
Sbjct: 362 DSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILEN 421

Query: 423 TDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYI 482
           TDKK RQDDFLSSIE+++IDQLHSIEYQN++H+ TIFDHLNKIP+QQHEADFSRIRMWYI
Sbjct: 422 TDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYI 481

Query: 483 NDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTF 542
           N+QA+ FRQTM+FTKY++P  N+LIN RCRN AGRWKNH  I PE S+I QLGLK++Q F
Sbjct: 482 NEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIF 541

Query: 543 QRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKT 602
           QRFD +G S+++EPDYRFK F+SV+IPSIVKST Y DGILIYIPDYTD++RIRNY+KEKT
Sbjct: 542 QRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKT 601

Query: 603 TLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNP 662
           T+LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRY++KGVKSV+FYKPP NP
Sbjct: 602 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNP 661

Query: 663 EFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEF 722
           EFY+E VR+IGK+AF GN DLNISTVR +Y KLDG+SLERIVG+KRA +L HAQ EVYEF
Sbjct: 662 EFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEF 721

Query: 723 Q 723
           +
Sbjct: 722 K 722

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/716 (65%), Positives = 553/716 (77%), Gaps = 14/716 (1%)

Query: 13  GSKKRGRQELRTIRRSA-----GAKVSSQEVFNSSIVXXXXXXXXXXXXXXXXXXXXXXX 67
           G +KRGRQELR I+RS+     G+  + ++V                             
Sbjct: 15  GYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDEEG 74

Query: 68  KKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXXG 127
           KK KVY ALLTILKSEHPE         D+S     +  E   ++ +            G
Sbjct: 75  KKEKVYDALLTILKSEHPE-PKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIENG 133

Query: 128 LARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKY 187
           L    +         +D+  + +DIDSEDEQDPFESHFNQV EK  D L+ AF T SVKY
Sbjct: 134 LLGNHEDDND-----DDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKY 188

Query: 188 KSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKD 247
           KS K  + D+++ I + P +IG+E   E   S  +SSSI+SYFLKQRL+V N +LD K D
Sbjct: 189 KSVKGSLSDSESYIYAKPVVIGEEALVE---SPYRSSSIYSYFLKQRLKVQNGLLDKKTD 245

Query: 248 PLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDNGRLQ 307
           PL  LQK+LVDPMFQY+DIL             RDLYALH LNH+YKTRDRILK+N RLQ
Sbjct: 246 PLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQ 305

Query: 308 DNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPP 367
           DN DTE+ DQGFTRPKVLIVVPTR+ AY V+ KIISKSG+DQVDKKGKF DQF D++LPP
Sbjct: 306 DNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPP 365

Query: 368 SSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKN 427
            SKPKSFQHIF+GNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKK 
Sbjct: 366 KSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKK 425

Query: 428 RQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQAR 487
           RQDDFLSSIE+++IDQLHSIEYQN++H+FTIFDHLNKIP+QQHEADFSRIRMWYIN+QA+
Sbjct: 426 RQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAK 485

Query: 488 LFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDM 547
           LFRQTM+FTKY++PAAN+LIN RCRN AGRWKNH++I  E S+I Q GLK++Q FQRFD+
Sbjct: 486 LFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDI 545

Query: 548 MGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFG 607
           +G S+I+EPDYRFK F+SVIIP IVKST Y DGILIYIPDYTD++RIRNY+KEKTT+LFG
Sbjct: 546 IGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFG 605

Query: 608 DINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNE 667
           DINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYE+KGVKSVVFYKPP NPEFYNE
Sbjct: 606 DINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNE 665

Query: 668 VVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           VVR+IGK+AFLGN DLNISTVR +Y KLDGLSLERIVG+KRA +L HAQ E+YEF+
Sbjct: 666 VVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/719 (65%), Positives = 561/719 (78%), Gaps = 17/719 (2%)

Query: 13  GSKKRGRQELRTIRRSAGAKVSSQEVFNSSIVXXXXXXXXXX-------XXXXXXXXXXX 65
           G +KRGRQELR I+RS+  +   + V     V                            
Sbjct: 15  GYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLDVEDE 74

Query: 66  XXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSG-EDKGSELASDDGKXXXXXXXXXX 124
             KK KVY ALLTILKSEHPE         +D+K+  +  G+E  + + +          
Sbjct: 75  EGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLE--- 131

Query: 125 XXGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGS 184
              +  G  G   DD +D+   +  +D+DSEDEQDPFESHFNQVSEK  DDL+ AF + S
Sbjct: 132 ---IENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVDDLSNAFKSKS 188

Query: 185 VKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDS 244
           +KYKS K+ +GD+++ I + P ++G+E   E   S  +SSSI+SYFLKQRL+V N +LD 
Sbjct: 189 IKYKSVKASLGDDESYIYAKPFMVGEEALVE---SPYRSSSIYSYFLKQRLKVQNGLLDK 245

Query: 245 KKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDNG 304
           K DPL  +QK+L+DPMFQY+DIL             RDLYALH LNH+YKTRDRILK+N 
Sbjct: 246 KIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRILKNNQ 305

Query: 305 RLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDET 364
           RLQDN DTE+ DQGFTRPKVLIVVPTR+ AY V+ KIISKSG+DQVDKKGKF DQF D++
Sbjct: 306 RLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDS 365

Query: 365 LPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTD 424
           LPP SKPKSFQHIFKGNT+DFFV+G+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTD
Sbjct: 366 LPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTD 425

Query: 425 KKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYIND 484
           KK RQDDFLSSIE+++IDQLHSIEYQN++H+FTIFDH+NKIP+QQHEADFSRIRMWYIN+
Sbjct: 426 KKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINE 485

Query: 485 QARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQR 544
           QA+LFRQTM+FTKY++PAAN+LIN RC N AGRWKNH++I  E+S+I QLGLKV+Q FQR
Sbjct: 486 QAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQR 545

Query: 545 FDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTL 604
           FD++G S+I+EPDYRFK F+SVIIPSIVKS  Y DGIL+YIPDYTD++RIRNY+KEKTT+
Sbjct: 546 FDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTI 605

Query: 605 LFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEF 664
           LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYE+KGVKSVVFYKPP NPEF
Sbjct: 606 LFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEF 665

Query: 665 YNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           YNE VR+IGK+AFLGN DLNISTVR +Y KLDGLSLERIVG+KRA +L HAQ EVYEF+
Sbjct: 666 YNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/734 (61%), Positives = 557/734 (75%), Gaps = 20/734 (2%)

Query: 3   KRSHEGSQ-HAGSKKRGRQELRTIRRSAGAKV-SSQEVFNSSIVXXXXXXXXXXXXXXX- 59
           KRS  G+  + G +KRGR+ELR IRR+ G K   +QE  N   V                
Sbjct: 2   KRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAAN 61

Query: 60  ----------XXXXXXXXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELA 109
                              K +VYGALLTILKSEHPE       +V+      ++  E  
Sbjct: 62  GDDVGDEVGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESD 121

Query: 110 SDDGKXXXXXXXXXXXXGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVS 169
           + + +            G +   D    DD+E  D +      +S++EQDPFE+HFN V 
Sbjct: 122 ASEEEEDETQQIENALMG-SHADDASEDDDKEHGDDNE-----ESDEEQDPFETHFNSVD 175

Query: 170 EKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSY 229
           EK  D L+ +F    +KYKSTK  I +++  I S P +I  +  E   + +   SSIHSY
Sbjct: 176 EKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKP-VIKSDEIESPVELSVNKSSIHSY 234

Query: 230 FLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHAL 289
           FLKQRL++ N+++D K DPL PLQK+LVDPMFQY+DIL             RDLY+LH L
Sbjct: 235 FLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVL 294

Query: 290 NHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQ 349
           NH+YKTRD+ILK+N RLQDN+DTE  DQGFTRPKVLIVVPTRDTAY+VI KII+KSG+DQ
Sbjct: 295 NHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQ 354

Query: 350 VDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII 409
           VDKKGKF DQF +++LPPSSKPKSFQ IFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII
Sbjct: 355 VDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII 414

Query: 410 VCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQ 469
           +CSPLG+QMI+ENTDKK RQDDFLSSIE++IIDQLHSIEYQN++H+FTI +H+NKIP++Q
Sbjct: 415 ICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQ 474

Query: 470 HEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEAS 529
           H+ADFSR+RMWYINDQA+LFRQTM+FTKY++P AN+L+N +C+NW+GRWKNH++I   +S
Sbjct: 475 HDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSS 534

Query: 530 AISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYT 589
           +IS++G+K++Q FQRF+ + GSV+DEPDYRFK F+SV +P+IVK+T Y DG LIYIP+YT
Sbjct: 535 SISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYT 594

Query: 590 DYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKG 649
           DY+R+RNYLK+KTT+LFGDINEYS+Q++LNSNRSLFQQGRVKVLLYTERLHHYRRYE+KG
Sbjct: 595 DYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKG 654

Query: 650 VKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRA 709
           VK+VVFY+PP NPEFY EVVRYIGK+AFLGN DLNISTVR LY KLD LSLE IVGSKRA
Sbjct: 655 VKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRA 714

Query: 710 GILCHAQNEVYEFQ 723
           G+LCHAQNEVYEF+
Sbjct: 715 GVLCHAQNEVYEFK 728

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/730 (61%), Positives = 547/730 (74%), Gaps = 22/730 (3%)

Query: 1   MSKRSHEGSQHAG---SKKRGRQELRTIRRSAGAKVS-SQEVFNSS--IVXXXXXXXXXX 54
           +SKRS+    H G   +KK GR+ELRTI R+     + S++ F +   +           
Sbjct: 4   VSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMSSEEEELADNK 63

Query: 55  XXXXXXXXXXXXXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGE-DKGSELASDDG 113
                        KK KVY ALLT+L+SEHP             K G   +G E  SD+ 
Sbjct: 64  PRSDEEEEEDIETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDED 123

Query: 114 KXXXXXXXXXXXXGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTA 173
           +                    + +DDE+D  +  N  D D ED+ D FE HFN VSE  A
Sbjct: 124 EEEAIENALV-----------ETNDDEDDVGSDIN-GDEDDEDKADSFELHFNNVSELQA 171

Query: 174 DDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQ 233
             L +AF    ++YKS K  + +++  I S PT+ G++ +     S  KS  +HSYF+KQ
Sbjct: 172 TKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKS--LHSYFIKQ 229

Query: 234 RLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVY 293
           +L++ N++LD KK+ L PLQK LVDPMFQY+D+L             RDLYALH LNHVY
Sbjct: 230 KLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLL-YEYRSYEQEEEYRDLYALHVLNHVY 288

Query: 294 KTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKK 353
           KTRDRIL+++ +LQDNSD E  DQGFTRPKVLIVVPTRD AY++++KII KSGLDQVDK+
Sbjct: 289 KTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKR 348

Query: 354 GKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSP 413
           GKF DQF D +LPPSSKPKSF+HIFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSP
Sbjct: 349 GKFQDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSP 408

Query: 414 LGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEAD 473
           LG+Q+I+ENTDKK RQDDFLSSIE+++IDQLHSIEYQNL+H+ TIF H+NKIP+QQH+AD
Sbjct: 409 LGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDAD 468

Query: 474 FSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQ 533
           FSRIRMWYIN+QA LFRQTM+FTKY +P AN+LIN +CRN AGRWKNH I+ PE S+I+Q
Sbjct: 469 FSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQ 528

Query: 534 LGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVR 593
           LGLKV+Q FQRFD++GGS +DEPDYRFK F+SVII SI+KST Y DGIL+YIPDYTDYVR
Sbjct: 529 LGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVR 588

Query: 594 IRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSV 653
           +RN+L+EKTTLLFGDINEYSEQ++L SNR+LFQQG+VKVLLYTERLHH+RRYE+KGVKSV
Sbjct: 589 VRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSV 648

Query: 654 VFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILC 713
           +FYKPPTNPEFY EVVRYIGKSAFLG+ADLNISTVR +YCKLDGLSLER+VG+KRA +L 
Sbjct: 649 IFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLT 708

Query: 714 HAQNEVYEFQ 723
           H QNE+YEF+
Sbjct: 709 HGQNEIYEFK 718

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/723 (60%), Positives = 537/723 (74%), Gaps = 19/723 (2%)

Query: 14  SKKRGRQELRTIRRSAGAKVSSQEVFNSSIV-------XXXXXXXXXXXXXXXXXXXXXX 66
           S KRGR+ELR ++R+            S+ V                             
Sbjct: 5   SGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAE 64

Query: 67  XKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXX 126
            +K KVYGALLTILKSEHPE       +  D   G +    L  DD              
Sbjct: 65  ARKGKVYGALLTILKSEHPEAKKRKTKKSSD---GGEVDKILVHDDNHEELEEENEEEQI 121

Query: 127 GLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVK 186
             A   +   SD E++ D  +  E+ DSEDEQDPFESHFNQ  E   + L+ AF +  ++
Sbjct: 122 DNAILDNRTQSDSEDEQDVAA--EEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQ 179

Query: 187 YKSTK------SVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVAND 240
           Y+S K      + + D + +I S PT+ G +   ++   +    SI SYFLK+RL++ ND
Sbjct: 180 YRSVKLQPAKVTKVKD-EYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQND 238

Query: 241 MLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRIL 300
           +L++K D L  +QKELVDPMFQY+DIL             R LYALHALNHVYKTRDRIL
Sbjct: 239 LLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRIL 298

Query: 301 KDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQF 360
           K+N RLQ+NSDTE  DQGFTRPKVLI+ PTRDTAY +++ II+KSG+DQVDK+GKF DQF
Sbjct: 299 KNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQF 358

Query: 361 HDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV 420
           ++++LPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIVCSPLG+QMIV
Sbjct: 359 YEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIV 418

Query: 421 ENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMW 480
           ENTDKK RQDDFLSSIE+ IIDQLHSIEYQN++H++TIF+HLN IP++QH+ADFSRIRMW
Sbjct: 419 ENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMW 478

Query: 481 YINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQ 540
           YINDQAR FRQTM+FTKY++P AN++IN +CRNW+GRWKNH I+  EAS I +L L+V+Q
Sbjct: 479 YINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQ 538

Query: 541 TFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKE 600
            FQRF++ GGS++DEPDYRFK F+SVIIP I+KST Y DGILIYIP+YTDYVR+RNYLKE
Sbjct: 539 IFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKE 598

Query: 601 KTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPT 660
           KT +LFGDINEYS Q++L +NRSLFQQGR+KVLLYTERLHHYRRYE+KGVKSV+FYKPP+
Sbjct: 599 KTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPS 658

Query: 661 NPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVY 720
           +PEFY EVVR IG++AFLGN DLNISTVR +Y KLD L+LE +VG++RAG+LCH QNE+Y
Sbjct: 659 DPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIY 718

Query: 721 EFQ 723
           EF+
Sbjct: 719 EFK 721

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/740 (56%), Positives = 539/740 (72%), Gaps = 38/740 (5%)

Query: 1   MSKRSHEGSQHAGSKKRGRQELRTIRRSAGAK-----------------VSSQEVFNSSI 43
           MS    + +   G  KRGR + R+I++S+GAK                  S ++V N+SI
Sbjct: 1   MSGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSI 60

Query: 44  VXXXXXXXXXXXXXXXXXXXXXXXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGED 103
                                   KK +VY AL+TILKSEH E       ++ D+ +   
Sbjct: 61  -------------DKEAEVTEDLEKKKQVYDALVTILKSEHKE------PKMRDNLNETS 101

Query: 104 KGSELASDDGKXXXXXXXXXXXXGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFES 163
           K   L  +D                   S     ++ E+ND ++   D +S+++ DPF+S
Sbjct: 102 KEEHLTDEDLDEDEKFETEEQEIENNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDS 161

Query: 164 HFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKS 223
           HFNQ +E+  +    AF    +KY+S K  I + ++ I S P I+  E T+ +  S    
Sbjct: 162 HFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVK--SPVLK 219

Query: 224 SSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDL 283
           SSIHSY LK+RL++ ND+LD   + L  +QKELVDPMFQY+DIL             R L
Sbjct: 220 SSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSL 279

Query: 284 YALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIIS 343
           Y LH LNH+YKTRDRILK+N ++QDN D E+ DQGFTRPKVLIV PTRD  Y ++++II 
Sbjct: 280 YCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIK 339

Query: 344 KSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNF 403
           KSG+DQ+DKK KF DQF++E+L P+SKPKSFQ +FKGN+ND+FVLG+KFTRKAIKLYSNF
Sbjct: 340 KSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNF 399

Query: 404 YQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLN 463
           YQSDIIVCSPLG+ MI+ENTDKK RQDDFLSSIE++IIDQLHS+E+QN++HV +IF+H+N
Sbjct: 400 YQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHIN 459

Query: 464 KIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEI 523
           KIP++QH+ DFSRI+MWYINDQA+LFRQTMIFTKY++P+AN  +N +C+NW+GRWKNH++
Sbjct: 460 KIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKM 519

Query: 524 IEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILI 583
           I P  S+I QLGL+VKQ F RFD++GGS++DEPDYRFK+F+SVI+ SI KSTSY DG+LI
Sbjct: 520 ITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLI 579

Query: 584 YIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYR 643
           YI DYTDYVR+RNYLKEKTT+LFGDINEYS+Q+++NSNR+LFQQ RVKVLLYTERLHH+R
Sbjct: 580 YITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFR 639

Query: 644 RYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERI 703
           RYE+KGVK++VFYK PTNPEFYNEVVRYIGK+AF GN D+NIS VRT+Y KLDGL+LERI
Sbjct: 640 RYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERI 699

Query: 704 VGSKRAGILCHAQNEVYEFQ 723
           +G+KRA +L H QNE YEF+
Sbjct: 700 MGTKRAAVLTHGQNETYEFK 719

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/714 (60%), Positives = 523/714 (73%), Gaps = 21/714 (2%)

Query: 13  GSKKRGRQELRTIRRSAGAKVSSQ-EVFNSSIVXXXXXXX--XXXXXXXXXXXXXXXXKK 69
           G+ KRGR+ELR+IRR    K   + E  N S                           K+
Sbjct: 15  GTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNEEIANVEEDEENKR 74

Query: 70  NKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXXGLA 129
            KVYGALLTIL SEHP+        V   K       E +  D +             LA
Sbjct: 75  RKVYGALLTILNSEHPKPKPKQEVTVQSRK-------EDSESDVEEDERDEVEQLEDNLA 127

Query: 130 RGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKS 189
           R  D  PS+D+   DA        S+DEQD F+SHFNQV E   D L+ AF    +KYKS
Sbjct: 128 R-VDENPSEDDLSEDADEE-----SDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKYKS 181

Query: 190 TKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPL 249
            K  IG+N++++ S P ++  E+  ++ +   +  S+ SY  KQRL++ ND+   + + L
Sbjct: 182 AKVPIGENESMVYSKPLLL--EDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENL 236

Query: 250 GPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDNGRLQDN 309
              Q+ LVDPM QY D+L             RDLYALH LNHVYKTRD+ILK+N R+ DN
Sbjct: 237 TSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDN 296

Query: 310 SDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSS 369
            D +Y DQGFTRPKVLIVVPTRDTAY+V+ KII KSG+DQ+DKKGKF DQF +E+LPPSS
Sbjct: 297 PDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSS 356

Query: 370 KPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQ 429
           KPKSFQH+FKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENTDKK RQ
Sbjct: 357 KPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 416

Query: 430 DDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLF 489
           DDFLSSIE+ I DQLHSIEYQN++HV TIFDHLN IP++QH+ DF R+R+WYIN+QA+LF
Sbjct: 417 DDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLF 476

Query: 490 RQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMG 549
           RQTMIFTKYV+P ANALINN+C+N  GRWKNH  IEP  S+I +LGLKV+Q FQR D+  
Sbjct: 477 RQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGA 536

Query: 550 GSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDI 609
            S+++E D+RFK F+SVIIPSI+KST Y DGIL+YIPDY D++R+RNY+KEKTT++FGDI
Sbjct: 537 ASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDI 596

Query: 610 NEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVV 669
           NEYS Q++LNSNR+LFQQGR KVLLYTERLHH+RRYE+KGVKSVVFY+PPTNPEFY+EVV
Sbjct: 597 NEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVV 656

Query: 670 RYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           R+I KSA LG  DLNISTVRT+Y KLDG+SLERIVG+KRA IL H QNEVYEF+
Sbjct: 657 RFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/568 (67%), Positives = 480/568 (84%), Gaps = 2/568 (0%)

Query: 156 DEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEE 215
           D+ D FESHFN VS+   DD++  F    +KYKS K  +   ++ I   P ++ ++  +E
Sbjct: 139 DQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQ--DE 196

Query: 216 EKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXX 275
             D+   +SS  SYF+KQRL++ ND+LDS K+ L PL+K+L+DPMFQY+D+LC       
Sbjct: 197 TIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYEN 256

Query: 276 XXXXXRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAY 335
                R+LY+LH LNH+YKTRD+ILKDN RLQ+N D E  DQGFTRPKVLIVVPTRDTAY
Sbjct: 257 DEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAY 316

Query: 336 EVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRK 395
           +V+  II KSGLDQ+DKKGKF DQF D++LPP+SKPKSF+H+FKGNTNDFFVLG+KFTRK
Sbjct: 317 QVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRK 376

Query: 396 AIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHV 455
           AIKLYSNFYQSDII+CSPLG+QMI+ENTDKK RQDDFLSSIEV+I+DQLHSIEYQN++HV
Sbjct: 377 AIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHV 436

Query: 456 FTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWA 515
           +TI +H+NKIP+QQ EADFSRIRMWYINDQA+  RQTM+FT+Y++P ANA+IN +C N A
Sbjct: 437 YTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMA 496

Query: 516 GRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKST 575
           GRWKN++II  E S+I QLG+K+KQ FQRFD++GG+V+DE DYRFK+F+SV++ +IVKST
Sbjct: 497 GRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKST 556

Query: 576 SYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLY 635
            Y DGIL+YIP+YTDY+R+RNY+KEKTT+LF +INEYS Q++L+SNRS+FQQGR KVLLY
Sbjct: 557 GYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLY 616

Query: 636 TERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKL 695
           TERLHHYRRYELKG+KSV+FYKPPTNPEFYNEV+R+  K+AFLG +D+NIST+RT+Y KL
Sbjct: 617 TERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKL 676

Query: 696 DGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           DGL+L+RIVGSKRA ILCH QNE Y+F+
Sbjct: 677 DGLALQRIVGSKRAAILCHGQNESYDFK 704

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/742 (56%), Positives = 522/742 (70%), Gaps = 31/742 (4%)

Query: 7   EGSQHAGSKKRGRQELRTIRRSAGAKVS-SQEVFNSSIVXXXXXXXXXXXXXXXXXXXXX 65
           +GS    S K GR++LRTIR+++G +   ++E  N                         
Sbjct: 12  KGSNEYRSSKSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPELNEPAQD 71

Query: 66  XXKKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXX 125
                + Y ALLT+LK+EH         + DD K+  D  S +  ++             
Sbjct: 72  QRAGGEAYAALLTLLKAEHGG-PARRKTKTDDKKTSADPTSNVKDEEESESRDNEDEEED 130

Query: 126 XGLARGSDGQPSDD-----------------------EEDNDAHSNVEDIDSEDEQDPFE 162
                  +    D+                        E  DA       + ED+ D  E
Sbjct: 131 EDEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAAGFEEEDKPDTLE 190

Query: 163 SHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPK 222
            HFN VSEK  + L+ AF    V+Y+S K  +  N+  I S PT++   N      SAP 
Sbjct: 191 IHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLV---NEPASAVSAPD 247

Query: 223 SS-SIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXR 281
            S S++SYF+KQRL++ ND+LDS+ D L PLQK++VDPMFQY+D+L             R
Sbjct: 248 GSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDLL-YEYEDYDKETEYR 305

Query: 282 DLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKI 341
           DLYALH LNH+YKTRDRILK+N RLQ+N D E  DQGFTRPKVLIV PTRD AY+++SKI
Sbjct: 306 DLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKI 365

Query: 342 ISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYS 401
           I KSGLDQVDKK KF DQF  E LPPS KPKSFQ +FKGNTNDFFVLG KFTRK IKLYS
Sbjct: 366 IQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYS 425

Query: 402 NFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDH 461
           NFYQSDII+CSPLG+Q+I+ENTDKK RQDDFLSSIE+L++DQLHSIE+QN+ H+ +IF+H
Sbjct: 426 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEH 485

Query: 462 LNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNH 521
           +NKIP+QQH+ADFSRI+MWYINDQA+LFRQT+IFTK+ +P AN+LIN +CRN+AGRWKNH
Sbjct: 486 INKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNH 545

Query: 522 EIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGI 581
            +I PE S++ QLG++ +  FQRFD++G SV +EPD RFKHF SVI+P+IVKST Y DGI
Sbjct: 546 RVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGI 605

Query: 582 LIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHH 641
           L+YIPDYTD+VR+RNYL+EKTT+LFGDINEYSEQR+L SNR++FQQGRVKVLLYTERLHH
Sbjct: 606 LLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHH 665

Query: 642 YRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLE 701
           +RRYE+KGVK+V+FYKPPTNPEF+ EV RY+GKSAFLG ADLNIS VR L+ KLDGLSLE
Sbjct: 666 FRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLE 725

Query: 702 RIVGSKRAGILCHAQNEVYEFQ 723
           RIVG++RA +L H  NE YEF+
Sbjct: 726 RIVGTERAAVLTHGPNETYEFK 747

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/653 (62%), Positives = 508/653 (77%), Gaps = 9/653 (1%)

Query: 72  VYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXXGLARG 131
           VYGALL+IL S HPE+      RV   K+ +    E    +G                  
Sbjct: 64  VYGALLSILNSAHPEIRRK---RVKVEKTTDAVVEE--RKNGSRNYETDEVATISASLDD 118

Query: 132 SDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTK 191
           S  +  + EED+  +S+ ED  SEDE+DPFE HFNQ+SE   + L+ AF   +V+Y+STK
Sbjct: 119 SVDKDEEVEEDDGVYSDGED--SEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176

Query: 192 -SVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPLG 250
              + DN+  I S P I G + ++   D+     +IHSYF+K++L+V N +LD KK PL 
Sbjct: 177 LPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLT 236

Query: 251 PLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDNGRLQDNS 310
           PL K LVDP+FQYRD+L             RDLY LH LNH+YKTRDRILK+N +LQ+N 
Sbjct: 237 PLSKTLVDPIFQYRDLL-FEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQEND 295

Query: 311 DTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSK 370
           D E  DQGFTRPKVL+V PTR+TAY++I KII KSGLDQVDKK KF DQF++++LPP+SK
Sbjct: 296 DQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSK 355

Query: 371 PKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQD 430
           PKSFQH+FKGNTNDFFVLG+KFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKK RQD
Sbjct: 356 PKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQD 415

Query: 431 DFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFR 490
           DFLSSIE+L++DQLHS+E+QN AHV +IF H+NKIP++QH++DFSRIRMWYINDQARLFR
Sbjct: 416 DFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475

Query: 491 QTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGG 550
           QT+IFTKYV+P AN+LIN +C NW+GR+KN   I PE SAI+QLGLKV+Q F RFD+  G
Sbjct: 476 QTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTG 535

Query: 551 SVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDIN 610
           S +DEPDYRFK F+SV +P I KST Y DGIL+YIPDYTD++R+RNY K++T +LFG+I 
Sbjct: 536 SSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEIT 595

Query: 611 EYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVR 670
           EYS+QR++ SNR+LFQQG+VKVLLYTERLHH+RRY++KGVKSV+FYKPP+NPEFY E++R
Sbjct: 596 EYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIR 655

Query: 671 YIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
            IGK+AFLGNADLNISTVR  YCKLD LSLERIVGSKRA +L  +QNE+YEF+
Sbjct: 656 CIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/713 (58%), Positives = 525/713 (73%), Gaps = 22/713 (3%)

Query: 16  KRGRQELRTIRRSAGAKVS-SQEVFNSSIVXXXXXXXXXXXXXXXXXXXXXXXKKNKVYG 74
           K GR++LR I R+   +V    E   + +                         + + Y 
Sbjct: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQAYN 68

Query: 75  ALLTILKSEHPE-LXXXXXXRVDDSKSGEDKGSE---LASDDGKXXXXXXXXXXXXGLAR 130
           ALLT+LKSEHPE           DS+  E+   E   + S+D +            G+  
Sbjct: 69  ALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALDDVSGGVV- 127

Query: 131 GSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKST 190
                  D+E+  D+ S+V++  SEDE DPFESHF++ SE      +  F   +VKYKS+
Sbjct: 128 -------DEEDMEDSLSDVDE--SEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSS 178

Query: 191 KSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPLG 250
           K+ + + +++I S P +      +EE        ++ SYF+KQ+L++AND  ++   PL 
Sbjct: 179 KTDVSEEESLIYSKPCL-----DDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGL-PLT 232

Query: 251 PLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDNGRLQDNS 310
            +QKELVDPMFQY+D+L             RDLY+LHALNHVYKTRDRILK+N +LQ+N+
Sbjct: 233 EIQKELVDPMFQYKDML-YEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENN 291

Query: 311 DTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSK 370
           D E  DQGFTRPKVLIVVPTRD A++++ KI+ KSGLDQ DKK KF DQF +++LPP+SK
Sbjct: 292 DEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSK 351

Query: 371 PKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQD 430
           PKSFQHIF+GNTNDFFVLG+KFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKK RQD
Sbjct: 352 PKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQD 411

Query: 431 DFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFR 490
           DFLSSIEV+IIDQLHSIEYQN  HV TIF H+NKIPEQQ EADFSRIRMWYIN+QA+ FR
Sbjct: 412 DFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFR 471

Query: 491 QTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGG 550
           QT++FTKY++P AN+++N +CRN AGRWKNH  I+PE S+I QLGLKV+Q FQRFD+ GG
Sbjct: 472 QTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGG 531

Query: 551 SVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDIN 610
           + +DEPDYRFK F+SVI+PSIVKST Y DGIL+YIPDYTD++R+RNYLKEKTT++FG+IN
Sbjct: 532 TALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEIN 591

Query: 611 EYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVR 670
           EYS Q++L SNR+ FQ G+VKVLLYTERLHH+RRYE+K VKSV+FYKPP NPEFY+EVVR
Sbjct: 592 EYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVR 651

Query: 671 YIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
            IGK+ FLGN D+NISTVR +Y K+DGLSLER+VGSKRA +L H QNEVYEF+
Sbjct: 652 NIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/735 (57%), Positives = 534/735 (72%), Gaps = 27/735 (3%)

Query: 3   KRSHEGSQHAGSK--KRGRQELRTIRRSAGAKVSSQEVFNSSIVXXXXXXXXXXXXXXXX 60
           +R  +  +H G K  K GR++LR+IR+++  +  S++  +  +                 
Sbjct: 6   RRYTDHDRHDGEKFTKGGRKQLRSIRKAS--RYDSKKPEDEPVETPEEEINEVEDVHEER 63

Query: 61  XXXXXXXKKN-KVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXX 119
                  + N + Y ALLT+LK+EH               SGE + SE++ +  +     
Sbjct: 64  TEVSRKQESNGEAYAALLTLLKAEHGTGKKKVKAGPQGEGSGESQISEISPEAEQDEEEE 123

Query: 120 XXXXXXXGLARG------SDGQPS----DDEEDNDAHSNVEDIDSEDEQDPFESHFNQVS 169
                   +  G      SDG  +    D+E+DN+   +      E+  DP E+HFN V 
Sbjct: 124 EEEEEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQD------ENASDPLEAHFNSVP 177

Query: 170 EKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSS-SIHS 228
           EK  D L+ AF T  V+Y+S+K  I  N+  I S P +  +  T  +    P+ + S+  
Sbjct: 178 EKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQ---VPQGTQSLSP 234

Query: 229 YFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHA 288
           YF+KQRL++ ND+LDSK + L PLQK++VDP+FQY+D+L             RDLYALHA
Sbjct: 235 YFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQETEY-RDLYALHA 292

Query: 289 LNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLD 348
           L+H+YKTRDRILK+N RLQDN D E  DQGFTRPKVLIVVPTRD AY V+SKII KSGLD
Sbjct: 293 LDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLD 352

Query: 349 QVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDI 408
           QVDKK KF DQF+ ++LPP  KPKSFQ +FKGNTNDFFVLG KFTRK IKLYSNFYQSDI
Sbjct: 353 QVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDI 412

Query: 409 IVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQ 468
           IVCSPLG+Q+I+ENTDKK RQDDFLSSIE+L+IDQLHSIE+QN+ H+ +IF+H+NKIP+Q
Sbjct: 413 IVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQ 472

Query: 469 QHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEA 528
           QH+ADFSRI+MWYINDQA+LFRQT+IFT++ TP AN+LIN +CRN+AGRWKNH I+  E 
Sbjct: 473 QHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEK 532

Query: 529 SAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDY 588
           S++SQLG++ +  FQRFD+ GG+  DEPD+RFKHF SVI+P+IV+ST Y DGIL+YIPDY
Sbjct: 533 SSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDY 592

Query: 589 TDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELK 648
           TD++R+RNYL+EKTT+LFGDI+EYSEQR+L +NR+LFQQGRVKVLLYTERLHH+RRYE+K
Sbjct: 593 TDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIK 652

Query: 649 GVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKR 708
           GVK+V+FYKPPTNPEF+ E VRY+ KSAFLG ADLNIS VR LY KLDGL+LERIVG++R
Sbjct: 653 GVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTER 712

Query: 709 AGILCHAQNEVYEFQ 723
           A IL H  NE YEF+
Sbjct: 713 AAILTHGPNETYEFK 727

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/720 (58%), Positives = 526/720 (73%), Gaps = 34/720 (4%)

Query: 16  KRGRQELRTIRRSAGAKVSSQE---VFNSSIVXXXXXXXXXXXXXXXXXXXXXXXKKNKV 72
           KRGR+ELR+IRR+   K+  +    V +S  V                        K +V
Sbjct: 3   KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDD----KEQV 58

Query: 73  YGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXXGLARGS 132
           Y ALLTILKSEH E         D  K+  D   E +  + +              A   
Sbjct: 59  YNALLTILKSEHKE---------DKVKTHRDHDEEESEAEEEEQAEDQYND-----AFAD 104

Query: 133 DGQPSDDEEDNDAHSNVEDIDSEDEQ-DPFESHFN-QVSEKTADDLNTAFNTGSVKYKST 190
                +D+++++     E+I+S+DE+ DPF++HFN + + K  + L  A     ++YKS 
Sbjct: 105 GESDDEDDDEDEQAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSI 164

Query: 191 KSVIGD------NKTVISSIPTIIGKENTEEEKDSAPK-SSSIHSYFLKQRLRVANDMLD 243
           K  +G        +  I S+P I G    E  K   PK   S+ SYFLK+RLR+ N++LD
Sbjct: 165 KLKVGSADEDQVQEDAIFSVPYIEG----ETPKIEDPKLKCSLSSYFLKKRLRIQNNLLD 220

Query: 244 SKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDN 303
           ++ + L  LQ+++VDPM QY+DIL             RDLY LH LNHVYKTRD+I+K+N
Sbjct: 221 TESNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNN 280

Query: 304 GRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDE 363
            +LQDN D+E+ DQGFTRPKVLI+ PTRD+AY++++K+I KSGLDQVDKKGKF DQF+D 
Sbjct: 281 QKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDP 340

Query: 364 TLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENT 423
           + PPSSKPKSFQHIFKGNTND+FVLGVKFTRKAIKLYSNFYQSDIIVCSPLG+QMIVENT
Sbjct: 341 SFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENT 400

Query: 424 DKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYIN 483
           DKK RQDDFLSS+EV IIDQ HSIEYQN  H+FTIFDHLNKIP++QH+ADFSRIRMWYIN
Sbjct: 401 DKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYIN 460

Query: 484 DQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQ 543
           DQA+ FRQTMIFTKY++P AN+L+N +CRN  GRWKNH+I+  E S++  +GLKV+Q FQ
Sbjct: 461 DQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQ 520

Query: 544 RFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTT 603
           RF+++G SV DEPDYRFK F+SV+I +I KST Y DG LIYIP+Y+DYVR+RNY+KEKT+
Sbjct: 521 RFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTS 580

Query: 604 LLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPE 663
           +LFGDINEYSEQR L SNR+LF QGR+KVLLYTERLHH+RRYELKGVK+VVFYKPP++PE
Sbjct: 581 ILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPE 640

Query: 664 FYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           FY EVVRYIGK+ FLG+ADLNISTVR  Y KLDGL+LE+IVG+KR G+L H QNE YEF+
Sbjct: 641 FYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/728 (57%), Positives = 530/728 (72%), Gaps = 24/728 (3%)

Query: 1   MSKRSHEGSQHA-GSKKRGRQELRTIRRSAGAKVSSQEVFNSSIVXXXXXXXXXXXXXXX 59
           M KR+  G+    GS+KRGR++LR+IRR+   K   +E                      
Sbjct: 1   MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSEEDAT 60

Query: 60  XXXXXXXXKKNKVYGALLTILKSEHPELXXXXXXR----VDDSKSGEDKGSELASDDGKX 115
                    K K YGALLTILKSEHPE       +    + D  S +D   EL+ D+   
Sbjct: 61  NEVQEQEDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDD---ELSEDEKGE 117

Query: 116 XXXXXXXXXXXGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADD 175
                        A   D    ++ +  +  S  ++ +SEDE+DPFESHFN  SE + D 
Sbjct: 118 VE-----------ANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSE-SIDS 165

Query: 176 LNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRL 235
           L+ A+    +  KS K  + D++++I +  T+ GK    +E +       + SY LK++L
Sbjct: 166 LDEAWKQKKIVNKSGKIRVDDDESLIYT-KTLAGKG---QEFELPSHKGHLSSYPLKRKL 221

Query: 236 RVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKT 295
           ++ N++L+S+ D L PLQ+++VDP+FQYRD+L             RDLY LH LNH+YKT
Sbjct: 222 KIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKT 281

Query: 296 RDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGK 355
           RDRILKDN RL  N D E+ DQGFTRPKVLIV PTRDTAY+++SK+I KSGLDQVDKK K
Sbjct: 282 RDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSK 341

Query: 356 FNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLG 415
             DQF ++ LPPSSKPKSF+H FKGNTNDFFVLGVKFTRKAI+LYSNFYQSD+IVCSPLG
Sbjct: 342 LRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLG 401

Query: 416 MQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFS 475
           +Q+I+ENTD+K RQDDFLSSIE++IIDQL+SIE+QN++H+FTIF H+NKIP++QH+ DF 
Sbjct: 402 LQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFG 461

Query: 476 RIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLG 535
           R+RMWYIN+QA+L RQT+IFT+YVTP AN L+N +CRN  GRWKNH  I  E S++S+LG
Sbjct: 462 RVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLG 521

Query: 536 LKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIR 595
            +V+Q FQR D+ G SV+DEPDYRF+ F+SVI+PSI KST Y DGIL+YIPDY D++R+R
Sbjct: 522 FRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVR 581

Query: 596 NYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVF 655
           NYLK+KTT+LFGDINEYS+ R+L S RSLFQQGR+KVLLYTERLHH+RRYE+KGVKSV+F
Sbjct: 582 NYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIF 641

Query: 656 YKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHA 715
           Y+PP+NPEFYNEVVRYIGKSAFLG+ DLNISTVR +Y KLDGL+LERIV SKRA +L H 
Sbjct: 642 YQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHG 701

Query: 716 QNEVYEFQ 723
           QNE+YEF+
Sbjct: 702 QNEIYEFK 709

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/565 (67%), Positives = 464/565 (82%), Gaps = 5/565 (0%)

Query: 161 FESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKT--VISSIPTIIGKENTEEEKD 218
           F+ HFNQV E   D ++  F+   +KY S K  +  ++    I S P +   +  + + +
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIV--DDGNKHKVE 212

Query: 219 SAPKSSSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXX 278
           S  K SS+ SYF+K+RL + N++LD K D L  LQK LVDPMFQY DIL           
Sbjct: 213 SPIKKSSLDSYFIKKRLEITNNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQ 271

Query: 279 XXRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVI 338
             R+LY LH LNH+YKTRD++LKDN RLQ+N+++E+ DQGFTRPKVLIVVPTRDTAY V+
Sbjct: 272 EYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVV 331

Query: 339 SKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIK 398
             II KSGLDQV+KKGKF  QF +++LPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKA+K
Sbjct: 332 ETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALK 391

Query: 399 LYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTI 458
           LYSNFYQSD+I+CSPLG+ MI ENTDKK +QDDFLSSIE+ I+DQLHS+EYQN++H+  I
Sbjct: 392 LYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNI 451

Query: 459 FDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRW 518
           F+HLNKIP +QH+ADFSRIRMWYINDQARLFRQTMIFTKYV+P ANA+IN +CRN AGRW
Sbjct: 452 FEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRW 511

Query: 519 KNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYS 578
           +N   +  E S++ +LGLK++Q FQRFD++GG++ DEPD+RFK F SV++ SI+KST Y 
Sbjct: 512 RNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYE 571

Query: 579 DGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTER 638
           DGIL+YIP+Y+DY+R+RNY+KEKTTLLFGDINEYS+QRELNSNRSLFQQGRVKVLLYTER
Sbjct: 572 DGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTER 631

Query: 639 LHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGL 698
           LHHYRRYE+KGVKSV+FY PPTNPEFYNEVVR+IGK+AFLGN D+NI+TVR +Y KLD L
Sbjct: 632 LHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSL 691

Query: 699 SLERIVGSKRAGILCHAQNEVYEFQ 723
           SLERIVG++RA +L  A+NEVYEF+
Sbjct: 692 SLERIVGTQRAAVLSRAENEVYEFK 716

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/660 (57%), Positives = 489/660 (74%), Gaps = 29/660 (4%)

Query: 68  KKNKVYGALLTILKSEHPELXXXXXXRVDDSKSGEDKGSELASDDGKXXXXXXXXXXXXG 127
           ++++ YGALLT+L +EH              K  + +  +  ++  +             
Sbjct: 70  RESQSYGALLTLLSAEH-------------GKQRKKRLRKAEAEAAEAAEAGEDPEEAIT 116

Query: 128 LARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKY 187
            A  +  Q ++D ED    S     +S++EQD F+ HFN+VS      L+ AF  G  +Y
Sbjct: 117 AALENSAQDAEDAEDAFDDSG----ESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQY 172

Query: 188 KSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAP---KSSSIHSYFLKQRLRVANDM-LD 243
           +  K   G+ + + S    +   E TE      P    + S+  Y +KQRLR+ N +  D
Sbjct: 173 RVQKEARGEEEILYSK--PVASSEGTE-----GPVRVPARSLRGYAIKQRLRMHNGLTAD 225

Query: 244 SKKDPLGPLQKELVDPMFQYRDILCXXXXXXXXXXXXRDLYALHALNHVYKTRDRILKDN 303
             + PL P QK L+DPMFQY+DIL             R+LY LH LNHVYKTRDRILK+N
Sbjct: 226 DPEKPLTPQQKVLLDPMFQYQDILYEYEGYDREREY-RELYTLHILNHVYKTRDRILKNN 284

Query: 304 GRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDE 363
            +LQDN D E  DQGFTRPK L+VVPTR TAY+V+  ++ +SG++QVDKK KF DQF+D 
Sbjct: 285 QKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDP 344

Query: 364 TLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENT 423
           +LPP+SKPKSFQH+FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+I+ENT
Sbjct: 345 SLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENT 404

Query: 424 DKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYIN 483
           DKK RQDDFLSSIEV+++DQLHSIE+QN+AHV  IF H+NKIP+QQ +ADFSRIRMWYI 
Sbjct: 405 DKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIE 464

Query: 484 DQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQ 543
           DQA+LFRQTM+FT+Y++P ANAL+N +C NWAGR K+H ++  E S I QLGLK++Q FQ
Sbjct: 465 DQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQ 524

Query: 544 RFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTT 603
           RF+++GGS +DEPD+RFK F+SV++P I K+T Y  GIL+YIP+YTD++R+RNYLK+KT 
Sbjct: 525 RFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTR 584

Query: 604 LLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPE 663
           +LFGDINEYS+QR+L SNR+LFQ GR+KVLLYTERLHH+RR+ELKGVKSV+ YKPP+NPE
Sbjct: 585 ILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPE 644

Query: 664 FYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723
           FY E++RYIGKSAFLG ADLNI+TVR LY K+D L+LERIVG+KRA +L H QNEVYEF+
Sbjct: 645 FYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 114/289 (39%), Gaps = 52/289 (17%)

Query: 411 CSPLGMQMIVENT------DKKNRQDDFLSSIEVLI------IDQLHSIEYQNLAHV-FT 457
           CS  G    + NT       K  +  D     E++I      ID L  I   NL  V + 
Sbjct: 206 CSKFGKSSRIRNTCVYGGVPKGQQIRDLSRGSEIVIATPGRLIDMLE-IGKTNLKRVTYL 264

Query: 458 IFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFT----KYVTPAANALINNRCRN 513
           + D  +++ +   E    +I      DQ R  RQT++++    K V   A   +N+  + 
Sbjct: 265 VLDEADRMLDMGFEPQIRKIV-----DQIRPDRQTLMWSATWPKEVQNLARDYLNDPIQV 319

Query: 514 WAGRWKNHEIIEPEAS-AISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIV 572
             G       +E  AS  I+QL ++V   F++ D M            KH         V
Sbjct: 320 QIGS------LELAASHTITQL-VEVITDFEKRDRM-----------VKHLE-------V 354

Query: 573 KSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKV 632
            S      IL++         I  YL+E        I+   +QRE +   + F++GR  +
Sbjct: 355 ASQDKESKILVFASTKRTCDEITKYLREDGWPALA-IHGDKDQRERDWVLAEFREGRSPI 413

Query: 633 LLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNA 681
           ++ T+     R  ++KG+  V+ Y  P N E Y   +   G++   G A
Sbjct: 414 MVATDVAA--RGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTA 460

>ZYRO0G11792g Chr7 (935438..937981) [2544 bp, 847 aa] {ON} some
           similarities with uniprot|P46949 Saccharomyces
           cerevisiae YGR196C FYV8 Protein of unknown function
           required for survival upon exposure to K1 killer toxin
          Length = 847

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%)

Query: 147 SNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPT 206
           + V +IDSE ++ P +SHF++V   +A DLN     G    +S+ +     KT I S  T
Sbjct: 668 ATVSEIDSERDKGPLKSHFHEVLNTSAPDLNGEPMKGKRTGESSGAETPTQKTPIISGST 727

Query: 207 II 208
            +
Sbjct: 728 TV 729

>TDEL0B03520 Chr2 complement(626658..631046) [4389 bp, 1462 aa] {ON}
           Anc_8.758 YOR291W
          Length = 1462

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 650 VKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLD 696
           V+S+VF KP T+ +FY +  +YIG  A +     +IS VR +   LD
Sbjct: 675 VRSMVFPKP-TSFKFYEDSFKYIGFMAIIAMLGFSISCVRFIQIGLD 720

>SAKL0H16720g Chr8 (1472129..1472144,1472210..1472880) [687 bp, 228
           aa] {ON} similar to uniprot|Q12255 Saccharomyces
           cerevisiae YLR093C NYV1 v-SNARE component of the
           vacuolar SNARE complex involved in vesicle fusion
           inhibits ATP-dependent Ca(2 ) transport activity of
           Pmc1p in the vacuolar membrane
          Length = 228

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 132 SDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDL 176
           +D +P ++E ++  HSN+EDI  +  Q+    H +  +E T  DL
Sbjct: 106 TDLKPLNNENNDQLHSNIEDITKQFHQELLSYHDSSTTEATETDL 150

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 101/248 (40%), Gaps = 40/248 (16%)

Query: 440 IIDQLHSIEYQNLAHV-FTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFT-- 496
           +ID L  I   NL  V + + D  +++ +   E    +I      DQ R  RQT++++  
Sbjct: 249 LIDMLE-IGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIV-----DQIRPDRQTLMWSAT 302

Query: 497 --KYVTPAANALINNRCRNWAGRWKNHEIIEPEAS-AISQLGLKVKQTFQRFDMMGGSVI 553
             K V   A+  +N+  +   G       +E  AS  I+QL ++V   F++ D +     
Sbjct: 303 WPKEVKQLASDYLNDPIQVQIGS------LELSASHNITQL-VEVVSEFEKRDRL----- 350

Query: 554 DEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYS 613
                  KH  +        S      ILI+         +  YL+E        I+   
Sbjct: 351 ------LKHLETA-------SQDQESKILIFASTKRTCDEVTKYLREDGWPALA-IHGDK 396

Query: 614 EQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIG 673
           +QRE +     F+ GR  +++ T+     R  ++KG+  V+ Y  P N E Y   +   G
Sbjct: 397 DQRERDWVLEEFRSGRSPIMVATDVAA--RGIDVKGINYVINYDMPGNIEDYVHRIGRTG 454

Query: 674 KSAFLGNA 681
           ++   G A
Sbjct: 455 RAGATGTA 462

>NDAI0C04520 Chr3 (1026605..1027615) [1011 bp, 336 aa] {ON}
           Anc_5.387 YDR336W
          Length = 336

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 161 FESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGD 196
           + SH++   EK  + +N  FNT SVKY+   S  GD
Sbjct: 75  YNSHYHYPGEKEMNPINHFFNTASVKYEWGVSAFGD 110

>Suva_14.237 Chr14 (426951..431363) [4413 bp, 1470 aa] {ON} YNL102W
           (REAL)
          Length = 1470

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 24/78 (30%)

Query: 332 DTAYEVISKIISKSGLDQV---DKKGKFNDQFHD---------------------ETLPP 367
           D   E++  ++ K GLD +    +K K++ + HD                     +T+PP
Sbjct: 407 DVHEEIVPLLMDKYGLDNIRAKPQKMKYSFELHDIPPESEYLKVLLPYQTPKSSRDTIPP 466

Query: 368 SSKPKSFQHIFKGNTNDF 385
                +F H+F GN N F
Sbjct: 467 DLSSDTFYHVFGGNANIF 484

>CAGL0G05698g Chr7 complement(541468..544755) [3288 bp, 1095 aa] {ON}
            highly similar to uniprot|P33327 Saccharomyces cerevisiae
            YDL215c GDH2
          Length = 1095

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 8/127 (6%)

Query: 489  FRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRF--D 546
            F ++ ++  YV  A + + NN    +   WK   I +   + IS+L   + QT  +   +
Sbjct: 951  FIKSPLYKAYVVEAQSRIENNARLEFGQLWK---INQETGTPISELSNVLSQTINKLNDE 1007

Query: 547  MMGGSVIDEPDYRFKHFSSV--IIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTL 604
            ++    +   D + +++  +  IIP ++   +  D IL  IP+    V + +YL      
Sbjct: 1008 LVESEELWLNDLKLRNYLLLEKIIPKLLIDVAGKDQILTSIPENYLKVLLSSYLSSTFVY 1067

Query: 605  LFG-DIN 610
             FG D+N
Sbjct: 1068 KFGIDVN 1074

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,106,430
Number of extensions: 3564750
Number of successful extensions: 23506
Number of sequences better than 10.0: 246
Number of HSP's gapped: 23514
Number of HSP's successfully gapped: 260
Length of query: 723
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 606
Effective length of database: 40,065,477
Effective search space: 24279679062
Effective search space used: 24279679062
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)