Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B062202.293ON48648625410.0
NDAI0B035202.293ON50150119000.0
Smik_9.892.293ON49148718080.0
Skud_9.832.293ON49148717680.0
YIL090W (ICE2)2.293ON49148717580.0
Suva_9.1092.293ON49148717500.0
CAGL0D04202g2.293ON49949016850.0
KAFR0J013302.293ON49148816760.0
KNAG0A053902.293ON49749216730.0
TDEL0G022302.293ON48848316700.0
ZYRO0A02024g2.293ON48648016300.0
SAKL0E07524g2.293ON47948615410.0
Kpol_1003.422.293ON49048315010.0
KLTH0G10516g2.293ON47448613890.0
Kwal_27.115002.293ON47549213600.0
Ecym_33322.293ON51352212811e-173
ADL208W2.293ON50251112731e-172
TPHA0C034402.293ON57951612051e-160
TBLA0B059802.293ON49348611791e-158
KLLA0E08207g2.293ON48648411781e-157
TBLA0B069902.293ON53652811331e-150
TBLA0D032608.839ON76833761.1
Suva_13.4658.839ON73233723.5
Smik_13.4908.839ON73233713.7
YMR277W (FCP1)8.839ON73233714.1
Skud_13.4498.839ON73433714.2
KLTH0F07766g7.450ON465108696.1
AGL233Cna 1ON87264706.3
TBLA0A017606.137ON708116698.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B06220
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   983   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   736   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   701   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   685   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   681   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   678   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   653   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   650   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   649   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   647   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   632   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   598   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   582   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   539   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   528   0.0  
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   498   e-173
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   494   e-172
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   468   e-160
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   458   e-158
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   458   e-157
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            441   e-150
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...    34   1.1  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...    32   3.5  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...    32   3.7  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...    32   4.1  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...    32   4.2  
KLTH0F07766g Chr6 complement(669046..670443) [1398 bp, 465 aa] {...    31   6.1  
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    32   6.3  
TBLA0A01760 Chr1 complement(426097..428223) [2127 bp, 708 aa] {O...    31   8.2  

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/486 (100%), Positives = 486/486 (100%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
           KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
           ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 301 VVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYK 360
           VVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYK
Sbjct: 301 VVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYK 360

Query: 361 MACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAM 420
           MACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAM
Sbjct: 361 MACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAM 420

Query: 421 YAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIGT 480
           YAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIGT
Sbjct: 421 YAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIGT 480

Query: 481 TPGSKQ 486
           TPGSKQ
Sbjct: 481 TPGSKQ 486

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/501 (72%), Positives = 425/501 (84%), Gaps = 16/501 (3%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           MISSSF+RG+R  SA FYLLFTLISIPISFKIGGL CGLAFT +LF +YFLSTTLS+ AR
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
           KYGS   I LT  LYY QH IIASLLYLFLSGFS+E L+  L D  + +D I+D+ ++N+
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
            SST +NW LY+ YY FFVQPW+++LSYSTPFFTLSEGFFTILAIQA+GETNKWLV EIN
Sbjct: 121 -SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEIN 179

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SNTW+ISSLL SGGVITASLYYLYRIYVTPIWQLS+QTASLLGFTLSLVGGLG+YGIVT+
Sbjct: 180 SNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTE 239

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           KGSVIESS+FFAYIVRCIYEISPKLATTAT+EILE+FKEVWQRHQ NL + +NLL YY+N
Sbjct: 240 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNN 299

Query: 301 VVLKNIETIWESF--KINDN------------SFITSF-STERVITIFMPIWKLLKTFTI 345
            VL++I+ +WE    KIN N            +F+T+F S + ++ I  PIWKL K FT+
Sbjct: 300 FVLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTV 359

Query: 346 TVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRI 405
           +VPSSI+EL  VTY+MA ES+SPAV++NLCFRVLIFYSATRIIPALQRR+D+EL+KSRRI
Sbjct: 360 SVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRI 419

Query: 406 MKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCN 465
           MK+LYWYSPC+LIAMY HLILQYSGELK +LCLWGCN K    +QP++IVDSWGFWNWCN
Sbjct: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCN 479

Query: 466 IFFTILVYASELIGTTPGSKQ 486
           IFFTI++YASEL GTT  + +
Sbjct: 480 IFFTIIIYASELFGTTATANK 500

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 408/487 (83%), Gaps = 9/487 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           +S SF++  RIC+A FYLLFTL+SIPISFK+GGL CGL+FTV+LF LYF++TTL++ AR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
           YG +++I LT+ LYY QHFIIASLLYLFLSGFSN++L ++L+      +S  +  K N  
Sbjct: 64  YGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALK-NSL 122

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           +S Q N+VLYYYY+RF VQPWQFIL+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 123 NSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           NTW+ISSLLASGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+V GLG+YGIV+ K
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL++FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353
           +LKN E +W SF      K  D  +  I+  S E+V  I  P WK  K FT +VP SINE
Sbjct: 303 ILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSINE 362

Query: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413
            C VT KMA ES+SPA++VNLCFRVL+FYSATRIIPALQR++D +LRKSRRIMK LYWYS
Sbjct: 363 FCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473
           PCILIAMY HLILQYSGELK +LC+WGC+ K F SDQP+IIVDSWGFWNWCNIF TILVY
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTILVY 482

Query: 474 ASELIGT 480
           A+ELIG+
Sbjct: 483 ATELIGS 489

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/487 (69%), Positives = 411/487 (84%), Gaps = 9/487 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           +S SF++  R+C+A FYLLFTL+SIPISFK+GGL CGL+FTV+LF LYF++TTL++ A++
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
           +G +++I LTN LYY QHF+IASLLYLFLSGFSN++L ++L++ +   +S  D  K ++ 
Sbjct: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSL- 122

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           +S Q N+VLYYYYYRF VQPWQF+L+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           NTW+ISSLLASGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+V GLG+YGIV+ K
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL++FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353
           VLKN E +W SF      K  D  +  I+  S E+V  I  P WK  K FT +VP SINE
Sbjct: 303 VLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINE 362

Query: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIM+ LYWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYS 422

Query: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473
           PCILIAMY HLILQYSGELK +LC+WGC+ K F ++QP+IIVDSWGFWNWCNIF TILVY
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVY 482

Query: 474 ASELIGT 480
           A+ELIG+
Sbjct: 483 ATELIGS 489

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/487 (69%), Positives = 404/487 (82%), Gaps = 9/487 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           +S SF++  RIC+A FYLLFTL+SIPISFK+GGL CGL+FTV+LF LYF++TTL++ AR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
           +G R++I  TN LYY QHFIIASLLYLFLSGFSN++L ++L++     +S  +  K N  
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALK-NSL 122

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           +S Q N+VLYYYYYRF VQPWQF+L+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           NTW+ISSLL SGGVITASLYYLYRIYVTPIW LS+QTASLLG  LS+V GLG+YGIV+ K
Sbjct: 183 NTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQK 242

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL +FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353
           +LKN E +W SF      K  D  +  I+  S E+V  I  P WK  K FT +VP SINE
Sbjct: 303 ILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINE 362

Query: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIMK LYWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473
           PCILIAMY HLILQYSGELK +LC+WGC+ K F  DQP+IIVDSWGFWNWCNIF TILVY
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVY 482

Query: 474 ASELIGT 480
           A+ELIG+
Sbjct: 483 ATELIGS 489

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/487 (68%), Positives = 407/487 (83%), Gaps = 9/487 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           +S SF++  RIC+A FYLLFTL+SIPISFK+GGL CGL+FTV+LF LYF++TTL++ AR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
            G R++I LT+ LYY QHF+IASLL+LFLSGFSN++L ++L++ +   +S  +  K N  
Sbjct: 64  NGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALK-NSL 122

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           +S Q N+VLYYYYYRF VQPWQFIL+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           NTW+ISSLLASGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+V GLG+YGIV+ +
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQR 242

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL++FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353
           +LKN E +W SF        +D     I+  S E+V  I  P W+  K FT +VP SINE
Sbjct: 303 ILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINE 362

Query: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIMK LYWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473
           PCILIAMY HLILQYSGELK +LC+WGC+ K F  DQP+IIVDSWGFWNWCNIF TILVY
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVY 482

Query: 474 ASELIGT 480
           A+EL+G+
Sbjct: 483 ATELVGS 489

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/490 (66%), Positives = 387/490 (78%), Gaps = 10/490 (2%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           +I+    R IRI SA  YL+ TL+SIPISFKIGGL CGL+FTV+LF LY +STTLS+ AR
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGN-----KPIDSIADI 115
           +  +R ++  T+ILYY QH +IA LL+LFLSGFSNE+ +  L          P  S  D+
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122

Query: 116 FKKNVASSTQA----NWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGET 171
            K  +  +T A    NW LYYYY++F VQPWQ++LSYSTPFFTL EGFFTILAIQAIGET
Sbjct: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182

Query: 172 NKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGG 231
           NKWL YE+NSNTW+I+SLL SGGVIT SLYYLYRIYVTPIW+L++Q+ASLLGF LS+V  
Sbjct: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242

Query: 232 LGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSP 291
           LG+YGI++ KGSVIESS+FFAYIVRCIYEISPKLAT ATEEIL++ K+VWQ HQ NL + 
Sbjct: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302

Query: 292 NNLLSYYHNVVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSI 351
           +NLL+YYHNVVLKN E +WESF +  +  + +    R      P+WK  K FT++VPSSI
Sbjct: 303 DNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPSSI 362

Query: 352 NELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYW 411
            EL  VTYKMA ES+SPAVIVNLCFR+LIFYSATRIIPALQR    E R+SRRI+K+LYW
Sbjct: 363 VELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYW 422

Query: 412 YSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFPS-DQPKIIVDSWGFWNWCNIFFTI 470
           YSPC+LIAMY HLILQYSGELK ELCLWGC S  F S DQP+I+ DSW FWNWCNIF+T+
Sbjct: 423 YSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFWTV 482

Query: 471 LVYASELIGT 480
           LVYA+ELIGT
Sbjct: 483 LVYANELIGT 492

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/488 (66%), Positives = 398/488 (81%), Gaps = 11/488 (2%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           ++S S IRG+RI S TFYLLFTLISIP+SFKIGG+HCGL+FTV+LFI YFLSTTLSI AR
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
           + GSR +I+LT+++YY QH IIASLLY FLSGFSN++L  +L+DG + I+ +  +  +++
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVL--VANQDL 120

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
             S ++NW+LY YYY + V+PW+F+LSYSTPFF L+EGFFTILAIQAIGETN+WL  E N
Sbjct: 121 MVS-ESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKN 179

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SN+W+ISSLLAS GV+TASLYYLYRIYVTPIW+LS QTA+LLG  LSL  GLGI+GI+++
Sbjct: 180 SNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISE 239

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           +GSV+ESS+FFAYIVRCIYEISPKLATTAT+EILE+FKEVWQ HQ  L   +N+L+YY +
Sbjct: 240 RGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRS 299

Query: 301 VVLKNIETIWESF----KINDNSFITSFSTERVITI-FMPIWKLLKTFTITVPSSINELC 355
           V+LKN E IWE+F    K + N  + SF T     I F P+WK  K FTI+VP SI+EL 
Sbjct: 300 VILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELS 359

Query: 356 FVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPC 415
            +  +MA ESISPAV+VNLCFRVLIFYSATRIIP+LQR++  + RKSRRIMKVLYWYSPC
Sbjct: 360 GMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPC 419

Query: 416 ILIAMYAHLILQYSGELKDELCLWGCNSK---IFPSDQPKIIVDSWGFWNWCNIFFTILV 472
           ILIAMY HLILQYSGELK EL LWG +SK   +   ++  I+VDSW FWNWCNIF+TIL+
Sbjct: 420 ILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILI 479

Query: 473 YASELIGT 480
           Y  EL GT
Sbjct: 480 YGGELFGT 487

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/492 (66%), Positives = 404/492 (82%), Gaps = 9/492 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           ++S FIRG RICS   YLL TLISIPISFK+GGL+CGLAFT +LFILYF+STTLSI ARK
Sbjct: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
            G+RI+I+L++ILYY QHFIIASLL+LFLSGFSN +L  ++ +   PI+S+  I   +++
Sbjct: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           SS +ANW+ YYYYY++ V PW+F+LS+STPFFTLSEGFFTILAIQAIGETNKWL YE NS
Sbjct: 125 SS-EANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           N W+ISSLL S  VI+A+LYYLYRIYVTPIW+L+VQTASLLGF LSLV GLGIYGIV+D 
Sbjct: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDS 243

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+E+LE+FK+VWQ+ Q NL   NNL+ YY+NV
Sbjct: 244 GSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNV 303

Query: 302 VLKNIETIWESFKINDNSFIT-----SFSTERVITIFMPIWKLLKTFTITVPSSINELCF 356
           +LKNIE  W++F +   +  T     S           PIWK  K FT++VP SI E+  
Sbjct: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILL 363

Query: 357 VTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCI 416
           +T+KM+ ES+SPAV++NLCFR+LIFYSATRI+P+LQR+D  E R+SR++M+++YWYSPCI
Sbjct: 364 MTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCI 423

Query: 417 LIAMYAHLILQYSGELKDELCLWGCNSKI--FPSDQPK-IIVDSWGFWNWCNIFFTILVY 473
           LIAMYAHLILQYS ELK+ELCLWGCN+ +  + +DQ + ++VD+W FWNWCN+F TILVY
Sbjct: 424 LIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVY 483

Query: 474 ASELIGTTPGSK 485
           A+ELIG T  ++
Sbjct: 484 ANELIGDTTHTE 495

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/483 (66%), Positives = 399/483 (82%), Gaps = 6/483 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           IS SF++G R+  A FYLL TL++IPISFK+GGL+CGL+FTV+LF LY ++TTLS+ A+ 
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
           YG++ +I+ T  +YY QHF+IASLLYLFLSGFSNE+L+ +L DG++P  S+ ++ + NV 
Sbjct: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           S+  ++W+LYYYYYR+ VQPWQ +L++ST FF LSEGFFT+L IQAIGETN+WL+ E+NS
Sbjct: 124 SN-HSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNS 182

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           NTW+I+SLL SGGVITASLYYLYRIYVTPIW LSVQTASLLGFTLS+V G+G++GIV+  
Sbjct: 183 NTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKN 242

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EILEV K  WQ+HQ NL++ NNLLSYY +V
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDV 302

Query: 302 VLKNIETIWESFKIN-DNSFITSFST----ERVITIFMPIWKLLKTFTITVPSSINELCF 356
           VLKN E +WES  +   NS  T+F+      ++   F PIWK  K F ++VPSSI  +  
Sbjct: 303 VLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQ 362

Query: 357 VTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCI 416
           VT K+A ES+SPA+++NLCFRVL+FYSATRIIPALQR++  ELRKSRRIM VLYWYSPCI
Sbjct: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422

Query: 417 LIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASE 476
           LIAMY HLILQYSGEL  +LCLWGC+ K F S QPKI +++W FWNWCNIF+T+L+Y SE
Sbjct: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSE 482

Query: 477 LIG 479
           LIG
Sbjct: 483 LIG 485

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/480 (67%), Positives = 389/480 (81%), Gaps = 8/480 (1%)

Query: 7   IRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRI 66
           ++ +R+  A FYLL  LI+IPISFK+GGL+CGL+FTV+LF LYF+STTLS++ R Y SR 
Sbjct: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64

Query: 67  HILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVASSTQA 126
           ++  T  +YY QH IIASLLYLFLSGFSNE+L+ +L  G++P  S+ ++ K N   S  +
Sbjct: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSN-PFSAHS 123

Query: 127 NWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSNTWVI 186
           NW+LYYYYY + VQPWQ+ILS+ST FF+LSEGFFTILAIQA+GE+++WL+YEINSN W I
Sbjct: 124 NWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183

Query: 187 SSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKGSVIE 246
           +SLL SGGVITA+LYYLYRIYVTP+W+LS+QTASLLGFTLSLV GLG+YGIV+  GSVIE
Sbjct: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243

Query: 247 SSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVLKNI 306
           SS+FFAYIVRCIYEISPKLATTAT+EILE+FKE WQ+HQ N +S NNLLSYYH+VVL + 
Sbjct: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303

Query: 307 ETIWESF-----KINDNSFITS-FSTERVIT-IFMPIWKLLKTFTITVPSSINELCFVTY 359
           E +WES        +D  + TS F   R  T IF P+    K FTI+VPSSI  L  VT 
Sbjct: 304 EMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTL 363

Query: 360 KMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIA 419
           KMA +S+SPA++VNL FRVLIFYSAT+IIPALQ + D +L KSRRIM VLYWYSPCILIA
Sbjct: 364 KMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIA 423

Query: 420 MYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIG 479
           MY HLILQYSGEL  +LCLWGCNS  F  +Q KI+VDSWGFWNWCNIF+TILVY SELIG
Sbjct: 424 MYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIG 483

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/486 (61%), Positives = 383/486 (78%), Gaps = 18/486 (3%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           M+  S I+ IR C  TFYLL  LI+IPISF++GGL+CGL+FTV+LF LYFL+TTL I ++
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLR-DGNKPIDSIADIFKKN 119
           KY +R++  +T+ +YY QHFII SLL+LFLSGF+N++L   +  D N P +S+ +  +  
Sbjct: 61  KY-NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNK 119

Query: 120 VASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEI 179
              S + +W+ YYYYY+F V+PWQF+L +STP+FTL EGFFT+L IQAIGETNKWL Y  
Sbjct: 120 ---SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHK 176

Query: 180 NSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVT 239
           NSNTW+I SLL SGGVIT SLYYLYRIYVTP+W+LS+QTASLLGFTLS+V GLG+YGIV+
Sbjct: 177 NSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVS 236

Query: 240 DKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYH 299
            KGSVIESS+FFAYIVRCIYEISP+LAT+A +EI ++ K+ WQ+HQ NL + +NLLSYY 
Sbjct: 237 GKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYR 295

Query: 300 NVVLKNIETIWESFKINDNSFITSFSTERVITI-FMPIWKLLKTFTITVPSSINELCFVT 358
           NVVLKN E IW++  I   +  TS ST +++ +   P+WK  K FTI+VPSSI E+  VT
Sbjct: 296 NVVLKNGEMIWDA--IVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVT 353

Query: 359 YKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILI 418
            KMA ES++P V++NL FR+L+FYSATRIIPALQ+ D N  + SRR+M+++YWYSPCI+I
Sbjct: 354 LKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVI 413

Query: 419 AMYAHLILQYSGELKDELCLWGCNSKIFP---SDQP--KIIVDSWGFWNWCNIFFTILVY 473
           AMY HLILQYSGEL ++LCLWGC    FP   ++ P  K++VD+WGFWNWCN+F T+ +Y
Sbjct: 414 AMYTHLILQYSGELNNDLCLWGC----FPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIY 469

Query: 474 ASELIG 479
             ELIG
Sbjct: 470 GLELIG 475

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 362/483 (74%), Gaps = 8/483 (1%)

Query: 4   SSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYG 63
            + IR +++    FYLL  + +IPISFKIGGL+CGL FTV+LF LYF STTL+I AR++G
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 64  SRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVASS 123
           S+  I++T+  +YFQ+FII SLL+LFL+GF+NE L   +R G +P ++  D+ + ++  S
Sbjct: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125

Query: 124 TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSNT 183
            + NW+L+YYYY + V+PWQ ILSYSTP FTL EGFFTIL IQ IGE N WL +E NSN 
Sbjct: 126 VK-NWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNI 184

Query: 184 WVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKGS 243
           W+ISSLL SGG+IT SLYYLYRIY TPIW LSV  A+LLGFTLSLVG LGIYGIV+  GS
Sbjct: 185 WIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGS 244

Query: 244 VIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVL 303
           VIESS+FFAYIVRCIYEI+P+LATTATEE LE  KEVWQ H ANL   +  +SY+++   
Sbjct: 245 VIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFH 304

Query: 304 KNIETIWESFKIN-------DNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCF 356
                 W  F           N  +   S   + + F PIW+ LKT T +VP+SI+EL  
Sbjct: 305 MQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFH 364

Query: 357 VTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCI 416
           +T +MA +S+SPA+I+NLCFR++IFYSATRIIPA+Q+R  +E RK R IMK LYWYSPCI
Sbjct: 365 LTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCI 424

Query: 417 LIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASE 476
           LIAMY HLILQYSGELK +LCLWGC+S  F  DQ +I VD+W FWNWCNIF+TI++Y SE
Sbjct: 425 LIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYGSE 484

Query: 477 LIG 479
           LIG
Sbjct: 485 LIG 487

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/486 (57%), Positives = 361/486 (74%), Gaps = 20/486 (4%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           M   S I+  R+C  +FYLL  LI+IPISF++GGL+CGL+FTV+LF LY ++TTL I AR
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
             G      L +  YY QHF I SLL+LFLSGFSN++L   +    +P +S+ D+ +   
Sbjct: 61  ARG---LAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTT 117

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
            S T   WV YYYYY++ V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL     
Sbjct: 118 QSQT---WVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNG 174

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SN WVIS L+ASGGVITA+LYYLYRIYVTPIW+LSVQTASLLGFT S+V GLGIYGIV+ 
Sbjct: 175 SNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSG 234

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           +GS IESS+FFAYIVRC+YEISP+LAT+A +EI  + KE W     +L S + LL+YY +
Sbjct: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRD 294

Query: 301 VVLKNIETIWESFKINDNSFITSFST------ERVITIFMPIWKLLKTFTITVPSSINEL 354
           ++LKN E +W++     N  + +  T       RV     P+WK +K FT +VPSSI E+
Sbjct: 295 IILKNGEMVWDAILARTNVNVGASGTPVWASWNRV----QPLWKFVKHFTSSVPSSIQEI 350

Query: 355 CFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSP 414
            ++T +MA E+I+PAV++NLCFR+LIFYSATRIIPALQ++     R+SRR M++LYWYSP
Sbjct: 351 FYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSP 407

Query: 415 CILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYA 474
           CI+IAMY HLILQYSG++ ++LCLWGC     P D PK++VDSWGFWNWCNIF T+ +YA
Sbjct: 408 CIVIAMYTHLILQYSGQISNDLCLWGCFPWSVP-DTPKVVVDSWGFWNWCNIFCTMAIYA 466

Query: 475 SELIGT 480
           SEL+G+
Sbjct: 467 SELLGS 472

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 358/492 (72%), Gaps = 26/492 (5%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           MI  S ++ IR+C  +FYLL  LI+IPI+F++GGL+CGL+FTV+LF LY ++TTL I AR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
             G      L +  YY QHF I SLL+LFLSGFSN++L   +    +P +S+ D+ + + 
Sbjct: 61  ARG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSST 117

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
            S     W+ YYYYY + V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL     
Sbjct: 118 HSQP---WIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SN WVIS L+ SGGVITA+LYYLYRIYVTPIW+LSVQTASLLGFT S+V GLGI+GIV+ 
Sbjct: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           +GS IESS+FFAYIVRC+YEISP+LAT+A +EI  + K+ W     +L S +  L+YY +
Sbjct: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294

Query: 301 VVLKNIETIWESFKINDNSFITS------FSTERVITIFMPIWKLLKTFTITVPSSINEL 354
           ++LKN E IW++     N  ++        S  RV     P+WK +K FT +VPSSI E+
Sbjct: 295 IILKNGEMIWDAVLARTNVNVSGAGPVAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350

Query: 355 CFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSP 414
             +T  MA E+I+PAV++NLCFR+LIFYSATRIIPALQR+     R+SRR M++LYWYSP
Sbjct: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSP 407

Query: 415 CILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQP---KIIVDSWGFWNWCNIFFTIL 471
           CI+IAMY HLI+QYSG++ ++LCLWGC    FP   P   K++VDSWGFWNWCNIF T+ 
Sbjct: 408 CIVIAMYTHLIMQYSGQISNDLCLWGC----FPWSPPEGSKVVVDSWGFWNWCNIFCTMA 463

Query: 472 VYASELIGTTPG 483
           +YASEL G+  G
Sbjct: 464 IYASELFGSKSG 475

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  498 bits (1281), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 277/522 (53%), Positives = 357/522 (68%), Gaps = 52/522 (9%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           M+S   +R IR   A FYL   LI+IPISF++GGL+CGL+FTV+LFILYF +TTL I   
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
             GS    LL +++YY QHF+I S+L+LFLS F+++QL  ++        S   IF+ NV
Sbjct: 61  N-GSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNV 119

Query: 121 ----------ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGE 170
                         + +   YYYYY++ V+PWQ++L ++TP+FTL+EGFFT+LAIQAIGE
Sbjct: 120 NESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179

Query: 171 TNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVG 230
           T +WL Y+ NSNTWVI SLL SG VIT S++YLYRIYVTPIW LSVQTA+LLGFTLSLV 
Sbjct: 180 TGRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239

Query: 231 GLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTS 290
           GLG+YGI++ KGS IESS+FFAY+VRCIYEISP+LA TA  EI +V  + WQ  Q  L S
Sbjct: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298

Query: 291 PNNLLSYYHNVVLKNIETIWESFKINDNSFITSFSTERVITIF---MP------------ 335
            NNLL+YY N  + N E+ W+S  +   +  T+ + E   TIF   MP            
Sbjct: 299 KNNLLTYY-NTFVSNAESFWDSL-LKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLII 356

Query: 336 -----------IWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSA 384
                      IW   K F++ +P SI+E+  VT KMA ESI+PAVI NL FRVL+FYSA
Sbjct: 357 LQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSA 416

Query: 385 TRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSK 444
           TRIIPALQ+       +SR++M+++YWYSPCI+IAMY HLIL+YSGEL ++LC+WGC   
Sbjct: 417 TRIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGC--- 471

Query: 445 IFP------SDQPKIIVDSWGFWNWCNIFFTILVYASELIGT 480
            FP        + K +VD+W FWNWCN+FFT+L+YA ELIG+
Sbjct: 472 -FPWLNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 346/511 (67%), Gaps = 41/511 (8%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           M+    +R +R   A+FYL   LI++PISF+IGGL+CGL+FTV+LFILYF++TTL I A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  KYGSR-IHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKN 119
             G    HI  T  LYY QHF++ S+L+LFLSGF+N+QL   L   +        IF  N
Sbjct: 61  TRGDEWKHIAST--LYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGN 118

Query: 120 VASS---------TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGE 170
           +  S              + Y +YYR+ V+PWQ++L ++TP FTL+EGFFT+LAIQ IGE
Sbjct: 119 MNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178

Query: 171 TNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVG 230
           T +WL Y+ NS  WVISSL+ SG VIT S+YYLYRIYVTPIW LSV TA+LLGFTLSLV 
Sbjct: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238

Query: 231 GLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTS 290
           GLG+YGI++ KGS IESS+FFAY+V CIYEISP+LA TA  EI +V    WQ  Q  L  
Sbjct: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK 298

Query: 291 PNNLLSYYHNVVLKNIETIWE-----SFKINDNSFITSFSTERVITIFM----------- 334
            N+LL+YY N +L N E +W+     +F ++      + S+  V    +           
Sbjct: 299 -NSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356

Query: 335 PIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRR 394
            +W   K F+  +P SI+E+  VT  +A ESI+ AV+ NL FRV++FYSATRIIPALQR 
Sbjct: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416

Query: 395 DDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFP-----SD 449
                 +SR++M+++YWYSPCI+IAMY H+IL+YSGEL +ELC+WGC    FP     ++
Sbjct: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGC----FPWLQSEAN 470

Query: 450 QPKIIVDSWGFWNWCNIFFTILVYASELIGT 480
           + + +VD+WGFWNWCN+FFT+L+YA ELIG+
Sbjct: 471 RDRWVVDAWGFWNWCNLFFTLLIYAVELIGS 501

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  468 bits (1205), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 259/516 (50%), Positives = 340/516 (65%), Gaps = 58/516 (11%)

Query: 17  FYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRIHI-LLTNILY 75
           FYLL  +++IPISFKIGG++CGL+FT +LF LYF+ST+++I  ++      + LL + L+
Sbjct: 66  FYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASSLF 125

Query: 76  YFQHFIIASLLYLFLSGFSNEQLSSML----------RDGNKPIDSIADIFKK------- 118
           Y Q+FII+SLL ++L GF+N+ L + L          ++G      I  I K        
Sbjct: 126 YIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNIMN 185

Query: 119 --------------NVASSTQAN----------WVLYYYYYRFFVQPWQFILSYSTPFFT 154
                          +A  ++ N          W+L++YYY  F++PW+F+L  STPFFT
Sbjct: 186 LILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFIKPWKFLLINSTPFFT 245

Query: 155 LSEGFFTILAIQAIGETNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQL 214
           L EGFFTIL IQ IGETN WL  + +S+ WVI SLL+SGGVITA+LYYL RIYVTP W L
Sbjct: 246 LLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFWDL 305

Query: 215 SVQTASLLGFTLSLVGGLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEIL 274
           +V TAS+LGFTLS+VGGLG++GIV+  GS IESS+FFAYIVRCIYE+SP+LA +AT+E L
Sbjct: 306 TVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDEFL 365

Query: 275 EVFKEVWQRHQANLTSPNNLLSYYHNVVLKNIETIWESFKINDNSFITSFSTERVIT--- 331
           E F EVWQ +Q  +T  +N+L+Y      K I   + SF   ++      + E  I+   
Sbjct: 366 EGFNEVWQMNQNRITVADNVLTYCK----KYIMDAFSSFSSIEHHLFPK-TIELGISKNL 420

Query: 332 IFMPIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPAL 391
           I    W  LK FTI VPSSIN+L  +T +MA +SISPA+I+NL FR++IFYSATRIIPA+
Sbjct: 421 IVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFRLMIFYSATRIIPAI 480

Query: 392 QRRDDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQP 451
           QRR   +       M  +YW+SPC+LIAMY HLILQ+SGELK  +CLW C + +  S   
Sbjct: 481 QRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNICLWNCENWLSSSSDV 540

Query: 452 K--------IIVDSWGFWNWCNIFFTILVYASELIG 479
           K        IIVDSW FWNWCNIF+TI++YASELIG
Sbjct: 541 KSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  458 bits (1179), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 253/486 (52%), Positives = 332/486 (68%), Gaps = 25/486 (5%)

Query: 11  RICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRIHILL 70
           R   A  YLL  L+++PI+F++GGL CGLAFT++LF  YF++TTL+  ARK   +  I  
Sbjct: 13  RFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLRWQRFIAW 72

Query: 71  TNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVASSTQANWVL 130
           TN LYYFQ+F I  +L++FLS FS+ +LS  + D N  +++I  I K N    ++    +
Sbjct: 73  TNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNNDTYPSKTISFI 132

Query: 131 YYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSNTWVISSLL 190
           Y Y++ + +  W+F LSYSTP F L EGFFTILAIQ IGETN WL    NS+ W+I SL+
Sbjct: 133 YKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKNSSIWIILSLI 192

Query: 191 ASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKGSVIESSVF 250
            S  ++T S+YY+Y+IYVTP+W LS Q ASLL FT SLVGG+ IYGIV+ +GSV+ESS+F
Sbjct: 193 MSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSHRGSVVESSLF 252

Query: 251 FAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVLKNIE--- 307
           FAYIV CIYEISP +ATTA ++I +  KE WQ HQ N    +NLL YY+N ++KN++   
Sbjct: 253 FAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYNSLIKNVDEFI 312

Query: 308 -------TIWESFKINDNSFITSFSTERV-ITIFMPIWKLLKTFTITVPSSINELCFVTY 359
                  T  ++F    NS +  F   ++    F  I KL K FT+ +PSSI EL  +T 
Sbjct: 313 KLKIIKLTTKDNFSNKFNSLL--FQCVKISKKSFKFILKLSKRFTLGIPSSIYELYSITL 370

Query: 360 KMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDN------ELRKSRRIMKVLYWYS 413
           KMA ESISP ++VNLC+RVLIFY+ATRIIPAL+ R +       + + + + MKVLYWYS
Sbjct: 371 KMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNSKFMKVLYWYS 430

Query: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473
           PCILIAMY +LILQYSGELK E  LW        S+  +++VDSW FWNWCNIF+TI +Y
Sbjct: 431 PCILIAMYTNLILQYSGELKSEFKLWNN------SNNNEVVVDSWRFWNWCNIFWTITLY 484

Query: 474 ASELIG 479
            SELIG
Sbjct: 485 GSELIG 490

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  458 bits (1178), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 325/484 (67%), Gaps = 45/484 (9%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           +I  S ++ +RI   T YL   LI+IPISF++GGL+CGL+FTV+LF LYF+STT  +   
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
             GS     L+ ++YY QH +I S+L++FLS F N          +  +DS  + FK   
Sbjct: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYFEN--------IDSDTVDS--EYFK--- 144

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
                        ++   V+PWQ  L +STP FTL EG FTILAIQAIGET +WL     
Sbjct: 145 ------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRR 192

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SN WVI SLL SGG+IT SL+Y YRIYVTP+W+LS  +ASLLGFT S+V G+G+YGI   
Sbjct: 193 SNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NG 251

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
            GSV+ESS+FFAY+VR +YEISPK+A  A +EI ++ KE W+ HQANL   +NLL     
Sbjct: 252 SGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----E 307

Query: 301 VVLKNIETIWESF---KINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFV 357
           ++ KN   IW         ++ +I     ++   I  P+W  +K FT +VP SI E+  V
Sbjct: 308 LMTKNYRAIWSQIVEHTPRNHKYIKMM--DQCKWILNPLWNSVKNFTKSVPISIQEIFVV 365

Query: 358 TYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCIL 417
           T+KMA ES+ PAV++NL FR+LIFYSATRIIP LQ R+  E R  RRIM  +YWYSPCI+
Sbjct: 366 TFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIMNFVYWYSPCII 424

Query: 418 IAMYAHLILQYSGELKDELCLWGCNSKIFPSD-QPKIIVDSWGFWNWCNIFFTILVYASE 476
           IAMY HLIL+YSG+LK++LC+WGC    FP + +PKI+VDSW FWNWCNI+ T+L+YA E
Sbjct: 425 IAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIYSTMLIYALE 480

Query: 477 LIGT 480
           L+G+
Sbjct: 481 LMGS 484

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  441 bits (1133), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 243/528 (46%), Positives = 346/528 (65%), Gaps = 58/528 (10%)

Query: 8   RGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRIH 67
           + IR+    FYL+  LI+IP +FKIGGL+CGL+FT++LF LYFLSTT+ + A++  +  +
Sbjct: 10  QSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTLNNFY 69

Query: 68  ILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIF---KKNVASST 124
           ILL+ ++YY QH +IASLLY+F++ FS+  L+ +L   N   D +  +    K + + S 
Sbjct: 70  ILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEIL--SNNKTDQLPSLLYYIKNDTSKSV 127

Query: 125 QANW--VLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSN 182
             N+  +L+YYYY + VQPW ++LS+STPFFTL EGFFTIL IQAIGET  WL+ +    
Sbjct: 128 SQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQKK 187

Query: 183 TWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKG 242
            + + + L S GVI  ++++LY+IY   +W+LS+QTASLLG T+SLV  +GI+GI +  G
Sbjct: 188 IFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFSTNG 247

Query: 243 SVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVV 302
           S+IESS+F  YI+RC YEISP+L+T+AT EIL+  KE WQ HQ ++T   ++L YY+NV+
Sbjct: 248 SLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNNVL 307

Query: 303 LKNI--------------------ETIWESFKINDNSFITSFSTERVITIFM-------- 334
           LKNI                     T+ E  +  +N  +T  +    +   +        
Sbjct: 308 LKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIYQN 367

Query: 335 ------PIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRII 388
                 PI++LLK F + +P+S+  L  VTYK+A +S+SP++++NLCFRVLIFYSATRII
Sbjct: 368 WLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATRII 427

Query: 389 PALQRRDDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGC------- 441
           PA+QR++  E ++SR  +K  Y +SPCI+IAMY +LILQYSGELK++LC+WGC       
Sbjct: 428 PAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISKSI 487

Query: 442 -------NSKIFPSD---QPKIIVDSWGFWNWCNIFFTILVYASELIG 479
                  N  +   D     + IV+SWGFWNWCNIF TI +Y  EL+G
Sbjct: 488 SQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
            ++FP+DQ  +I+  D    WNWCN    ++ Y
Sbjct: 312 ERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPY 344

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
           +K+FP+DQ  ++V  D    WNWC     ++ Y
Sbjct: 309 AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY 341

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
           +K+FP+DQ  ++V  D    WNWC     ++ Y
Sbjct: 310 AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY 342

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
           +K+FP+DQ  ++V  D    WNWC     ++ Y
Sbjct: 310 AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY 342

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
           +K+FP+DQ  ++V  D    WNWC     ++ Y
Sbjct: 311 AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY 343

>KLTH0F07766g Chr6 complement(669046..670443) [1398 bp, 465 aa] {ON}
           similar to uniprot|P41807 Saccharomyces cerevisiae
           YPR036W VMA13 vacuolar ATPase V1 domain subunit H (54
           kDa)
          Length = 465

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 16/108 (14%)

Query: 339 LLKTFTITVPSSINELCFVTYKMACESISPAVIVN--LCFRVLIFYSATRIIPALQRRD- 395
           LLK   +T+   ++ LC  T  + C  +SP V  +  L  ++L+  +A  I+ +L  R  
Sbjct: 265 LLKLVKVTIKEKLSRLCIATI-LNC--VSPHVKGHKALIRQLLLLGNALPILQSLSERKY 321

Query: 396 -DNELRKSRRIMKVLYWYSPCILIAMYAHLI--LQYSGELKDELCLWG 440
            D+ELR+    +K L       L   Y  L    +Y  EL  +L +W 
Sbjct: 322 SDDELRQDLATLKEL-------LEQTYQELTSFDEYEAELDSKLLVWS 362

>AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL222C
           and YOR172W (YRM1)
          Length = 872

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 247 SSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVLKNI 306
           SS     ++R I E+  +LA   +E + ++F    Q+H     SP N LS +H V+ K  
Sbjct: 64  SSTPNVELLRRIDELETELARMKSEMVPQLF---MQKHVMGTVSPVNRLSQFHLVIEKQG 120

Query: 307 ETIW 310
            TI+
Sbjct: 121 RTIF 124

>TBLA0A01760 Chr1 complement(426097..428223) [2127 bp, 708 aa] {ON}
           Anc_6.137 YGL114W
          Length = 708

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 12/116 (10%)

Query: 64  SRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVASS 123
           + + I++ + +  F  FI+ S++ L  S      +     DGN   DS++D+    + +S
Sbjct: 382 TALSIMIADAVVGFVVFIVRSMIKLIHSNTKEFTMELSQLDGN---DSLSDVPPNELVTS 438

Query: 124 TQ-------ANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETN 172
           T        ++ +      R F    Q +  YS         FF +LAI+A+GET+
Sbjct: 439 TTVISGLIISSLLCIILMLRLFGS--QLVPIYSILLSLCLAFFFAVLAIRALGETD 492

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,857,582
Number of extensions: 2121709
Number of successful extensions: 8344
Number of sequences better than 10.0: 60
Number of HSP's gapped: 8508
Number of HSP's successfully gapped: 61
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)