Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B061402.306ON44342418040.0
TDEL0G023602.306ON40236111871e-161
YNL016W (PUB1)2.306ON45338811861e-160
ZYRO0A02398g2.306ON41037311801e-160
Suva_14.3302.306ON45738911741e-158
Smik_14.3132.306ON45137511631e-156
TBLA0B071702.306ON47036811581e-155
TPHA0C035202.306ON44235311381e-153
Ecym_33442.306ON42134811311e-152
KLTH0G10912g2.306ON43635811101e-149
AGR390C2.306ON37834311011e-148
Kwal_27.114472.306ON43937610771e-144
NDAI0B034402.306ON4992018691e-111
KNAG0A054402.306ON4422508151e-104
KLLA0E08779g2.306ON4753937911e-100
CAGL0H10604g2.306ON4161937831e-100
KAFR0J012602.306ON3651857613e-97
Skud_14.3122.306ON4592117494e-94
Kpol_1043.342.306ON4421857266e-91
SAKL0E07128g2.306ON4011887165e-90
NDAI0C061008.229ON5851932575e-23
Kpol_1032.498.229ON5802042566e-23
TDEL0E024505.382ON4721802531e-22
TBLA0F037808.229ON5771612461e-21
KNAG0G018108.229ON5961972461e-21
TDEL0A013508.229ON5881832442e-21
TPHA0B034208.229ON5791932433e-21
ZYRO0B11660g8.229ON5871672433e-21
Ecym_80105.382ON6021812381e-20
CAGL0L11792g8.229ON5791672381e-20
ADR307W5.382ON5661812353e-20
CAGL0H02123g5.382ON5551962343e-20
Ecym_55628.229ON5801742335e-20
KAFR0D048305.382ON4061852271e-19
NCAS0A036808.229ON5751612292e-19
SAKL0H17952g8.229ON5891852264e-19
KAFR0B025008.229ON5821832231e-18
KLLA0C17600g8.229ON5921672221e-18
YER165W (PAB1)8.229ON5771672193e-18
KNAG0B044405.382ON3971822173e-18
Smik_5.3378.229ON5771672193e-18
Skud_5.3048.229ON5771672193e-18
AGR122C8.229ON5851672168e-18
Smik_8.1645.382ON5241942131e-17
SAKL0G08118g5.382ON5451742122e-17
Suva_5.2998.229ON5771672122e-17
NCAS0H018105.382ON4431722093e-17
TBLA0H017905.382ON6742102114e-17
Kwal_55.201545.382ON5221882087e-17
Skud_8.1475.382ON5131882078e-17
Kwal_56.234868.229ON5871752061e-16
ZYRO0A07018g5.382ON5581782061e-16
SAKL0A07370g6.104ON4902422042e-16
KNAG0D032204.61ON3991802013e-16
TBLA0C043604.61ON4032041995e-16
KLTH0G14344g8.229ON5871612015e-16
KLTH0E03520g5.382ON5162012006e-16
CAGL0E03245g4.61ON4252061996e-16
KLLA0F14861g5.382ON5891791999e-16
NCAS0A058904.61ON4151791952e-15
NDAI0D028404.61ON4261781952e-15
YHR086W (NAM8)5.382ON5231891952e-15
Ecym_30826.104ON5862381944e-15
NDAI0C018205.382ON4981801935e-15
KAFR0F031204.61ON4121791915e-15
TBLA0A078103.49ON4721671909e-15
AAR151W6.104ON4812361891e-14
TPHA0H015205.382ON4941961882e-14
Smik_6.2644.61ON3951801862e-14
Ecym_62014.61ON4481801863e-14
Kpol_224.18.797ON2171891784e-14
Suva_15.2805.382ON5411931855e-14
Kwal_55.219603.49ON5971671856e-14
KLTH0F18766g3.49ON5881671838e-14
AFR107W4.61ON3962061819e-14
Skud_7.4834.61ON3931801811e-13
TDEL0F029104.61ON4361801811e-13
YGR159C (NSR1)4.61ON4141781801e-13
KAFR0C016803.49ON4791691802e-13
SAKL0C12672g3.49ON5511671793e-13
SAKL0H23562g4.61ON4211811783e-13
TPHA0K019104.61ON4161791773e-13
YBR212W (NGR1)6.104ON6721441784e-13
NCAS0A100103.49ON5061691775e-13
Suva_7.4504.61ON3911811747e-13
KLLA0C11495g4.61ON4451811757e-13
Skud_6.1071.357ON611721767e-13
KNAG0A013703.49ON5451671758e-13
ZYRO0C02574g3.49ON5431671741e-12
KAFR0G023206.104ON6202401741e-12
CAGL0M03795g3.49ON5131671731e-12
NCAS0B072401.357ON610721741e-12
Skud_2.3456.104ON6641441741e-12
Ecym_20503.49ON5411681712e-12
Suva_4.4706.104ON6631441722e-12
TDEL0E006003.49ON5471671712e-12
Smik_2.3556.104ON7361441723e-12
TBLA0A099206.104ON5941461713e-12
KLTH0D03916g4.61ON5051781703e-12
TDEL0G036706.104ON6171441704e-12
ZYRO0C05060g6.104ON7161441705e-12
Kpol_1026.214.61ON4371801677e-12
KLLA0C05522g6.104ON5402211677e-12
TPHA0P013103.49ON5181691679e-12
NDAI0A061703.49ON5521381661e-11
TBLA0B085903.49ON6231701661e-11
NDAI0G039703.49ON6071941661e-11
Suva_6.951.357ON613721651e-11
Kpol_1076.113.49ON5261671652e-11
CAGL0E01947g3.49ON4521691642e-11
NCAS0C046003.49ON5811691642e-11
Kpol_530.466.104ON5871441632e-11
Skud_15.303.49ON5391361633e-11
ADL160W3.49ON5261711623e-11
Smik_15.303.49ON5361361623e-11
ZYRO0G07326g4.61ON4681811623e-11
Suva_15.373.49ON5511361624e-11
YOL123W (HRP1)3.49ON5341361624e-11
KLLA0C12925g3.49ON5701701606e-11
CAGL0K06655g6.104ON8021431591e-10
Ecym_27461.357ON681811581e-10
AEL016C1.357ON678811581e-10
KLTH0E14036g8.797ON2091901501e-10
Kpol_1018.1221.357ON6341791572e-10
Kwal_14.18516.104ON5351441562e-10
KLLA0C14388g8.797ON2031691483e-10
ZYRO0G00814g1.357ON654871526e-10
KLTH0H06842g6.104ON5471031518e-10
ABL059W8.797ON2041761421e-09
Kpol_1008.231.357ON660721482e-09
SAKL0D09680g1.357ON672721463e-09
Suva_16.2718.491ON686911464e-09
KLLA0A08338g1.357ON766851455e-09
Kwal_26.7493singletonOFF2221381395e-09
NDAI0B045701.357ON4641091445e-09
TBLA0D049401.357ON665591446e-09
SAKL0B06270g8.797ON2091751386e-09
CAGL0I09900g8.797ON2111771377e-09
Smik_7.3341.357ON611721429e-09
YFR023W (PES4)1.357ON611721421e-08
Smik_16.1928.491ON690911421e-08
TDEL0H032407.159ON1671151341e-08
TDEL0D022501.357ON622811411e-08
Skud_16.2388.491ON680911402e-08
TPHA0F028206.104ON6081441402e-08
TPHA0A022201.357ON713721393e-08
KAFR0H014508.491ON690891383e-08
NDAI0F01720singletonON4743191373e-08
KLTH0H12958g1.357ON639731374e-08
Kwal_0.3701.357ON560721365e-08
YPL043W (NOP4)8.491ON685911365e-08
NDAI0E030708.491ON701901357e-08
NCAS0C023808.491ON702901357e-08
Ecym_25418.491ON675831322e-07
NCAS0C048301.408ON3771691302e-07
Kwal_27.123378.797ON2091741253e-07
NCAS0E038805.76ON7172041303e-07
TBLA0B080105.76ON939801303e-07
KNAG0A022108.491ON682831294e-07
KAFR0C044101.357ON589721294e-07
TDEL0F006802.80ON3882341284e-07
KLTH0C04268g8.822ON4501901284e-07
Skud_15.4878.797ON2131861235e-07
AGL250W8.491ON729881285e-07
TDEL0B014608.491ON6921001286e-07
KLLA0D05016g1.408ON4433351267e-07
Suva_8.3708.797ON2131801227e-07
KNAG0G032608.797ON2011391218e-07
KLLA0C08019g7.250ON301881249e-07
SAKL0H11330g8.491ON697921269e-07
Ecym_74208.797ON2041681219e-07
KAFR0B044205.76ON6251951251e-06
CAGL0I08943g1.357ON602801251e-06
ADL063W7.250ON320911221e-06
YOR319W (HSH49)8.797ON2131801192e-06
YHR015W (MIP6)1.357ON659801242e-06
ADR189W5.536ON269851212e-06
KLTH0E11418g8.491ON693861232e-06
TBLA0B008102.80ON3891181222e-06
TDEL0B010108.797ON2101721182e-06
ZYRO0F16214g1.102ON330751212e-06
KLLA0D11792g8.491ON685831232e-06
Kpol_1075.1a8.229ON264801202e-06
TBLA0A015708.491ON742911232e-06
KLTH0A04554g7.250ON2781061202e-06
ABL134C2.80ON3751901212e-06
KAFR0A074902.80ON3812061213e-06
TPHA0B043001.102ON334751203e-06
KAFR0B045402.167ON220941173e-06
Kwal_27.118328.491ON686941223e-06
KAFR0C054305.536ON274911193e-06
TBLA0J018307.159ON140891134e-06
KNAG0L015807.250ON305871194e-06
TDEL0A039905.536ON278841184e-06
Smik_15.5008.797ON2131801164e-06
NDAI0D048104.33ON626911205e-06
TPHA0C017408.491ON697861196e-06
SAKL0E12738g2.80ON3961421186e-06
ZYRO0F08294g8.491ON714821196e-06
Suva_7.5465.76ON7792241197e-06
KNAG0I020302.167ON229951157e-06
ZYRO0E04928g1.408ON4093471177e-06
SAKL0F08866g7.250ON302921168e-06
CAGL0J11154g2.80ON3802171178e-06
TBLA0A033005.382ON362791178e-06
Ecym_11211.102ON324751168e-06
Kpol_1041.42.80ON3841381179e-06
Kpol_259.17.250ON332781169e-06
Kwal_33.144632.80ON393781179e-06
TPHA0F023102.80ON400781179e-06
Ecym_43247.250ON3311181161e-05
Kwal_55.209727.159ON135901091e-05
YGR250C5.76ON7812241171e-05
Kpol_1026.164.66ON277791141e-05
ADR017W7.159ON1731091111e-05
NCAS0A028804.33ON588931161e-05
ZYRO0G08140g6.183ON6321931161e-05
ZYRO0G04862g2.80ON3761421151e-05
Kpol_1023.955.536ON274881132e-05
SAKL0C03234g1.102ON340751142e-05
TDEL0F012202.167ON212731112e-05
AFR649W1.102ON310751132e-05
ZYRO0D12782g5.536ON273841132e-05
CAGL0H04675g5.536ON274811122e-05
NDAI0D028004.66ON315791123e-05
AFL224W2.167ON2061041103e-05
KLLA0D13420g7.159ON166751073e-05
KLTH0F13442g7.159ON134771054e-05
KLTH0F02838g1.102ON330751114e-05
SAKL0E10604g2.167ON221881094e-05
TPHA0D024005.536ON293881104e-05
KLTH0D09262g2.167ON223881094e-05
KAFR0F027704.33ON743871124e-05
ZYRO0B09790g2.167ON198921084e-05
CAGL0M12573g7.250ON2991191104e-05
CAGL0L03806g2.167ON255741094e-05
SAKL0D08558g1.408ON4641731115e-05
KAFR0K010507.159ON154751055e-05
KLTH0F13090g7.145ON1451031055e-05
Skud_7.5835.76ON7792261115e-05
KLTH0B02992gna 1ON2041001076e-05
KAFR0B066906.183ON5331891116e-05
NDAI0A047503.432ON8431751116e-05
CAGL0B04807g1.408ON4191791106e-05
KNAG0C020301.357ON365781096e-05
NDAI0F033202.80ON399781106e-05
NCAS0G019502.80ON4041421106e-05
KLTH0B06886g2.80ON396781107e-05
Kwal_33.134961.102ON330801097e-05
TPHA0K018704.66ON289791087e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B06140
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   699   0.0  
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   461   e-161
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   461   e-160
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   459   e-160
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   456   e-158
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   452   e-156
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   450   e-155
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   442   e-153
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   440   e-152
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   432   e-149
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   428   e-148
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   419   e-144
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   339   e-111
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   318   e-104
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   309   e-100
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   306   e-100
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   297   3e-97
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   293   4e-94
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   284   6e-91
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   280   5e-90
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}            103   5e-23
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...   103   6e-23
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...   102   1e-22
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    99   1e-21
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    99   1e-21
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    99   2e-21
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    98   3e-21
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    98   3e-21
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    96   1e-20
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    96   1e-20
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    95   3e-20
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    95   3e-20
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    94   5e-20
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    92   1e-19
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    93   2e-19
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    92   4e-19
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    91   1e-18
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    90   1e-18
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    89   3e-18
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    88   3e-18
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    89   3e-18
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    89   3e-18
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    88   8e-18
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    87   1e-17
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    86   2e-17
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    86   2e-17
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     85   3e-17
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    86   4e-17
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    85   7e-17
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    84   8e-17
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    84   1e-16
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    84   1e-16
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    83   2e-16
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    82   3e-16
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    81   5e-16
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    82   5e-16
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    82   6e-16
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    81   6e-16
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    81   9e-16
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             80   2e-15
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    80   2e-15
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    80   2e-15
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    79   4e-15
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    79   5e-15
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    78   5e-15
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    78   9e-15
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    77   1e-14
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    77   2e-14
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    76   2e-14
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    76   3e-14
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    73   4e-14
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    76   5e-14
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    76   6e-14
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    75   8e-14
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    74   9e-14
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    74   1e-13
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    74   1e-13
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    74   1e-13
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    74   2e-13
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    74   3e-13
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    73   3e-13
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    73   3e-13
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    73   4e-13
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    73   5e-13
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    72   7e-13
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    72   7e-13
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    72   7e-13
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    72   8e-13
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    72   1e-12
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    72   1e-12
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    71   1e-12
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    72   1e-12
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    72   1e-12
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    70   2e-12
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    71   2e-12
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    70   2e-12
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    71   3e-12
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    70   3e-12
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    70   3e-12
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    70   4e-12
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    70   5e-12
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    69   7e-12
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    69   7e-12
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    69   9e-12
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    69   1e-11
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    69   1e-11
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    69   1e-11
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    68   1e-11
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    68   2e-11
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    68   2e-11
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      68   2e-11
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    67   2e-11
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    67   3e-11
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    67   3e-11
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    67   3e-11
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    67   3e-11
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    67   4e-11
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    67   4e-11
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    66   6e-11
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    66   1e-10
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    65   1e-10
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    65   1e-10
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    62   1e-10
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    65   2e-10
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    65   2e-10
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    62   3e-10
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    63   6e-10
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    63   8e-10
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    59   1e-09
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    62   2e-09
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    61   3e-09
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    61   4e-09
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    60   5e-09
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    58   5e-09
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    60   5e-09
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    60   6e-09
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    58   6e-09
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    57   7e-09
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    59   9e-09
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    59   1e-08
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    59   1e-08
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    56   1e-08
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    59   1e-08
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    59   2e-08
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    59   2e-08
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    58   3e-08
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    58   3e-08
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    57   3e-08
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    57   4e-08
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    57   5e-08
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    57   5e-08
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    57   7e-08
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    57   7e-08
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    55   2e-07
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     55   2e-07
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    53   3e-07
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    55   3e-07
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    55   3e-07
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    54   4e-07
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    54   4e-07
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    54   4e-07
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    54   4e-07
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    52   5e-07
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    54   5e-07
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    54   6e-07
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    53   7e-07
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    52   7e-07
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    51   8e-07
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    52   9e-07
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    53   9e-07
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    51   9e-07
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    53   1e-06
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    53   1e-06
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    52   1e-06
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    50   2e-06
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    52   2e-06
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    51   2e-06
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    52   2e-06
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    52   2e-06
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    50   2e-06
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    51   2e-06
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    52   2e-06
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    51   2e-06
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    52   2e-06
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    51   2e-06
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    51   2e-06
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    51   3e-06
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    51   3e-06
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    50   3e-06
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    52   3e-06
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    50   3e-06
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    48   4e-06
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    50   4e-06
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    50   4e-06
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    49   4e-06
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    51   5e-06
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    50   6e-06
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    50   6e-06
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    50   6e-06
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    50   7e-06
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    49   7e-06
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    50   7e-06
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    49   8e-06
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    50   8e-06
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    50   8e-06
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    49   8e-06
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    50   9e-06
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    49   9e-06
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    50   9e-06
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    50   9e-06
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    49   1e-05
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    47   1e-05
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    50   1e-05
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    49   1e-05
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    47   1e-05
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    49   1e-05
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    49   1e-05
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    49   1e-05
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    48   2e-05
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    49   2e-05
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    47   2e-05
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    48   2e-05
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    48   2e-05
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    48   2e-05
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       48   3e-05
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    47   3e-05
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    46   3e-05
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    45   4e-05
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    47   4e-05
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    47   4e-05
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    47   4e-05
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    47   4e-05
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    48   4e-05
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    46   4e-05
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    47   4e-05
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    47   4e-05
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    47   5e-05
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    45   5e-05
KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa] ...    45   5e-05
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    47   5e-05
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    46   6e-05
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    47   6e-05
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    47   6e-05
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    47   6e-05
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    47   6e-05
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      47   6e-05
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    47   6e-05
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    47   7e-05
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    47   7e-05
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    46   7e-05
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    46   7e-05
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    47   8e-05
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    47   8e-05
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    47   8e-05
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    47   8e-05
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    47   9e-05
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    47   9e-05
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    45   9e-05
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    46   9e-05
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    45   1e-04
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    45   1e-04
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    45   1e-04
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    47   1e-04
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    47   1e-04
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    44   1e-04
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    45   1e-04
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    45   1e-04
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    44   1e-04
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    46   1e-04
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    45   2e-04
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    44   2e-04
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    45   2e-04
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    46   2e-04
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    45   2e-04
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    46   2e-04
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    45   2e-04
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    45   2e-04
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    45   2e-04
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    45   2e-04
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    46   2e-04
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     45   2e-04
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    46   2e-04
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    45   2e-04
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    45   2e-04
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    45   2e-04
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    45   2e-04
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    45   2e-04
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    45   2e-04
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    45   3e-04
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    45   3e-04
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    45   3e-04
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    43   3e-04
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    44   3e-04
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    45   3e-04
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    44   3e-04
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    45   3e-04
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    45   3e-04
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    42   4e-04
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    45   4e-04
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    44   4e-04
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    44   4e-04
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    45   4e-04
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    43   4e-04
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    45   4e-04
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    44   4e-04
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    44   4e-04
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    44   4e-04
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    44   4e-04
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    44   4e-04
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    44   4e-04
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    45   4e-04
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    45   4e-04
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    44   4e-04
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    45   4e-04
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    43   5e-04
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    44   5e-04
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    43   5e-04
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    44   5e-04
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    44   5e-04
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    44   5e-04
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    43   5e-04
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    42   6e-04
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    44   6e-04
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    43   6e-04
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    44   6e-04
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    42   6e-04
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    44   6e-04
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    44   6e-04
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    44   6e-04
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    44   7e-04
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    44   7e-04
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      43   7e-04
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    43   8e-04
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    43   8e-04
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    44   8e-04
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    44   8e-04
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    42   8e-04
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    43   8e-04
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    43   8e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    44   8e-04
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    44   8e-04
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    44   9e-04
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    43   9e-04
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    43   0.001
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    43   0.001
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    43   0.001
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    41   0.001
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    43   0.001
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    43   0.001
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    43   0.001
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    43   0.001
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     43   0.001
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    42   0.001
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    42   0.001
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    43   0.001
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    43   0.001
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    42   0.001
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    42   0.001
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    42   0.001
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    43   0.002
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    43   0.002
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    43   0.002
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    43   0.002
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    40   0.002
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    43   0.002
Smik_13.481 Chr13 complement(785925..787286) [1362 bp, 453 aa] {...    42   0.002
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    43   0.002
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    42   0.002
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    41   0.002
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    42   0.002
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    42   0.002
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    42   0.002
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    42   0.002
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    42   0.002
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    42   0.002
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    42   0.002
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    42   0.002
KNAG0B01400 Chr2 complement(261331..262335) [1005 bp, 334 aa] {O...    42   0.003
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    41   0.003
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    42   0.003
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    41   0.003
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    41   0.003
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    42   0.003
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    42   0.003
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    42   0.003
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    40   0.004
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    42   0.004
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    42   0.004
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    41   0.004
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    40   0.005
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    41   0.005
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    40   0.005
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    40   0.005
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    41   0.005
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    40   0.005
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    41   0.005
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    40   0.005
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    40   0.005
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    41   0.006
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    40   0.007
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    41   0.007
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      40   0.008
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    40   0.008
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    40   0.008
Kpol_193.1 s193 (1..1776) [1776 bp, 591 aa] {ON} (1..1776) [1776...    40   0.008
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    40   0.009
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    40   0.010
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    40   0.011
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    40   0.011
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    39   0.012
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    40   0.013
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    39   0.014
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    40   0.014
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    39   0.015
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    39   0.016
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    39   0.017
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    40   0.017
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    39   0.018
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    39   0.019
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    39   0.019
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...    39   0.020
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    39   0.020
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    38   0.020
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    39   0.021
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    39   0.021
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    39   0.022
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    39   0.022
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    39   0.023
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    39   0.023
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    39   0.024
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    38   0.024
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    39   0.024
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    39   0.025
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    39   0.025
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    39   0.025
TPHA0C04450 Chr3 complement(964539..965540) [1002 bp, 333 aa] {O...    39   0.025
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    39   0.026
TBLA0A04750 Chr1 complement(1177080..1178501) [1422 bp, 473 aa] ...    39   0.028
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    39   0.028
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    38   0.030
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    37   0.030
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    38   0.031
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    38   0.039
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    38   0.041
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    38   0.044
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    38   0.044
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    38   0.045
ZYRO0D15224g Chr4 (1279820..1280080) [261 bp, 86 aa] {ON} weakly...    35   0.046
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    38   0.047
Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}...    37   0.049
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    37   0.054
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    37   0.067
Kwal_55.20903 s55 complement(604836..605279) [444 bp, 147 aa] {O...    36   0.067
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    37   0.078
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    37   0.080
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    37   0.088
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    37   0.089
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    37   0.092
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    37   0.094
SAKL0B09702g Chr2 (819107..820528) [1422 bp, 473 aa] {ON} simila...    37   0.099
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    37   0.10 
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    37   0.11 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    36   0.11 
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    36   0.11 
TBLA0B03120 Chr2 complement(729579..730898) [1320 bp, 439 aa] {O...    37   0.12 
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    36   0.13 
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    37   0.13 
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    36   0.14 
TBLA0A02650 Chr1 complement(642309..642773,643714..643995) [747 ...    36   0.14 
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    36   0.16 
Kwal_47.18572 s47 complement(878877..879968) [1092 bp, 363 aa] {...    36   0.17 
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    36   0.17 
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    36   0.18 
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    36   0.20 
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    36   0.20 
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    35   0.21 
KLLA0F20834g Chr6 complement(1942016..1943866) [1851 bp, 616 aa]...    36   0.23 
YPL178W Chr16 (212158..212784) [627 bp, 208 aa] {ON}  CBC2Small ...    35   0.24 
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    35   0.27 
Ecym_2633 Chr2 (1221858..1223150) [1293 bp, 430 aa] {ON} similar...    35   0.29 
NCAS0A12190 Chr1 (2415445..2415786) [342 bp, 113 aa] {ON} Anc_7....    33   0.30 
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    35   0.32 
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    35   0.32 
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    34   0.37 
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    35   0.38 
ACR274W Chr3 (854587..855867) [1281 bp, 426 aa] {ON} Syntenic ho...    35   0.38 
NDAI0K00510 Chr11 (114005..115363) [1359 bp, 452 aa] {ON} Anc_8....    35   0.41 
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    34   0.45 
KAFR0E03720 Chr5 complement(744915..745358,746003..746269) [711 ...    34   0.45 
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    35   0.51 
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    34   0.62 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    34   0.63 
KLLA0B10472g Chr2 complement(914512..915108) [597 bp, 198 aa] {O...    33   0.65 
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    33   0.67 
Suva_15.128 Chr15 complement(223683..225089) [1407 bp, 468 aa] {...    34   0.70 
Kpol_478.5 s478 (22217..24601) [2385 bp, 794 aa] {ON} (22217..24...    34   0.71 
KNAG0G01000 Chr7 (209645..210040) [396 bp, 131 aa] {ON} Anc_7.14...    33   0.71 
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    34   0.72 
Skud_15.116 Chr15 complement(210151..211533) [1383 bp, 460 aa] {...    34   0.76 
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    34   0.88 
YGR156W Chr7 (800546..801823) [1278 bp, 425 aa] {ON}  PTI1Essent...    34   0.90 
NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.17...    33   0.91 
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    34   0.91 
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    34   0.99 
AFR149C Chr6 complement(705108..705521,706052..706300) [663 bp, ...    33   1.0  
KLLA0E02751g Chr5 (256959..257213,258450..258863) [669 bp, 222 a...    33   1.1  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    34   1.1  
Smik_6.375 Chr6 complement(611206..611835) [630 bp, 209 aa] {ON}...    33   1.2  
CAGL0L05038g Chr12 (571776..573317) [1542 bp, 513 aa] {ON} weakl...    33   1.2  
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    33   1.2  
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    33   1.3  
YOL041C Chr15 complement(251267..252646) [1380 bp, 459 aa] {ON} ...    33   1.3  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...    33   1.3  
SAKL0H23276g Chr8 complement(2019038..2020393) [1356 bp, 451 aa]...    33   1.4  
Smik_15.126 Chr15 complement(217400..218782) [1383 bp, 460 aa] {...    33   1.4  
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    32   1.4  
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    33   1.5  
Suva_16.131 Chr16 (221470..222099) [630 bp, 209 aa] {ON} YPL178W...    32   1.5  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...    33   1.6  
SAKL0G03080g Chr7 (255941..256189,256954..257346) [642 bp, 213 a...    32   1.6  
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    32   1.7  
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    33   1.7  
KLTH0D12540g Chr4 complement(1025489..1026407,1026476..1026555) ...    33   1.8  
NCAS0D03580 Chr4 complement(665299..666036) [738 bp, 245 aa] {ON...    32   1.8  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...    33   1.9  
NCAS0A11840 Chr1 (2349268..2349549,2350293..2350700) [690 bp, 22...    32   2.0  
TBLA0C04680 Chr3 complement(1139364..1140479) [1116 bp, 371 aa] ...    32   2.1  
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    33   2.1  
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    32   2.1  
KLTH0F13816g Chr6 (1135521..1135895) [375 bp, 124 aa] {ON} simil...    31   2.1  
Kpol_1063.18 s1063 (40779..41780) [1002 bp, 333 aa] {ON} (40779....    32   2.2  
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    33   2.2  
ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some s...    33   2.3  
ZYRO0D15686g Chr4 complement(1313019..1314032) [1014 bp, 337 aa]...    32   2.6  
KLTH0F15466g Chr6 complement(1260382..1260771,1261466..1261717) ...    32   2.6  
CAGL0H04763g Chr8 (454589..455740) [1152 bp, 383 aa] {ON} highly...    32   2.7  
Kpol_322.1 s322 complement(711..974) [264 bp, 87 aa] {ON} comple...    30   2.9  
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    31   3.0  
Suva_7.447 Chr7 (770016..771314) [1299 bp, 432 aa] {ON} YGR156W ...    32   3.1  
Kwal_26.7525 s26 (403321..404499) [1179 bp, 392 aa] {ON} YGR156W...    32   3.2  
TPHA0E01590 Chr5 complement(322289..322756,324326..324616) [759 ...    32   3.3  
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    32   3.3  
ADR183C Chr4 complement(1024790..1025752) [963 bp, 320 aa] {ON} ...    32   3.5  
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    32   3.8  
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    30   4.0  
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    31   4.1  
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...    32   4.4  
Kwal_55.21039 s55 (660549..660908) [360 bp, 119 aa] {ON} YIR009W...    30   4.4  
Kwal_26.6824 s26 (80841..83060) [2220 bp, 739 aa] {ON} YOR361C (...    32   4.5  
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    31   4.6  
KLTH0D00946g Chr4 (89863..92082) [2220 bp, 739 aa] {ON} similar ...    32   4.8  
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    31   4.8  
YJR112W Chr10 (637030..637635) [606 bp, 201 aa] {ON}  NNF1Essent...    31   4.9  
TDEL0A03220 Chr1 (576288..576542,577078..577476) [654 bp, 217 aa...    30   6.3  
Skud_7.480 Chr7 (784117..785394) [1278 bp, 425 aa] {ON} YGR156W ...    31   7.0  
ZYRO0B02310g Chr2 (190903..191163,191646..192062) [678 bp, 225 a...    30   7.5  
Ecym_8417 Chr8 (872889..873764) [876 bp, 291 aa] {ON} similar to...    30   8.0  
Kpol_1023.90 s1023 complement(213517..214764) [1248 bp, 415 aa] ...    30   9.9  

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/424 (81%), Positives = 346/424 (81%)

Query: 1   MSQEEQEQQHPTAVEQTTIPSATENIXXXXXXXXXXXXXXXXXXXXADPVSEAPAAGEQS 60
           MSQEEQEQQHPTAVEQTTIPSATENI                    ADPVSEAPAAGEQS
Sbjct: 1   MSQEEQEQQHPTAVEQTTIPSATENIPESESTPVTETAETSTEPESADPVSEAPAAGEQS 60

Query: 61  AENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN 120
           AENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN
Sbjct: 61  AENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN 120

Query: 121 NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNV 180
           NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNV
Sbjct: 121 NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNV 180

Query: 181 DVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240
           DVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR
Sbjct: 181 DVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240

Query: 241 AVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXMIPPTALGMPPMDGMIXXXXXX 300
           AVRINWATKRE                           MIPPTALGMPPMDGMI      
Sbjct: 241 AVRINWATKRENNNNNNGNGPRRGGFHNNNNMGGNRGGMIPPTALGMPPMDGMIPNPQQQ 300

Query: 301 XXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEK 360
                       IDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEK
Sbjct: 301 APVAPPPVNPQAIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEK 360

Query: 361 GCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFIXXXXXXXXXXXXXGMMPI 420
           GCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFI             GMMPI
Sbjct: 361 GCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFIPPQQQQQQQQQQPGMMPI 420

Query: 421 MMTD 424
           MMTD
Sbjct: 421 MMTD 424

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 230/361 (63%), Positives = 264/361 (73%), Gaps = 14/361 (3%)

Query: 51  SEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT 110
           SE PA+   S   +E SVVPA+A +GGRETSD+VLYVGNLD SINE++LKQYFQVGG I 
Sbjct: 15  SEVPASETIS---EEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIA 71

Query: 111 DVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDT 170
           +VKIMVDK N+N NYAF+EY +SHDAN+ALQTLNG QIE   V+INWAFQSQQ +  + T
Sbjct: 72  NVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEAT 131

Query: 171 FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230
           FNLFVGDLNVDVDDETL +AF +FP+Y+Q HVMWDMQTG SRGYGFVSF  QE+AQ+AM+
Sbjct: 132 FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMD 191

Query: 231 VMQGMPINGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXX-----XXXXXMIPPTAL 285
            MQG  +NGR +RINWA+KRE                                M PP ++
Sbjct: 192 AMQGHELNGRPLRINWASKRENNNNNNRRNVNGPRNNGFRHNNGGFPGSRGMPMPPPNSM 251

Query: 286 GMPPMDGMIXXXXXXXX----XXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADL 341
            +P   G++                      +D MIRRAPPRVTTAYIGNIPHFA EADL
Sbjct: 252 SLP--MGVVPPPQALGNPNGPSVPPPVNPQAVDSMIRRAPPRVTTAYIGNIPHFAIEADL 309

Query: 342 IPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTF 401
           IPLLQNFGFI+DF HYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER +F
Sbjct: 310 IPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTSF 369

Query: 402 I 402
           +
Sbjct: 370 V 370

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  461 bits (1186), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 234/388 (60%), Positives = 266/388 (68%), Gaps = 33/388 (8%)

Query: 47  ADPVSEAPAA----GEQSAENQ---ESSVVPASATQGGRETSDRVLYVGNLDKSINEDLL 99
           ADP SE   A     EQ+ +NQ   + SVVPA+A  GGRETSDRVLYVGNLDK+I ED+L
Sbjct: 32  ADPSSEQSVAVEGNSEQAEDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL 91

Query: 100 KQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAF 159
           KQYFQVGG I ++KIM+DK N NVNYAF+EY +SHDAN+ALQTLNG QIE   V+INWAF
Sbjct: 92  KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF 151

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           QSQQ++ SDDTFNLFVGDLNV+VDDETL +AF  FPSY+  HVMWDMQTG SRGYGFVSF
Sbjct: 152 QSQQSS-SDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 210

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKREXXXXXXXXXXXXXXXXXX---------- 269
             Q+ AQ AM+ MQG  +NGR +RINWA KR+                            
Sbjct: 211 TSQDDAQNAMDSMQGQDLNGRPLRINWAAKRDNNNNNNYQQRRNYGNNNRGGFRQYNSNN 270

Query: 270 -----------XXXXXXXXXMIPPTALGMP----PMDGMIXXXXXXXXXXXXXXXXXXID 314
                                +PP+++GMP    P+                      +D
Sbjct: 271 NNNMNMGMNMNMNMNMNNSRGMPPSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVD 330

Query: 315 DMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAA 374
            +IR APPRVTTAYIGNIPHFATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHEQAA
Sbjct: 331 HIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAA 390

Query: 375 VCIVALANFPFQGRNLRTGWGKERNTFI 402
           VCIVALANFPFQGRNLRTGWGKER+ F+
Sbjct: 391 VCIVALANFPFQGRNLRTGWGKERSNFM 418

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  459 bits (1180), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 228/373 (61%), Positives = 263/373 (70%), Gaps = 19/373 (5%)

Query: 49  PVSEAPAAG-----EQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYF 103
           PV E P          S E + + VVPA+AT+GGRETSDRVLYVGNLDKSI E++L+QYF
Sbjct: 17  PVQEEPTVSPSPERSDSEERETTPVVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYF 76

Query: 104 QVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQ 163
           QVGGQI++VK+M+DK N   NYAF+EY KSHDAN+ALQTLNG QIE   VRINWAFQSQQ
Sbjct: 77  QVGGQISNVKVMIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQ 136

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
               ++T+NLFVGDL+VDVDDETL +AF  FPS++Q HVMWDMQTG SRGYGFVSF DQE
Sbjct: 137 ALPDENTYNLFVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQE 196

Query: 224 QAQEAMNVMQGMPINGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXX----- 278
           QAQ AM+ MQ   +NGR +RINWA+KRE                                
Sbjct: 197 QAQLAMDSMQSQELNGRPLRINWASKRENHHNGNRRGGLAGNRNGGMRLFPNNNNGFGRG 256

Query: 279 --MIPPTALGMP-----PMDG--MIXXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYI 329
             M PP ++G+P     P +   M                   ++ MIRRAPPRVTT+YI
Sbjct: 257 MPMPPPNSMGIPLGGTLPPNAQPMGAPPSGPAPTVPPPVNPQAVEAMIRRAPPRVTTSYI 316

Query: 330 GNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRN 389
           GNIPHFAT++DLIPLLQNFGFILDF HYPEKGCCF+KYDTHEQAAVCIVALANF FQGRN
Sbjct: 317 GNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRN 376

Query: 390 LRTGWGKERNTFI 402
           LRTGWGKER TF+
Sbjct: 377 LRTGWGKERTTFV 389

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  456 bits (1174), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 230/389 (59%), Positives = 264/389 (67%), Gaps = 34/389 (8%)

Query: 47  ADPVSEAPAAGEQSAEN-------QESSVVPASATQGGRETSDRVLYVGNLDKSINEDLL 99
           ADP +E   + E ++E         + SVVPA+A  GGRETSDRVLYVGNLDK+I ED+L
Sbjct: 33  ADPSAEQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL 92

Query: 100 KQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAF 159
           KQYFQVGG I ++KIM+DK N NVNYAF+EY +SHDAN+ALQTLNG QIE   V+INWAF
Sbjct: 93  KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAF 152

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           QSQQ++ SDDTFNLFVGDLNV+VDDETL +AF  FPSY+  HVMWDMQTG SRGYGFVSF
Sbjct: 153 QSQQSS-SDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 211

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXM 279
             Q+ AQ AM+ MQG  +NGR +RINWA KR+                            
Sbjct: 212 TSQDDAQTAMDSMQGQDLNGRPLRINWAAKRDNNNTNNYPQRRNYGNNNRGGFRQYNNNN 271

Query: 280 ----------------------IPPTALGMP----PMDGMIXXXXXXXXXXXXXXXXXXI 313
                                 +PP+++GMP    P+                      +
Sbjct: 272 NNNNMNMGMNMGMNMNMSSNRGMPPSSMGMPMGAMPLPSQGQPQQSQTIGLPPQVNPQAV 331

Query: 314 DDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQA 373
           D +IR APPRVTTAYIGNIPHFATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHEQA
Sbjct: 332 DHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQA 391

Query: 374 AVCIVALANFPFQGRNLRTGWGKERNTFI 402
           AVCIVALANFPFQGRNLRTGWGKER+ F+
Sbjct: 392 AVCIVALANFPFQGRNLRTGWGKERSNFM 420

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  452 bits (1163), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 227/375 (60%), Positives = 259/375 (69%), Gaps = 31/375 (8%)

Query: 58  EQSAENQ---ESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKI 114
           EQ  +NQ   + SVVPA+A  GGRETSD+VLYVGNLDK+I ED+LKQYFQVGG I ++KI
Sbjct: 45  EQVEDNQGENDPSVVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQVGGPIANIKI 104

Query: 115 MVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLF 174
           M+DK N NVNYAF+EY +SHDAN+ALQTLNG QIE   V+INWAFQSQQ++ SDDTFNLF
Sbjct: 105 MIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSS-SDDTFNLF 163

Query: 175 VGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQG 234
           VGDLNV+VDDETL +AF  FPSY+  HVMWDMQTG SRGYGFVSF  Q+ AQ AM+ MQG
Sbjct: 164 VGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQG 223

Query: 235 MPINGRAVRINWATKRE-----------------------XXXXXXXXXXXXXXXXXXXX 271
             +NGR +RINWA KR+                                           
Sbjct: 224 QDLNGRPLRINWAAKRDNNNNNNNNYPQRRNYGNNNRGGFRQYNNNNNNNMNMGMNMNMN 283

Query: 272 XXXXXXXMIPPTALGMP----PMDGMIXXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTA 327
                   +PP+++GMP    P+                      +D +IR APPRVTTA
Sbjct: 284 MNMNTNRGMPPSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTA 343

Query: 328 YIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQG 387
           YIGNIPHFATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHEQAAVCIVALANFPFQG
Sbjct: 344 YIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQG 403

Query: 388 RNLRTGWGKERNTFI 402
           RNLRTGWGKER+ F+
Sbjct: 404 RNLRTGWGKERSNFM 418

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  450 bits (1158), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/368 (60%), Positives = 263/368 (71%), Gaps = 19/368 (5%)

Query: 53  APAAGEQSAEN---QESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQI 109
           A ++ EQ+ +N   + ++VVPA+A +GGRETSD++LYVGNLDKSINED LKQYFQVGG I
Sbjct: 50  AESSSEQTGDNDTEESANVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGPI 109

Query: 110 TDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDD 169
            +VKI+VDK N   NYAF+EYLK HDANVALQTLNG  IE K V+INWAFQSQQ++N DD
Sbjct: 110 ANVKIIVDKNNKYCNYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSSN-DD 168

Query: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
           TFNLF+GDLN+DV+DE+L+ AF  FPS+VQAHVMWDMQTGRSRGYGF SF+ Q  AQ AM
Sbjct: 169 TFNLFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLAM 228

Query: 230 NVMQGMPINGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXM---------- 279
           + MQG  +NGR +RINWA+KR+                                      
Sbjct: 229 DQMQGKELNGRPIRINWASKRDNQQGQQQSHNNGGFQNRRNNNNNNPNMFGSRNTNQMQG 288

Query: 280 IPPTALGM---PPMDGM--IXXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPH 334
            PP  + M   PP  GM  +                  ++DMIRRAPPRVTTAYIGN+P 
Sbjct: 289 PPPPNMQMGVPPPQQGMNPVGPNGPHPPVVPLPVNPDAVEDMIRRAPPRVTTAYIGNLPR 348

Query: 335 FATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGW 394
           FATEADLIPLLQNFGFILDF HYP++G CFIKYDTHEQAAVCIVALANFP QGRNL+TGW
Sbjct: 349 FATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAVCIVALANFPLQGRNLKTGW 408

Query: 395 GKERNTFI 402
           GKE+ TF+
Sbjct: 409 GKEKPTFM 416

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  442 bits (1138), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 253/353 (71%), Gaps = 16/353 (4%)

Query: 60  SAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK 119
           +A   +S VVPA+A  GGRETSD++LYVGNLDKSINE+ LKQYFQ+GG I++VK++ DK 
Sbjct: 56  TAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK- 114

Query: 120 NNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLN 179
           NN+VNYAF+EYL+ HDA+VA + LNG  IE K ++INWAFQSQQTT+ +  FNLFVGDLN
Sbjct: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLN 174

Query: 180 VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING 239
           VDVDDETL HAF +FPS+VQAHVMWDMQTGRSRGYGF+SF++QE AQ AM+ MQ   +NG
Sbjct: 175 VDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNG 234

Query: 240 RAVRINWATKREXXXXXXXXXXXXXXXXXXXXXX----------XXXXXMIPPTALGMPP 289
           R +RINWA+KRE                                      +PP  +G  P
Sbjct: 235 RQIRINWASKRENATNGNGNNNNRNMNNRRNNNNSNSNGPRGGFRSYNNNMPPLPMGNMP 294

Query: 290 MDGMIXXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFG 349
           M                      +DDMIRRAP RVTT YIGNIPHFATEADLIPLLQNFG
Sbjct: 295 MSA-----PPAGPAVLPPVNPQAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFG 349

Query: 350 FILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           FILDF +YPEKG CFIKYDTHEQAAVCIV LAN+PFQGRNL+TGWGKE+  FI
Sbjct: 350 FILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  440 bits (1131), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 246/348 (70%), Gaps = 11/348 (3%)

Query: 65  ESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN 124
           +S V P  AT+GGRETSDR+LYVGNLDK+INED LKQYFQVGG I +VK++VDK N   N
Sbjct: 45  QSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN 104

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDD 184
           YAF+EY + HDANVA QTL+G QIEG  ++INWAFQSQ  + SDDTFNLFVGDLNVDVDD
Sbjct: 105 YAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVS-SDDTFNLFVGDLNVDVDD 163

Query: 185 ETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           ETL+  F +FPS++QAHVMWDM +GRSRGYGFVSF++Q+ AQ+AM   QG  +NGRA+RI
Sbjct: 164 ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223

Query: 245 NWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXMIP----------PTALGMPPMDGMI 294
           NWA+KRE                            IP             +GM P     
Sbjct: 224 NWASKREPQQHQPRPRSNRGGFRNNNGPSHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAP 283

Query: 295 XXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDF 354
                             ++ MIRRAP RVTTAYIGNIPHFA E DLIPLLQNFGFI+DF
Sbjct: 284 QGIPPQGPVVPPPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDF 343

Query: 355 SHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402
            HYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE+  FI
Sbjct: 344 KHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFI 391

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  432 bits (1110), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 206/358 (57%), Positives = 250/358 (69%), Gaps = 14/358 (3%)

Query: 58  EQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD 117
           E S + +E +V PA+A++GGRETSDR+LYVGNLD ++ E++LKQYFQVGG I +VKI++D
Sbjct: 42  ESSTKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMD 101

Query: 118 KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGD 177
           K N   NYAF+E+ + HDANVA QTL+G QIE   ++INWAFQSQQ + S+DTFNLFVGD
Sbjct: 102 KNNKQANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVS-SEDTFNLFVGD 160

Query: 178 LNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPI 237
           LNVDVDDETL+  F   P+++QAHVMWDMQTGRSRGYGFVSF +Q QAQ+AM   QG  +
Sbjct: 161 LNVDVDDETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGAVV 220

Query: 238 NGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXM---IPPTA---------- 284
           NGRA+RINWA+KRE                           +   +PP            
Sbjct: 221 NGRAIRINWASKREHNSHNNNPMNNRGGARRGGFRNHGNNQLRHQMPPMGMPGRGAMLPN 280

Query: 285 LGMPPMDGMIXXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPL 344
           +GMP    M                   ++ M+R APPRVTT YIGNIPHFATE DLIPL
Sbjct: 281 MGMPSQPPMPQGAQPQGPIMPPQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPL 340

Query: 345 LQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           LQNFGFI+DF HYP++GCCFIKY THEQAAVCI+ L NFPFQGRNLRTGWGKE+ ++I
Sbjct: 341 LQNFGFIVDFKHYPDRGCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKEKPSYI 398

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  428 bits (1101), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/343 (60%), Positives = 242/343 (70%), Gaps = 24/343 (6%)

Query: 69  VPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFI 128
            P  AT+GGRETSDR+LYVGNLDK+INE  LKQYFQVGG I +VK++VDK N   NYAF+
Sbjct: 21  TPVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFV 80

Query: 129 EYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLS 188
           EY +  DANVA QTL+G QIE   ++INWAFQSQQ + SDDTFNLFVGDLNVDVDDETLS
Sbjct: 81  EYRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVS-SDDTFNLFVGDLNVDVDDETLS 139

Query: 189 HAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWAT 248
             F +FP+++QAHVMWDMQ+GRSRGYGFVSF +QE+AQ+AM+  QG  +NGRA+R+NWA 
Sbjct: 140 STFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAA 199

Query: 249 KREXXXXXXXXXXXXXXXXXXXXXXXXXXXMIP---------PTALGMPPMDGMIXXXXX 299
           KRE                             P         P  L  PP+   +     
Sbjct: 200 KRESQHAARPRSNRGGFRGGSGHQPFRGMPQGPHLGGAAPAGPMQLQGPPVPSPV----- 254

Query: 300 XXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPE 359
                        ++ MIRRAP RVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HY E
Sbjct: 255 ---------NPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAE 305

Query: 360 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           KGCCFIKYDTH+QAA+CIVALANFPFQGR LRTGWGKE+ +F+
Sbjct: 306 KGCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPSFV 348

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  419 bits (1077), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/376 (55%), Positives = 254/376 (67%), Gaps = 27/376 (7%)

Query: 51  SEAPAAGEQSA-ENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQI 109
           +E P+   Q+A +  E +V PA+AT+GGRETSDR+LYVGNLD ++ ED+LKQYFQVGG I
Sbjct: 29  AEQPSQEPQTAGKAAEPAVTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAI 88

Query: 110 TDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDD 169
            +VKI++DK N   NYAF+E+ + HDA+VA QTL+G QIE   ++IN+AFQSQQ + S+D
Sbjct: 89  ANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVS-SED 147

Query: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
           TFNLFVGDLNVDVDDETL++ F   P+++QAHVMWDMQTGRSRGYGFVSF +Q QAQ+AM
Sbjct: 148 TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAM 207

Query: 230 NVMQGMPINGRAVRINWATKREX--------------XXXXXXXXXXXXXXXXXXXXXXX 275
              QG  +NGRA+RINWA+KRE                                      
Sbjct: 208 EEKQGTVVNGRAIRINWASKREHNNGNNANNNIANNNNNNNMGNRGGLRRGGFRGHSNAQ 267

Query: 276 XXXMIPPTALGMPPMDGMIXXXXXXXXXXXXXXXX---------XXIDDMIRRAPPRVTT 326
               +PP  +GMP   G +                           I+ MIR AP RVTT
Sbjct: 268 MRHQLPP--MGMPTHGGAMMPGMGAPLPQGSQAPGPMLPPQVPPQAIEAMIRSAPSRVTT 325

Query: 327 AYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQ 386
            YIGNIPHFA+E DLIPLLQNFGFI+DF HYP++GCCFIKY THEQAA+CI+ L NFPFQ
Sbjct: 326 VYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAICILTLGNFPFQ 385

Query: 387 GRNLRTGWGKERNTFI 402
           GRNLRTGWGKE+ T++
Sbjct: 386 GRNLRTGWGKEKPTYV 401

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  339 bits (869), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (87%), Gaps = 2/201 (0%)

Query: 51  SEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT 110
           +E    GE+  E  E +VVPASAT GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT
Sbjct: 57  TEEKGNGEEQEE--EPNVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT 114

Query: 111 DVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDT 170
           DVKIMVDKKN NVNYAF+EYLKSHDANVALQTLNGIQIE K ++INWAFQSQQ  NS+DT
Sbjct: 115 DVKIMVDKKNQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDT 174

Query: 171 FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230
           FNLFVGDLN+DVDDETLS  F  FPSY+QAHVMWDMQT RSRGYGFVSFAD++QAQ AM+
Sbjct: 175 FNLFVGDLNIDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMD 234

Query: 231 VMQGMPINGRAVRINWATKRE 251
            MQG  INGR +RINWATKRE
Sbjct: 235 TMQGKEINGRPIRINWATKRE 255

 Score =  200 bits (508), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 87/90 (96%), Positives = 88/90 (97%)

Query: 313 IDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQ 372
           +DDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQ FGFILDFSHYPEKGCCFIKYDTHEQ
Sbjct: 354 VDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTHEQ 413

Query: 373 AAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           AAVCIVALANFPFQGRNLRTGWGKER TFI
Sbjct: 414 AAVCIVALANFPFQGRNLRTGWGKERTTFI 443

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  318 bits (815), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 184/250 (73%), Gaps = 9/250 (3%)

Query: 6   QEQQHPTA----VEQTTIPSATENIXXXXXXXXXXXXXXXXXXXXADPVSEAPAAGEQSA 61
           QEQ  PT+     E +++P +   +                    AD V E     E   
Sbjct: 3   QEQIQPTSQSSEAEISSVPQSESPVTTAATAPSSIEPSQKQAASEADVVPE-----ENEE 57

Query: 62  ENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN 121
            N+E  VVPA+AT GGRETSDRVLYVGNLDKSI ED+LKQYFQV GQI DVK+M+DKK+N
Sbjct: 58  ANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIVDVKVMIDKKSN 117

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVD 181
            VNYAF+EY K+HDA+VALQTLNGIQIE   V+IN AFQSQQ+T  D TFNLFVGDLN+D
Sbjct: 118 YVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDSTFNLFVGDLNID 177

Query: 182 VDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRA 241
           +DD+TLS +F  FPSY+QAHVMWDMQTGRSRGYGFVSFADQEQAQ+AM  MQG  +NGR 
Sbjct: 178 IDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEMQGKELNGRP 237

Query: 242 VRINWATKRE 251
           +RINWATKR+
Sbjct: 238 IRINWATKRD 247

 Score =  200 bits (509), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 90/110 (81%), Positives = 95/110 (86%), Gaps = 4/110 (3%)

Query: 313 IDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQ 372
           +DDMIRRAPPRV+TAYIGNIPHFATEADLIPLLQ+FGFILDF+HYPEKGCCFIKYDTHEQ
Sbjct: 327 VDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTHEQ 386

Query: 373 AAVCIVALANFPFQGRNLRTGWGKERNTFIXXXXXXXXXXXXXGMMPIMM 422
           AAVCIVALANF FQGRNLRTGWGKERNTF              GMMP+MM
Sbjct: 387 AAVCIVALANFNFQGRNLRTGWGKERNTF----APPQQQQAQPGMMPVMM 432

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  309 bits (791), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/393 (45%), Positives = 220/393 (55%), Gaps = 49/393 (12%)

Query: 49  PVSEAPAA------GEQSAEN---QESSVVPASATQGGRETSDRVLYVGNLDKSINEDLL 99
           P SE PA+      GE+  E    ++ S  P  ATQGGRE SD++LYVGNL KSI++DLL
Sbjct: 54  PASEKPASQDNNGDGEKQQEEGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLL 113

Query: 100 KQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAF 159
           KQYFQ+GG I+ VKI+ DK +   NYAF+EY + HDANVA QTLNG ++EGK ++INWAF
Sbjct: 114 KQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAF 173

Query: 160 QSQQTTNSDD--------------------TFNLFVGDLNVDV-----DDETLSHAFDQF 194
           QSQQ  NSD+                    TF  F   +   V        +  + F  F
Sbjct: 174 QSQQV-NSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF 232

Query: 195 PSYVQAHVMWDMQ-----TGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
               QA V  + +      GR+    + S  + +Q+Q+      G P +GR    N   +
Sbjct: 233 GEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNG-PASGRGGFRNNNNQ 291

Query: 250 REXXXXXXXXXXXXXXXXXXXXXXXXXXXMIPPTALGMPPMDGMIXXXXXXXXXXXXXXX 309
            +                           +     +G+PP+                   
Sbjct: 292 NQNHHNHNGINRHAGPPPHHQMQSHLPPQLQQQPPIGIPPI--------HQAPLVPPPVD 343

Query: 310 XXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDT 369
              ++DM+RRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HYPEKGCCFIKYDT
Sbjct: 344 PEAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDT 403

Query: 370 HEQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           HEQAA+CIVAL NFPFQGRNLRTGWGKE+ TFI
Sbjct: 404 HEQAALCIVALTNFPFQGRNLRTGWGKEKPTFI 436

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  306 bits (783), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 170/193 (88%)

Query: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK 118
           Q  ++ + SVVPASAT+GGRETSDRVLYVGNLDKSI EDLLKQYFQ GG I +VKI+ D 
Sbjct: 34  QENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM 93

Query: 119 KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDL 178
           KN  VNYAF+EY++SHDANVALQTLNG+Q+E KT++INWAF++QQ   +DDTFNLFVGDL
Sbjct: 94  KNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDL 153

Query: 179 NVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPIN 238
           NVDVDDETL+  F +FP+++QAHVMWDMQTGRSRGYGFVSF++QE+AQ+AM+ MQG  ++
Sbjct: 154 NVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLS 213

Query: 239 GRAVRINWATKRE 251
           GR +RINWATKRE
Sbjct: 214 GRQIRINWATKRE 226

 Score =  194 bits (492), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (97%)

Query: 313 IDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQ 372
           I+DMIRRAPPRVTTAYIGNIPH+ATEADLIPLLQNFGFILDF+HYPEKGCCFIKYDTHEQ
Sbjct: 303 IEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQ 362

Query: 373 AAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           AAVCIVALANFPFQGRNLRTGWGKER  F+
Sbjct: 363 AAVCIVALANFPFQGRNLRTGWGKERTNFM 392

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 62  ENQESSVVPASATQGGRETSDRV-LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KK 119
           EN+   +  A  TQ   E  D   L+VG+L+  ++++ L   F+         +M D + 
Sbjct: 124 ENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQT 183

Query: 120 NNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQ 163
             +  Y F+ +    +A  A+  + G  + G+ +RINWA + ++
Sbjct: 184 GRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKRER 227

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  297 bits (761), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 158/185 (85%)

Query: 67  SVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYA 126
           +V+PASA +GGRETSD+VLY+GNLDKSINED LKQYFQV GQI DVK+MVDKKNN+VNYA
Sbjct: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYA 74

Query: 127 FIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDET 186
           FIEY  +HDANVALQTLNGIQIE K ++INWAFQSQ   N D +FNLF+GDLNV+VDD T
Sbjct: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134

Query: 187 LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
           L++AF   P ++QAHVMWDMQT RSRGYGFVSF   E AQ AM+ MQG  INGRA+RINW
Sbjct: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194

Query: 247 ATKRE 251
           ATKRE
Sbjct: 195 ATKRE 199

 Score =  192 bits (488), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (97%)

Query: 313 IDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQ 372
           ++DMIRRAPPRVTTAYIGNIPHFATE DLIPLLQNFGFILDF+HYPEKGCCFIKYDTHEQ
Sbjct: 248 VEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQ 307

Query: 373 AAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           AAVCIVAL+NF FQGRNLRTGWGKER+TFI
Sbjct: 308 AAVCIVALSNFQFQGRNLRTGWGKERSTFI 337

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 360 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 398
           +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 328 YIGNIPHFATEADLIPLLQNFGFILDFSHYPEK-----GCCFIKYDTHEQAAVCIVALAN 382
           YIGN+     E  L    Q  G I+D     +K        FI+Y T+  A V +  L  
Sbjct: 34  YIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNG 93

Query: 383 FPFQGRNLRTGWGKERNT 400
              + +N++  W  +  T
Sbjct: 94  IQIENKNIKINWAFQSQT 111

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  293 bits (749), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 143/211 (67%), Positives = 167/211 (79%), Gaps = 8/211 (3%)

Query: 48  DPVSEAPAAGEQSAENQES-------SVVPASATQGGRETSDRVLYVGNLDKSINEDLLK 100
           DP +E   +GE ++   E        SVVPA+A  GGRETSDRVLYVGNLDK+I ED+LK
Sbjct: 33  DPSAEQNVSGEVNSTQVEDDQGESDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILK 92

Query: 101 QYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQ 160
           QYFQVGG I ++KIM+DK N NVNYAF+EY +SHDAN+ALQTLNG QIE   V+INWAFQ
Sbjct: 93  QYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQ 152

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           SQQ++ SDDTFNLFVGDLNV+VDDETL +AF  FPSY+  HVMWDMQTG SRGYGFVSF 
Sbjct: 153 SQQSS-SDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFT 211

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            Q+ AQ AM+ MQG  +NGR +RINWA KR+
Sbjct: 212 SQDDAQTAMDTMQGQDLNGRPLRINWAAKRD 242

 Score =  191 bits (485), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 96/127 (75%), Gaps = 4/127 (3%)

Query: 280 IPPTALGMP----PMDGMIXXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHF 335
           +PP+++GMP    P+                      +D +IR APPRVTTAYIGNIPHF
Sbjct: 298 MPPSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHF 357

Query: 336 ATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWG 395
           ATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWG
Sbjct: 358 ATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWG 417

Query: 396 KERNTFI 402
           KER+ F+
Sbjct: 418 KERSNFM 424

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  284 bits (726), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 133/185 (71%), Positives = 159/185 (85%), Gaps = 1/185 (0%)

Query: 67  SVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYA 126
           S+VPA+A  GGRETSD++LYVGNLDKSINED+LKQYFQVGG IT+VK++ DK NN  NYA
Sbjct: 61  SIVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDK-NNEANYA 119

Query: 127 FIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDET 186
           F+EY + HDA++AL+TLNG QIE  T++INWAFQSQQ T SD+TFNLF+GDLNVDVDDET
Sbjct: 120 FVEYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDET 179

Query: 187 LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
           L  AF  F S++QAHVMWDMQTGRSRGYGFVSF++ + AQ AM+ MQG  +NGR +RINW
Sbjct: 180 LVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINW 239

Query: 247 ATKRE 251
           A+KRE
Sbjct: 240 ASKRE 244

 Score =  183 bits (465), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 80/90 (88%), Positives = 85/90 (94%)

Query: 313 IDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQ 372
           +DDMIRRAP RVTT YIGNIPHFATEADLIPLLQNFGFILDF HYPEKG CFIKYDTHEQ
Sbjct: 312 VDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQ 371

Query: 373 AAVCIVALANFPFQGRNLRTGWGKERNTFI 402
           AAVCIV LANFPFQGRNL+TGWGKE++TF+
Sbjct: 372 AAVCIVVLANFPFQGRNLKTGWGKEKSTFM 401

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  280 bits (716), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (82%), Gaps = 1/188 (0%)

Query: 64  QESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNV 123
           ++  + PA+  +GGRETSD++LYVGNLDKSI EDLLKQYFQVGG + +VKI+VDK N   
Sbjct: 25  EQPQITPANVARGGRETSDKILYVGNLDKSITEDLLKQYFQVGGPVANVKILVDKNNQEA 84

Query: 124 NYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVD 183
           NYAF+EY K HDANVA QTL+G  IE   ++INWAFQS Q   SD++FNLFVGDLNVDVD
Sbjct: 85  NYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAFQSHQVA-SDESFNLFVGDLNVDVD 143

Query: 184 DETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVR 243
           DETL++AF +F +++QAHVMWDMQ+GRSRGYGFVSF +QEQAQ+AM   QG  +NGRA+R
Sbjct: 144 DETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQEQAQKAMETKQGFELNGRAIR 203

Query: 244 INWATKRE 251
           INWA+KRE
Sbjct: 204 INWASKRE 211

 Score =  187 bits (474), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 84/87 (96%)

Query: 316 MIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAV 375
           MIRRAPPR+TTAYIGNIPHFATE DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQAAV
Sbjct: 289 MIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAV 348

Query: 376 CIVALANFPFQGRNLRTGWGKERNTFI 402
           CIVALANFPFQGRNLRTGWGKE+ TFI
Sbjct: 349 CIVALANFPFQGRNLRTGWGKEKPTFI 375

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  103 bits (257), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 105/193 (54%), Gaps = 6/193 (3%)

Query: 60  SAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK- 118
           S E Q ++  P+SAT    E S   LYVG+LD S++E LL   F   G ++ +++  D  
Sbjct: 20  SQEQQTATSTPSSATT---ENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAI 76

Query: 119 KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDL 178
              ++ YA++ +        A++ LN   I+G+  RI W+ Q         + N+F+ +L
Sbjct: 77  TKTSLGYAYVNFNDHEAGKKAIEKLNYTPIKGRLCRIMWS-QRDPALRKKGSANIFIKNL 135

Query: 179 NVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPIN 238
           + D+D++ L   F  F + + + +  D +TG+S+G+GFV F D   A+EA++ + GM +N
Sbjct: 136 HSDIDNKALYDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGMLLN 194

Query: 239 GRAVRINWATKRE 251
           G+ + +     R+
Sbjct: 195 GQEIFVGPHLSRK 207

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N++    ++   + F   G++    +   +      + F+++    DA  A++ LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189
           G Q + + + ++ A   ++  Q                    NLF+ +L+  +DDE L  
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +     VM   + G+SRG+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 250 RE 251
           ++
Sbjct: 402 KD 403

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score =  103 bits (256), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 106/204 (51%), Gaps = 4/204 (1%)

Query: 50  VSEAPAAGEQSAENQESSVVPAS-ATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQ 108
           + E PA+ E+S+    + V  AS     G       LYVG LD S++E LL   F   G 
Sbjct: 17  LQEQPASQEESSSGSAAEVSSASNGGNSGTAVDSASLYVGELDPSVSEALLYDIFSPIGP 76

Query: 109 ITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNS 167
           ++ +++  D     ++ YA++ +       VA++ LN   I+GK  RI W+ Q   +   
Sbjct: 77  VSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEKLNYTPIKGKPCRIMWS-QRDPSMRK 135

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQE 227
           + + N+F+ +L+ D+D++ L   F  F + +   +  D +TG+S+G+GFV F +   A E
Sbjct: 136 NGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDTAASE 194

Query: 228 AMNVMQGMPINGRAVRINWATKRE 251
           A++ + GM +NG  V +     R+
Sbjct: 195 AIDAINGMMLNGLEVYVAAHVSRK 218

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 84/182 (46%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    E+  ++ F+  G IT + +  D +     + F+ Y     A  A+  LN
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189
            ++ + + + +  A   ++  Q                    NLFV +L+  +DDE L  
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F+ F +     VM + +TG+S+G+GFV F+  E+A  A+       + G+ + +  A +
Sbjct: 354 EFESFGTITSVKVMRN-ETGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

Query: 250 RE 251
           ++
Sbjct: 413 KD 414

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 101/180 (56%), Gaps = 10/180 (5%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVDKKNNNV----NYAFIEYL 131
           G ++ +  LY+G+LD S +E++++  +  +G    ++K+M + +N  V     Y F+++ 
Sbjct: 42  GSQSRNNQLYMGDLDPSWDENVIRSIWNSLGESNVEIKLMWNNRNAGVRTHLGYCFVQFS 101

Query: 132 KSHDANVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLS 188
               A+ AL   NG+ I G   KT+R+NW+  S  + +  +  ++FVGDL  +V +  L 
Sbjct: 102 SRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNVTESDLF 160

Query: 189 HAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
             F  + PS   A VM+D  TG S+GY FV F +QE  Q A+  M G  + GRA+R+  A
Sbjct: 161 ELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGSA 220

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 93/226 (41%), Gaps = 55/226 (24%)

Query: 71  ASATQGGRETSDRV-LYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDKKNN-NVNYAF 127
           +SA+    + S+ + ++VG+L  ++ E DL + +       ++ K+M D+    +  YAF
Sbjct: 130 SSASGNSADGSNEISVFVGDLAPNVTESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAF 189

Query: 128 IEYLKSHDANVALQTLNGIQIEGKTVRINWA-FQSQQTTN-------------------- 166
           + +    D   ALQ + G  ++G+ +R+  A  Q+Q+  N                    
Sbjct: 190 VRFGNQEDQQRALQEMTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKLKGLNATVSSPKP 249

Query: 167 ---SDDTFN----------------------LFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
              S   F+                      LFV  L+  V +  L   F  F + + A 
Sbjct: 250 ANISSTNFSQFILPTQQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAK 309

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           +  + Q       GFV + D+  A+ A+  +QG PI G  ++I+W 
Sbjct: 310 LPENKQC------GFVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 325 TTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPE-KGCCFIKYDTHEQAAVCIVALANF 383
           TT ++ ++ H  TE +L    Q FG ++ ++  PE K C F++Y     A + I+ L  F
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVI-YAKLPENKQCGFVQYVDRASAEMAILKLQGF 337

Query: 384 PFQGRNLRTGWGK 396
           P +G  ++  WG+
Sbjct: 338 PIRGSRIKISWGR 350

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 93/161 (57%), Gaps = 3/161 (1%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           LYVG LD S++E LL   F   G ++ +++  D     ++ YA++ +        A++ L
Sbjct: 45  LYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEKL 104

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++TL   F  F + +   + 
Sbjct: 105 NYTAIKGRPCRIMWS-QRDPSMRKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIA 163

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
            D +TG+S+G+GFV F ++E A+EA++ + GM +NG+ V +
Sbjct: 164 ND-ETGKSKGFGFVHFENEEAAREAIDAINGMLLNGQEVYV 203

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 87/182 (47%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV NLD    E+  +  F+  G IT V +  D +  +  + F+++    DA  A++ LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189
             + +G+T+ +  A          + Q   +  +        NLF+ +L+  +DDE L  
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +   A VM   + G+S+G+GFV F+  E+A  A+       + G+ + +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

Query: 250 RE 251
           ++
Sbjct: 405 KD 406

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%)

Query: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
           T +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F D E  + A+
Sbjct: 42  TASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAI 101

Query: 230 NVMQGMPINGRAVRINWATK 249
             +    I GR  RI W+ +
Sbjct: 102 EKLNYTAIKGRPCRIMWSQR 121

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 103/197 (52%), Gaps = 12/197 (6%)

Query: 49  PVSEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQ 108
           P  EA  A   S+E+Q++         G  + +   LYVG LD S++E LL   F   G 
Sbjct: 22  PQQEATPASTASSESQQA---------GDNDVTSTSLYVGELDPSVSEALLYDLFSPIGS 72

Query: 109 ITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNS 167
           +  +++  D     ++ YA++ +        A++ LN   I+GK  RI W+ Q   +   
Sbjct: 73  VASIRVCRDAITKTSLGYAYVNFSDHEAGKQAIEKLNYTPIKGKLCRIMWS-QRDPSLRK 131

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQE 227
               N+F+ +LN D+D++ L   F  F + + + +  D +TG+S+G+GFV F ++  A E
Sbjct: 132 KGHGNIFIKNLNQDIDNKALFDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEEESAANE 190

Query: 228 AMNVMQGMPINGRAVRI 244
           A++ + GM +NG+ + +
Sbjct: 191 AIDALNGMLLNGQEIYV 207

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 84/182 (46%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    ++  K++F   G +T V +          + F+ Y   +DA  A++ LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 145 GIQI----------EGKTVRINWAFQSQQTTNSDDT-----FNLFVGDLNVDVDDETLSH 189
           G +           + K  RI    +  ++T  +        NLFV +L+  +DDE L  
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +     VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

Query: 250 RE 251
           ++
Sbjct: 409 KD 410

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 160 QSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVS 218
           +SQQ  ++D T  +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+
Sbjct: 35  ESQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVN 94

Query: 219 FADQEQAQEAMNVMQGMPINGRAVRINWATK 249
           F+D E  ++A+  +   PI G+  RI W+ +
Sbjct: 95  FSDHEAGKQAIEKLNYTPIKGKLCRIMWSQR 125

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 98/183 (53%), Gaps = 5/183 (2%)

Query: 65  ESSVVPASATQGGR--ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNN 121
           + +V PAS     +  ETS   LYVG LD S++E LL   F   G ++ +++  D     
Sbjct: 22  QQNVAPASNEPESQKVETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKT 81

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVD 181
           ++ YA++ +        A++ LN   I+G   RI W+ Q   +     + N+F+ +L+ D
Sbjct: 82  SLGYAYVNFNDHEAGKTAIEKLNYAPIKGVPCRIMWS-QRDPSMRKKGSGNIFIKNLHPD 140

Query: 182 VDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRA 241
           +D++ L   F  F + +   +  D + G SRG+GFV F D E A+EA++ + GM +NG+ 
Sbjct: 141 IDNKALHDTFSVFGNILSCKIATD-EAGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQE 199

Query: 242 VRI 244
           V +
Sbjct: 200 VYV 202

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 85/182 (46%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+     ++  +++F   G IT   +  D +     + F+ Y   +DA  A++ LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 145 GIQIEGKTVRINWAFQS----QQTTNSDDTF-----------NLFVGDLNVDVDDETLSH 189
               +G+T+ +  A +     Q+     + F           NLFV +L+  +DD+ L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +     VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

Query: 250 RE 251
           ++
Sbjct: 404 KD 405

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           +SQ+   S  + +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F
Sbjct: 33  ESQKVETS--SASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNF 90

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            D E  + A+  +   PI G   RI W+ +
Sbjct: 91  NDHEAGKTAIEKLNYAPIKGVPCRIMWSQR 120

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 97/193 (50%), Gaps = 6/193 (3%)

Query: 53  APAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDV 112
           APAA E       S      A     +T+   LYVG LD S++E LL   F   G +T +
Sbjct: 23  APAASETEGTPAASET---EANNSNVDTTSASLYVGELDPSVSEALLYDIFSPIGPVTSI 79

Query: 113 KIMVDK-KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTF 171
           ++  D     ++ YA++ +        A++ LN   I+GK  RI W+ Q           
Sbjct: 80  RVCRDAITKTSLGYAYVNFNDHESGRTAIEKLNYSPIKGKPCRIMWS-QRDPALRKKGAG 138

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           N+F+ +L+ D+D++ L   F  F + +   +  D +TG+S+G+GFV F +   A EA++ 
Sbjct: 139 NIFIKNLHPDIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDNAAVEAVDA 197

Query: 232 MQGMPINGRAVRI 244
           + GM +NGR V +
Sbjct: 198 INGMMLNGREVYV 210

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 84/182 (46%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    ED     F   G IT + +  D +     + FI +    DA  A++ LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189
            ++ +G+ + +  A          + Q   +  +        NLFV +L+  +DDE L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F S   A VM + + G+S+ +GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

Query: 250 RE 251
           ++
Sbjct: 412 KD 413

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +L+VG+L+  V +  L   F          V  D  T  S GY +V+F D E  + A+  
Sbjct: 51  SLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGRTAIEK 110

Query: 232 MQGMPINGRAVRINWATK 249
           +   PI G+  RI W+ +
Sbjct: 111 LNYSPIKGKPCRIMWSQR 128

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 91/167 (54%), Gaps = 2/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           ETS   LYVG LD +++E LL   F   G ++ +++  D     ++ YA++ +       
Sbjct: 36  ETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGR 95

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++ L   F  F + 
Sbjct: 96  QAIEKLNYTPIKGQPCRIMWS-QRDPSLRKKGSGNIFIKNLHADIDNKALHDTFSVFGNI 154

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           +   +  D  TG S+G+GFV F   E A+EA++ + GM +NG+ V +
Sbjct: 155 LSCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGMLLNGQEVYV 201

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 83/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +Y+ N+     E   +++F+    +T V +  D +     + F+ Y     A  A++ LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189
           G++  G+ + +  A   ++ QQ                    NLF+ +L+  +DDE L  
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +     VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

Query: 250 RE 251
           ++
Sbjct: 403 KD 404

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 6/92 (6%)

Query: 164 TTNSDD------TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFV 217
           +T+SD       T +L+VG+L+  V +  L   F    S     V  D  T  S GY +V
Sbjct: 27  STDSDSQKVETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYV 86

Query: 218 SFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
           +F D E  ++A+  +   PI G+  RI W+ +
Sbjct: 87  NFNDYEAGRQAIEKLNYTPIKGQPCRIMWSQR 118

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 106/181 (58%), Gaps = 10/181 (5%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN---NNVNYAFIEYLKS 133
           G ET+   LY+G+LD S  E+ +KQ +   G+  +V++ + K +   NN  Y F+E+  +
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGE-PNVQVKLIKNSGPMNNSGYCFVEFPSN 105

Query: 134 HDA-NVALQTLNGIQIE-GKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAF 191
             A N  L+T   I ++  +++++NWA      T     F++FVGDL  +V +  L   F
Sbjct: 106 LSATNALLKTGLPIPVDPSRSLKLNWA---SFATAPGTEFSIFVGDLAPNVSESQLFELF 162

Query: 192 -DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
             ++ S + A +++D  TG S+GYGFV F ++ + Q ++  MQG+ +NGRA+R++  +K 
Sbjct: 163 ISRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTSKN 222

Query: 251 E 251
           +
Sbjct: 223 K 223

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 283 PNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQ 342

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 343 GFPIGNSRIRLSWGRS 358

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + E+ L+ YFQ  GQI  VKI V K        F++Y+    A  A+ 
Sbjct: 285 NTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 339

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNL 173
            + G  I    +R++W   ++Q       F +
Sbjct: 340 KMQGFPIGNSRIRLSWGRSAKQAAGMQQVFAM 371

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           Q T+ ++T  +F+G L+  V +E L   F  F   V   +         +G GFV + D+
Sbjct: 279 QFTDPNNT-TVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVG------KGCGFVQYVDR 331

Query: 223 EQAQEAMNVMQGMPINGRAVRINWA 247
             A+ A+  MQG PI    +R++W 
Sbjct: 332 SSAENAIAKMQGFPIGNSRIRLSWG 356

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 93/167 (55%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           ET    LYVG+LD S++E  L   F   G ++ +++  D     ++ YA++ +     A 
Sbjct: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+GK  RI W+ Q   +       N+F+ +L+ D+D++ L   F  F + 
Sbjct: 91  TAIEKLNFTPIKGKLCRIMWS-QRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNI 149

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           + + V  D +TG+S+G+G+V F + E A EA++ + GM +NG+ + +
Sbjct: 150 LSSKVATD-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYV 195

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 83/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +Y+ N++    +   ++     G+   V +    +  N  + F+ ++   DA   ++ LN
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189
             + +G+ + +N A   ++ QQ                    NLF+ +L+  +DD+ L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 250 RE 251
           ++
Sbjct: 397 KD 398

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 78/171 (45%), Gaps = 6/171 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +++ NL   I+   L   F V G I   K+  D+   +  + ++ + +   A+ A+  LN
Sbjct: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALN 184

Query: 145 GIQIEGKTVRINWAFQSQQTTNSDDTF-----NLFVGDLNVDVDDETLSHAFDQFPSYVQ 199
           G+ + G+ + +      ++  +  +       N+++ ++N +  D+       +F     
Sbjct: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKF-GKTD 243

Query: 200 AHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           + V+     G ++G+GFV+F + E A + +  +      G+ + +N A K+
Sbjct: 244 SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 5/109 (4%)

Query: 141 QTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQA 200
           + L  + ++ K    N   QS+  + S     L+VGDL+  V +  L   F    +    
Sbjct: 10  EQLENLSLQDKQEGTNEENQSETVSAS-----LYVGDLDPSVSEAHLYDIFSPIGAVSSI 64

Query: 201 HVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            V  D  T  S GY +V+F D + A+ A+  +   PI G+  RI W+ +
Sbjct: 65  RVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 325 TTAYIGNIPHFATEADLIPLLQNFGFI--LDFSHYPE---KGCCFIKYDTHEQAAVCIVA 379
           T  YI NI    T+ +   L+  FG    +     PE   KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 380 LANFPFQGRNLRTGWGKER 398
           L N  F+G+ L     +++
Sbjct: 276 LNNTEFKGQPLYVNRAQKK 294

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 105/181 (58%), Gaps = 10/181 (5%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN---NVNYAFIEYLKS 133
           G +TS   LY+G+LD S  E  +KQ +   G+  +V++ + K ++   N  Y F+E+  +
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGE-ANVQVKLIKNSSGGGNSGYCFVEFPSN 104

Query: 134 HDA-NVALQTLNGIQIEG-KTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAF 191
             A N  L+T   I ++  +T+++NWA      T     F++FVGDL  +V +  L   F
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWA---SFATTPGSEFSIFVGDLAPNVTESQLFELF 161

Query: 192 -DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
             ++ S + A +++D  TG S+GYGFV F ++ + Q ++  MQG+ +NGRA+R++  +K 
Sbjct: 162 ISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKN 221

Query: 251 E 251
           +
Sbjct: 222 K 222

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + ED L+ YFQ  GQI  VKI V K        F++Y+    A  A+ 
Sbjct: 281 NTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 335

Query: 142 TLNGIQIEGKTVRINWAFQSQQT 164
            + G  I    VR++W   ++QT
Sbjct: 336 KMQGFPIGNSRVRLSWGRSAKQT 358

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%)

Query: 320 APPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVA 379
           A P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  
Sbjct: 277 ADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAK 336

Query: 380 LANFPFQGRNLRTGWGKE 397
           +  FP     +R  WG+ 
Sbjct: 337 MQGFPIGNSRVRLSWGRS 354

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+  V ++ L   F  F   V   +         +G GFV + D+  A+ A+  M
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPFGQIVYVKIP------VGKGCGFVQYVDRSSAENAIAKM 337

Query: 233 QGMPINGRAVRINWA 247
           QG PI    VR++W 
Sbjct: 338 QGFPIGNSRVRLSWG 352

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 101/196 (51%), Gaps = 31/196 (15%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQ-YFQVGGQITDVKIM----VDKKNNNVNYAFIEYL 131
           G  T    LY+G+LD S +E ++K  +  +G +   V++M     D    N+ Y F+E+ 
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFP 137

Query: 132 KSHDANVALQTLNGIQIEG---KTVRINWAFQS----------------QQTTNSDDTFN 172
               A+ AL   NG++I G   K +++NW+ QS                QQT NS     
Sbjct: 138 SPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNS----- 191

Query: 173 LFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +FVGDL   V +  L   F +++PS V A VM+D  TG S+GYGFV F      Q A+  
Sbjct: 192 IFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVE 251

Query: 232 MQGMPINGRAVRINWA 247
           MQG  +NGRA++I  A
Sbjct: 252 MQGCFLNGRAIKIGIA 267

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +    TE +L    + FG I+       KGC F++Y     A   I  + 
Sbjct: 324 PNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQ 383

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 384 GFPIANSRVRLSWGRS 399

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  ++VG L   + ED L+ YF+  G I  VKI   K        F++Y++   A  A+
Sbjct: 325 NNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGK-----GCGFVQYVERSSAETAI 379

Query: 141 QTLNGIQIEGKTVRINWAFQSQQT 164
             + G  I    VR++W   +++T
Sbjct: 380 TKMQGFPIANSRVRLSWGRSAKKT 403

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 88/238 (36%), Gaps = 57/238 (23%)

Query: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVD 117
           QS  N   + V   A     + ++  ++VG+L  S+ E  L   +          K+M D
Sbjct: 168 QSVNNGSGASVANGAV--ANQQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYD 225

Query: 118 KKNN-NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA----------FQSQQTTN 166
           +    +  Y F+++  S D   AL  + G  + G+ ++I  A            + Q   
Sbjct: 226 QLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRAIKIGIAGGNNNNNSNSNYNNQRMA 285

Query: 167 SDDTFN-------------------------------------LFVGDLNVDVDDETLSH 189
           +D+  N                                     +FVG L+  V ++ L  
Sbjct: 286 NDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHFTDPNNTTVFVGGLSPLVTEDELRS 345

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
            F+ F + +   +         +G GFV + ++  A+ A+  MQG PI    VR++W 
Sbjct: 346 YFEPFGTIIYVKIP------AGKGCGFVQYVERSSAETAITKMQGFPIANSRVRLSWG 397

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 93/174 (53%), Gaps = 3/174 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           ETS   LYVG LD S++E LL   F   G ++ +++  D   N ++ YA++ +       
Sbjct: 34  ETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGR 93

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+GK  RI W+ Q   +     + N+++ +L+  +D+++L   F  F + 
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           +   V  D   G SRG+GFV F ++  A++A+  + GM +N + V + W   ++
Sbjct: 153 LSCKVATD-DNGVSRGFGFVHFENESDARDAIEAVNGMLMNDQEVYVAWHVSKK 205

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D   +++  +Q F   G+IT   +  D +     + FI +     A  A+  LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189
                G+T+ +  A          + Q  T   +        NLF+ +L+  +DDE L  
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +     VM D + G SRG+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

Query: 250 RE 251
           +E
Sbjct: 400 KE 401

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 80/178 (44%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +Y+ NL  +I+   L + F   G I   K+  D    +  + F+ +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGFGFVHFENESDAR 180

Query: 138 VALQTLNGIQIEGKTVRINWAF-----QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
            A++ +NG+ +  + V + W       QS+         N++V +++++   E     F 
Sbjct: 181 DAIEAVNGMLMNDQEVYVAWHVSKKDRQSKLEEVKAKFTNIYVKNIDLETSQEEFEQLFS 240

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           ++     A +  D + G+ RG+GF++F D   A  A++ +      G+ + +  A K+
Sbjct: 241 KYGKITSAVLEKDSE-GKLRGFGFINFEDHSTAARAVDELNESDFRGQTLYVGRAQKK 297

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 103/185 (55%), Gaps = 14/185 (7%)

Query: 64  QESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNV 123
           Q S+ V  + +         VLY+G+LD S +E ++ Q +   G+      M+++     
Sbjct: 13  QNSNTVANTNSNNNPVPKGNVLYMGDLDLSWDERVVSQIWASLGEPNVSVKMMNR----- 67

Query: 124 NYAFIEYLKSHDANVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDTFNLFVGDLNV 180
            Y FI +L S  A+ AL   NG+ I G   K +++NWA   Q ++N+ + +++FVGDL+ 
Sbjct: 68  -YCFITFLDSLTASNALLK-NGMLIPGYGGKRLKLNWA---QASSNASNGYSIFVGDLSP 122

Query: 181 DVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING 239
           +V +  L   F +++ S   A +++D  TG SRGYGFV F      Q A+  MQG+ +NG
Sbjct: 123 NVTEAQLFDLFINKYASTDHAKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNG 182

Query: 240 RAVRI 244
           RA++I
Sbjct: 183 RAIKI 187

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +    TE +L    + FG I+       KGC F++Y     A   I  + 
Sbjct: 241 PNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQ 300

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 301 GFPIANSRIRLSWGRS 316

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 79/206 (38%), Gaps = 49/206 (23%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITD-VKIMVDKKNN-NVNYAFIEYLKSHDANVALQT 142
           ++VG+L  ++ E  L   F      TD  KI+ D+    +  Y F+ +    D   AL  
Sbjct: 115 IFVGDLSPNVTEAQLFDLFINKYASTDHAKIVYDQATGVSRGYGFVRFNSLMDQQHALLE 174

Query: 143 LNGIQIEGKTVRIN--------------------------------------WAFQSQQT 164
           + GI + G+ ++I                                       +  Q Q T
Sbjct: 175 MQGIFLNGRAIKIGMTGNKQGQLQGQQHQGQQQQDFKVPIQSNTPMNQSQFMYPVQQQPT 234

Query: 165 TN---SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFAD 221
            N     +   +FVG L+  V ++ L   F  F + V   +         +G GFV + D
Sbjct: 235 LNHFTDPNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKI------PVGKGCGFVQYID 288

Query: 222 QEQAQEAMNVMQGMPINGRAVRINWA 247
           +  A+ A++ MQG PI    +R++W 
Sbjct: 289 RVSAENAISKMQGFPIANSRIRLSWG 314

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  ++VG L   + ED L++YF+  G I  VKI V K        F++Y+    A  A+
Sbjct: 242 NNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKG-----CGFVQYIDRVSAENAI 296

Query: 141 QTLNGIQIEGKTVRINWA 158
             + G  I    +R++W 
Sbjct: 297 SKMQGFPIANSRIRLSWG 314

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 90/161 (55%), Gaps = 3/161 (1%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           LYVG LD +++E LL   F   G ++ +++  D     ++ YA++ +        A++ L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N   I+G+  RI W+ Q         + N+F+ +L+ D+D++ L   F  F + + + + 
Sbjct: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
            D +TG+S+G+GFV F  +  A+EA++ + GM +NG+ + +
Sbjct: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N++    ++   + F   G +    +   +      + F+++ K  DA  A++ LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189
           G + + +T+ ++ A   ++  Q                    NLFV +L+  +DDE L  
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +     VM     G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 250 RE 251
           ++
Sbjct: 397 KD 398

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F D E  ++A+  
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 232 MQGMPINGRAVRINWATK 249
           +   PI GR  RI W+ +
Sbjct: 96  LNYTPIKGRLCRIMWSQR 113

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 100/185 (54%), Gaps = 5/185 (2%)

Query: 62  ENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KN 120
           ++Q+++     +     +TS   LYVG LD ++ E LL   F   G ++ +++  D    
Sbjct: 19  DDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITK 78

Query: 121 NNVNYAFIEYLKSHDA-NVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLN 179
            ++ YA++ +   HDA   A+Q LN   I+G+  RI W+ Q   +     + N+F+ +L+
Sbjct: 79  TSLGYAYVNF-HDHDAGRTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNIFIKNLH 136

Query: 180 VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING 239
             +D++ L   F  F + +   +  D + G S+G+GFV F ++  A+EA++ + GM +NG
Sbjct: 137 PAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNG 195

Query: 240 RAVRI 244
           + V +
Sbjct: 196 QEVYV 200

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 84/178 (47%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +++ NL  +I+   L   F V G I   KI  D+  N+  + F+ + + + A 
Sbjct: 123 RKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAK 182

Query: 138 VALQTLNGIQIEGKTVRI-----NWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
            A+  +NG+ + G+ V +         QS+      +  N++V +++++   E     F 
Sbjct: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           QF     A +  D + G+ RG+GF++F D E A +A++ +       + + +  A K+
Sbjct: 243 QFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    ++  +  F   G+IT   +  D +     + FI +     A  A+  LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189
               + + + +  A          + Q   +  +        NLFV +L+  +DDE L  
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +   A VM D   G S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 250 RE 251
           ++
Sbjct: 402 KD 403

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F D +  + A+  
Sbjct: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100

Query: 232 MQGMPINGRAVRINWATK 249
           +    I GR  RI W+ +
Sbjct: 101 LNYTTIKGRPCRIMWSQR 118

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 99/183 (54%), Gaps = 5/183 (2%)

Query: 65  ESSVVPASATQGGRET--SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNN 121
           E    P+S    G+++  +   LYVG+LD S++E LL   F   G +T +++  D     
Sbjct: 20  EQQNAPSSTGSEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKT 79

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVD 181
           ++ YA++ +       VA++ LN   I+G+  RI W+ Q           N+F+ +LN D
Sbjct: 80  SLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWS-QRDPALRKKGNGNIFIKNLNAD 138

Query: 182 VDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRA 241
           +D++ L   F  F + + + +  D + G S+G+GFV F ++  A+EA++ + GM +NG+ 
Sbjct: 139 IDNKALYDTFSVFGNILSSKIATD-ENGNSKGFGFVHFEEEAAAKEAIDALNGMLLNGQE 197

Query: 242 VRI 244
           + +
Sbjct: 198 IYV 200

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 65/142 (45%), Gaps = 16/142 (11%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA---FQSQQTTNSD------------D 169
           + F+ Y    DA  A++ LN  + +G+ + +  A   ++  Q                  
Sbjct: 263 FGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQ 322

Query: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
             NLF+ +L+  +DDE L   F  F +     VM   + G+S+G+GFV F+  E+A +A+
Sbjct: 323 GVNLFIKNLDDSIDDEKLKEEFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAI 381

Query: 230 NVMQGMPINGRAVRINWATKRE 251
                  + G+ + +  A ++E
Sbjct: 382 TEKNQQIVAGKPLYVAIAQRKE 403

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           Q ++S+ T +L+VGDL+  V +  L   F    S     V  D  T  S GY +V+FAD 
Sbjct: 33  QQSDSNST-SLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADH 91

Query: 223 EQAQEAMNVMQGMPINGRAVRINWATK 249
           E  + A+  +   PI GR  RI W+ +
Sbjct: 92  EAGKVAIERLNYTPIKGRLCRIMWSQR 118

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           L++ NLD SI+++ LK+ F   G IT  K+M  +   +  + F+ +    +A  A+   N
Sbjct: 326 LFIKNLDDSIDDEKLKEEFAPFGTITSTKVMRTENGKSKGFGFVCFSSPEEATKAITEKN 385

Query: 145 GIQIEGKTVRINWA 158
              + GK + +  A
Sbjct: 386 QQIVAGKPLYVAIA 399

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 360 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 398
           KG  F+ Y+ HE A   +  L N  F+G+ L  G  +++
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 86/167 (51%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           E ++  LYVG LD +I E LL   F   G I+ +++  D     ++ YA++ Y       
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A+Q LN  +I G+  RI W+ +         + N+F+ +L+  +D++ L   F  F   
Sbjct: 106 KAIQELNYAEINGRPCRIMWS-ERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEV 164

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           +   V  D + G SRG+GFV F ++  A++A+  + GM +NG  V +
Sbjct: 165 LSCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYV 210

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 88/178 (49%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +++ NL  +I+   L + F   G++   K+ +D+  N+  + F+ + +  DA 
Sbjct: 133 RKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAK 192

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQ----QTTNSDDTF-NLFVGDLNVDVDDETLSHAFD 192
            A++ +NG+ + G  V +      +    +   +   F N++V +++V+  DE     F 
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLFS 252

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           Q+   V A +  D + G+ +G+GFV+F D   A +A+  + G     +A+ +  A K+
Sbjct: 253 QYGEIVSAALEKDAE-GKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKK 309

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 83/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    ++  +Q F   G+I    +  D +     + F+ ++  + A  A++ LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 145 GIQIEGKTVRINWAFQSQQTTNSDDT---------------FNLFVGDLNVDVDDETLSH 189
           G + + + + +  A +  +                       NLF+ +L+  +DDE L  
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +   A VM D Q G S+G+GFV F+  E+A +AM       + G+ + +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

Query: 250 RE 251
           ++
Sbjct: 412 KD 413

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +L+VG+L+ ++ +  L   F          V  D  T  S GY +V++ D E  ++A+  
Sbjct: 51  SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE 110

Query: 232 MQGMPINGRAVRINWATK 249
           +    INGR  RI W+ +
Sbjct: 111 LNYAEINGRPCRIMWSER 128

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           E S   LYVG+L+ S++E  L   F   G ++ +++  D     ++ YA++ +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++ L   F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           + + +  D + G+S+G+GFV F ++  A+EA++ + GM +NG+ + +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +++ NL   I+   L   F V G I   KI  D+   +  + F+ + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 138 VALQTLNGIQIEGKTVRINWAFQ-----SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
            A+  LNG+ + G+ + +          SQ         NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +F   V A +  D   G+ +G+GFV++   E A +A+  +    +NG  + +  A K+
Sbjct: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           LYV N++    ++  ++ F   G I    +  D       + F+ Y K  DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 145 GIQIEGKTVRINWAFQSQQTTN---------------SDDTFNLFVGDLNVDVDDETLSH 189
             ++ G+ + +  A +  +  +                    NLFV +L+  VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 250 RE 251
           ++
Sbjct: 400 KD 401

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           +SQ   NS  + +L+VGDL   V +  L   F    S     V  D  T  S GY +V+F
Sbjct: 29  ESQSVENS--SASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNF 86

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            D E  ++A+  +   PI GR  RI W+ +
Sbjct: 87  NDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 99/182 (54%), Gaps = 19/182 (10%)

Query: 85  LYVGNLDKSINEDLLKQ-YFQVGGQITDVKIMVDKKN--------NNVNYAFIEYLKSHD 135
           LY+G+L+ S +E+++K+ +  +G     VK+M    N         N  Y FI++    +
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDFPTHFN 115

Query: 136 ANVALQTLNGIQIEG---KTVRINWAFQSQQTT-----NSDDTFNLFVGDLNVDVDDETL 187
           A+ AL   N + I G   K +++NWA  S  +T        + F++FVGDL  +V +  L
Sbjct: 116 ASNAL-LKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQL 174

Query: 188 SHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
              F  ++PS   A V+ D+ TG S+GYGF+ F D    Q A+  MQG+ +NGRA+++  
Sbjct: 175 FDLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGM 234

Query: 247 AT 248
           ++
Sbjct: 235 SS 236

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + E+ L+QYFQ  G+I  VKI V K        F++Y+    A  A+ 
Sbjct: 293 NTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGK-----GCGFVQYIDRISAETAIS 347

Query: 142 TLNGIQIEGKTVRINWAFQSQQ 163
            + G  I    VR++W   ++Q
Sbjct: 348 QMQGFPISNSRVRLSWGRSAKQ 369

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 95/239 (39%), Gaps = 66/239 (27%)

Query: 63  NQESSVVPASA---TQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITD-VKIMVDK 118
           N  SS  P++A   T GG   S   ++VG+L  ++ E  L   F      T+  K+++D 
Sbjct: 138 NWASSSAPSTAGVSTTGGNNFS---IFVGDLAPNVTEAQLFDLFISRYPSTEHAKVVIDL 194

Query: 119 KNN-NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRI---------------------- 155
               +  Y FI +    D   AL  + G+ + G+ +++                      
Sbjct: 195 STGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMSSGQSNSGAGGSRQVGHDRY 254

Query: 156 -------------NWAFQSQ------------QTTNSDDTFNLFVGDLNVDVDDETLSHA 190
                        N A  SQ              T+ ++T  +F+G L+  V +E L   
Sbjct: 255 GGSKPAGGKSNTPNSALFSQFMYPIQQQPALNHFTDPNNT-TVFIGGLSPLVKEEELRQY 313

Query: 191 FDQFPS--YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           F  F    YV+  V         +G GFV + D+  A+ A++ MQG PI+   VR++W 
Sbjct: 314 FQPFGEIVYVKIPV--------GKGCGFVQYIDRISAETAISQMQGFPISNSRVRLSWG 364

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 32/76 (42%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +     E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 291 PNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGFVQYIDRISAETAISQMQ 350

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 351 GFPISNSRVRLSWGRS 366

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           E S   LYVG+L+ S++E  L   F   G ++ +++  D     ++ YA++ +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++ L   F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           + + +  D + G+S+G+GFV F ++  A+EA++ + GM +NG+ + +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +++ NL   I+   L   F V G I   KI  D+   +  + F+ + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 138 VALQTLNGIQIEGKTV----RINWAFQSQQTTNSDDTF-NLFVGDLNVDVDDETLSHAFD 192
            A+  LNG+ + G+ +     ++   +  Q   +   F NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHFTNLYVKNINSETTDEQFQELFA 240

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           QF   V A +  D   G+ +G+GFV++ + E A +A+  +    +NG  + +  A K+
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVETLNDSELNGEKLYVGRAQKK 297

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           LYV N++    ++  ++ F   G I    +  D       + F+ Y    DA  A++TLN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 145 GIQIEGKTVRINWAFQSQQTTN---------------SDDTFNLFVGDLNVDVDDETLSH 189
             ++ G+ + +  A +  +  +                    NLFV +L+  VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 250 RE 251
           ++
Sbjct: 400 KD 401

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 2/109 (1%)

Query: 141 QTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQA 200
           + L  + I+    +     + Q   NS  + +L+VGDL   V +  L   F    S    
Sbjct: 10  EQLENLNIQDDQKQATAGSEGQSVENS--SASLYVGDLEPSVSEAHLYDIFSPIGSVSSI 67

Query: 201 HVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            V  D  T  S GY +V+F D E  ++A+  +   PI GR  RI W+ +
Sbjct: 68  RVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           E S   LYVG+L+ S++E  L   F   G ++ +++  D     ++ YA++ +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++ L   F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           + + +  D + G+S+G+GFV F ++  A+EA++ + GM +NG+ + +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 80/178 (44%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +++ NL   I+   L   F V G I   KI  D+   +  + F+ + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 138 VALQTLNGIQIEGKTVRINWAFQ-----SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
            A+  LNG+ + G+ + +          SQ         NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQDLFI 240

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           QF   V A +  D   G+ +G+GFV++ + E A +A+  +    +NG  + +  A K+
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKK 297

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 79/182 (43%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           LYV N++    ++  +  F   G I    +  D       + F+ Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 145 GIQIEGKTVRINWAFQSQQTTN---------------SDDTFNLFVGDLNVDVDDETLSH 189
              + G+ + +  A +  +  +                    NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 341 EFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 250 RE 251
           ++
Sbjct: 400 KD 401

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 147 QIEGKTVRINWAFQSQQTTNSD------DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQA 200
           Q+E  T++ +   Q Q  T S+       + +L+VGDL   V +  L   F    S    
Sbjct: 11  QLESLTIQDD---QKQAATGSEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSI 67

Query: 201 HVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            V  D  T  S GY +V+F D E  ++A+  +   PI GR  RI W+ +
Sbjct: 68  RVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 91/167 (54%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           ETS   LYVG L+ +++E LL   F   G ++ +++  D   N ++ YA++ +       
Sbjct: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+GK  RI W+ Q   +     + N+++ +L+  +D+++L   F  F + 
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           +   V  D + G SRG+GFV F ++  A++A+  + GM +N + V +
Sbjct: 153 LSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 86/182 (47%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D+  +++  ++ F   G+IT   +  D +     + F+ +     A  A+  LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189
            ++ +G+ + +  A   ++  Q                    NLFV +L+  +DDE L  
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +   A VM D +TG SRG+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 250 RE 251
           +E
Sbjct: 400 KE 401

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +L+VG+L   V +  L   F    S     V  D  T  S GY +V+F D E   +A+  
Sbjct: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98

Query: 232 MQGMPINGRAVRINWATK 249
           +    I G+  RI W+ +
Sbjct: 99  LNYTLIKGKPCRIMWSQR 116

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 105/194 (54%), Gaps = 30/194 (15%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT-DVKIMVDKK-----------NNNVN 124
           G  T+   LY+G+LD + +++ ++Q +   G+   +V++M +              NN  
Sbjct: 48  GSGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNSLNNGSRSPMGSKNNQG 107

Query: 125 YAFIEYLKS-HDANVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDTFN-------- 172
           Y F+++  S H AN  L+  NG+ I     + +++NWA  S  + NS  TFN        
Sbjct: 108 YCFVDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSSGNS--TFNNVKSSNNC 163

Query: 173 -LFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230
            +FVGDL  +V +  L   F +++ S   A V+ D  TG S+GYGFV FA+ ++ Q A+ 
Sbjct: 164 SVFVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQSALL 223

Query: 231 VMQGMPINGRAVRI 244
            MQG+ +NGRA+++
Sbjct: 224 EMQGVFLNGRAIKV 237

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQ 369

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 370 GFPIANSRVRLSWGRS 385

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + ED L+ YFQ  G I  VKI V K        F++Y+    A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG-----CGFVQYVDRLSAETAIA 366

Query: 142 TLNGIQIEGKTVRINWAFQSQQT 164
            + G  I    VR++W   ++QT
Sbjct: 367 RMQGFPIANSRVRLSWGRSAKQT 389

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPS--YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230
           +F+G L+  V ++ L   F  F +  YV+  V         +G GFV + D+  A+ A+ 
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV--------GKGCGFVQYVDRLSAETAIA 366

Query: 231 VMQGMPINGRAVRINWA 247
            MQG PI    VR++W 
Sbjct: 367 RMQGFPIANSRVRLSWG 383

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 99/174 (56%), Gaps = 11/174 (6%)

Query: 85  LYVGNLDKSINEDLLKQ-YFQVGGQITDVKIMVDKKNNNVN--YAFIEYLKSHDANVALQ 141
           LY+G+LD S +E  +K  +  +G Q   VK++ +      N  + F+E+    +A+ AL 
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGEQNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNALL 116

Query: 142 TLNGIQIEG---KTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAF-DQFPSY 197
             NG+ +     K +++NWA     +T   + +++FVGDL  +V +  L   F  ++ S 
Sbjct: 117 K-NGLPVPNAVNKFLKLNWA---SISTTPGNEYSIFVGDLAPNVTEAQLFELFISRYSST 172

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           + + +++D  TG S+GYGFV F ++ +   A+  MQG+ +NGRA+R++  +K +
Sbjct: 173 LNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSKNK 226

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + ED L+ YFQ  G I  VKI V K        F++Y+    A  A+ 
Sbjct: 280 NTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGK-----GCGFVQYIDRISAETAIA 334

Query: 142 TLNGIQIEGKTVRINWAFQSQQT 164
            + G  I    +R++W   ++QT
Sbjct: 335 KMQGFPIGNSRIRLSWGRSAKQT 357

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 278 PNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQ 337

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 338 GFPIGNSRIRLSWGRS 353

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 90/224 (40%), Gaps = 59/224 (26%)

Query: 73  ATQGGRETSDRVLYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEY 130
           +T  G E S   ++VG+L  ++ E  L + +        + KI+ D+    +  Y F+++
Sbjct: 138 STTPGNEYS---IFVGDLAPNVTEAQLFELFISRYSSTLNSKIVFDQLTGVSKGYGFVKF 194

Query: 131 LKSHDANVALQTLNGIQIEGKTVRIN---------------------------------- 156
               + + AL  + G+ + G+ +R++                                  
Sbjct: 195 GNEAEQHRALLEMQGVFLNGRAIRVSTTSKNKPKFQQLQQLQSQSQSKSQPLQQTPINST 254

Query: 157 -------WAFQSQQT------TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
                  + F  QQT      T+ ++T  +F+G L+  V ++ L   F  F S V   + 
Sbjct: 255 ATQLQSQFVFPVQQTPSINQFTDPNNT-TVFIGGLSSLVTEDELRTYFQPFGSIVYVKIP 313

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
                   +G GFV + D+  A+ A+  MQG PI    +R++W 
Sbjct: 314 VG------KGCGFVQYIDRISAETAIAKMQGFPIGNSRIRLSWG 351

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 91/167 (54%), Gaps = 3/167 (1%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           E S   LYVG+L+ +++E  L   F   G ++ +++  D     ++ YA++ +       
Sbjct: 34  ENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+ D+D++ L   F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           + + +  D + G S+G+GFV F ++  A+EA++ + GM +NG+ + +
Sbjct: 153 LSSKIATD-ENGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYV 198

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 81/178 (45%), Gaps = 6/178 (3%)

Query: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           R+     +++ NL   I+   L   F V G I   KI  D+  N+  + F+ + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGNSKGFGFVHFEEEVAAK 180

Query: 138 VALQTLNGIQIEGKTVRINWAFQ-----SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
            A+  LNG+ + G+ + +          SQ         NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEMFV 240

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +F   V A +  D   G+ +G+GFV++ + E A +A+  +    +NG  + +  A K+
Sbjct: 241 KFGPIVSASLEKDA-DGQLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKK 297

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 80/182 (43%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           LYV N++    ++  ++ F   G I    +  D       + F+ Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 145 GIQIEGKTVRINWAFQSQQTTN---------------SDDTFNLFVGDLNVDVDDETLSH 189
              + G+ + +  A +  +  +                    NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDTVDDEKLEE 340

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  + +   A VM   + G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 250 RE 251
           ++
Sbjct: 400 KD 401

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 140 LQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQ 199
           L+ LN IQ + K        QS + +++    +L+VGDL   V +  L   F    S   
Sbjct: 12  LENLN-IQDDQKQAATGSEGQSVENSSA----SLYVGDLEPAVSEAHLYDIFSPIGSVSS 66

Query: 200 AHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
             V  D  T  S GY +V+F D E  ++A+  +   PI GR  RI W+ +
Sbjct: 67  IRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 9/172 (5%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDA 136
            T    LY+G+LD + +E++++Q ++ +G     VK+M +     N  Y F+E+      
Sbjct: 43  NTGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHG 102

Query: 137 NVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAF-D 192
           N AL   NGI I G   + +++NWA       NS   F++FVGDL+ +V +  L   F  
Sbjct: 103 NNALLK-NGIVIPGFPQRRLKLNWASAGANGNNSG--FSVFVGDLSPNVTEAQLFELFIG 159

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           ++PS   A V+ D  TG S+ YGFV F      Q  +  MQG+ +NGR++++
Sbjct: 160 RYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    +E DL    Q FG I+       KGC F++Y     A + I  + 
Sbjct: 280 PNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQ 339

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 340 GFPLANSRIRLSWGRS 355

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANV 138
           + ++  +++G L   ++ED L+QYFQ  G I  VKI   K        F++Y+    A +
Sbjct: 279 DPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGK-----GCGFVQYVDRLSAEL 333

Query: 139 ALQTLNGIQIEGKTVRINWAFQSQQ 163
           A+  + G  +    +R++W   S+Q
Sbjct: 334 AISKMQGFPLANSRIRLSWGRSSKQ 358

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+  V ++ L   F  F   +   +     TG+  G GFV + D+  A+ A++ M
Sbjct: 285 VFIGGLSSLVSEDDLRQYFQPFGDIIYVKI----PTGK--GCGFVQYVDRLSAELAISKM 338

Query: 233 QGMPINGRAVRINWA 247
           QG P+    +R++W 
Sbjct: 339 QGFPLANSRIRLSWG 353

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 28/210 (13%)

Query: 62  ENQESSVVPASATQGGRETSDRV--LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK 119
           +N   + +P+S  +    + ++   LY+G+LD   +E  +KQ +   G+   V  ++   
Sbjct: 39  KNNNGNPLPSSMNRSSNPSVNKTTQLYMGDLDPMWDESTIKQIWNSLGENNIVVKIITNS 98

Query: 120 N------NNVNYAFIEYLKSHDANVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDT 170
           N      NN  Y FIE+   ++A+ AL   NG+ I G   K +++NWA    ++  + + 
Sbjct: 99  NMTSMGRNNPGYCFIEFSNYNNASNALLK-NGLVIPGYNSKVLKLNWASMHTRSNGNTNC 157

Query: 171 ---------------FNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGY 214
                          F++FVGDL  +V +  L   F +++ S + A +++D  T  S+GY
Sbjct: 158 TANNNTSSNNSTNNDFSVFVGDLAPNVTEAQLFDLFINRYSSTIHAKIVYDQMTNVSKGY 217

Query: 215 GFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           GFV F +    Q ++N MQG+ +NGR++R+
Sbjct: 218 GFVRFNNSADQQRSLNEMQGVFLNGRSIRV 247

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    +E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 337 PNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQ 396

Query: 382 NFPFQGRNLRTGWGK 396
            FP     +R  WG+
Sbjct: 397 GFPIGNSRIRLSWGR 411

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  +++G L   ++E  L+ YFQ  G I  VKI V K        F++Y+    A  A+
Sbjct: 338 NNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKG-----CGFVQYVDRSAAETAI 392

Query: 141 QTLNGIQIEGKTVRINWAFQSQQT 164
             + G  I    +R++W   ++Q+
Sbjct: 393 SKMQGFPIGNSRIRLSWGRFAKQS 416

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+  V +  L   F  F + V   +         +G GFV + D+  A+ A++ M
Sbjct: 342 VFIGGLSSLVSEGELRSYFQPFGTIVYVKI------PVGKGCGFVQYVDRSAAETAISKM 395

Query: 233 QGMPINGRAVRINWA 247
           QG PI    +R++W 
Sbjct: 396 QGFPIGNSRIRLSWG 410

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 104/188 (55%), Gaps = 16/188 (8%)

Query: 70  PASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN----NNVNY 125
           PAS     R  S   LY+G+LD + +E  ++  +   G+  +V+I + + +    +N  Y
Sbjct: 35  PASEHHSTRSNS---LYMGDLDPNWDEAAIRAVWATLGE-PNVQIKLIRSSGSPGHNSGY 90

Query: 126 AFIEYLKSHDANVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDTFNLFVGDLNVDV 182
            F+E+    +A+ AL   NG+ I     + +++NWA      T   + +++FVGD+  +V
Sbjct: 91  CFVEFPSHTNASNALLK-NGLVIPNTGNRILKLNWA---SFATTPGNEYSVFVGDVAPNV 146

Query: 183 DDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRA 241
            +  L   F  ++ S + A +++D  TG S+GYGFV F  + + Q ++  MQG+ +NGRA
Sbjct: 147 TEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRA 206

Query: 242 VRINWATK 249
           +R++  +K
Sbjct: 207 IRVSTTSK 214

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAKMQ 329

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 330 GFPIGNSRIRLSWGRS 345

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + ED L+ +FQ  G I  VKI V K        F++Y+    A  A+ 
Sbjct: 272 NTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGK-----GCGFVQYVDRLSAETAIA 326

Query: 142 TLNGIQIEGKTVRINWAFQSQQ 163
            + G  I    +R++W   ++Q
Sbjct: 327 KMQGFPIGNSRIRLSWGRSAKQ 348

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 93/228 (40%), Gaps = 65/228 (28%)

Query: 73  ATQGGRETSDRVLYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEY 130
           AT  G E S   ++VG++  ++ E  L + +        + KI+ D+    +  Y F+++
Sbjct: 128 ATTPGNEYS---VFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKF 184

Query: 131 LKSHDANVALQTLNGIQIEGKTVRIN-----------------------WAF-------- 159
            +  +   +L  + G+ + G+ +R++                        AF        
Sbjct: 185 GQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRPKFQQVQPPLQQQQHQQHAFAKHSHAPQ 244

Query: 160 ------QSQ------------QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPS--YVQ 199
                 QSQ            Q T+ ++T  +F+G L+  V ++ L   F  F S  YV+
Sbjct: 245 FNAVQPQSQFIYPVQQQPTLTQYTDPNNT-TVFIGGLSSLVTEDELRAFFQPFGSIVYVK 303

Query: 200 AHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
             V         +G GFV + D+  A+ A+  MQG PI    +R++W 
Sbjct: 304 IPV--------GKGCGFVQYVDRLSAETAIAKMQGFPIGNSRIRLSWG 343

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 104/188 (55%), Gaps = 25/188 (13%)

Query: 80  TSDRVLYVGNLDKSINEDLLKQ-YFQVGGQITDVKIMVDKKNN-----------NVNYAF 127
           T+   LY+G+LD + +++ ++Q +  +G    +V++M +  +N           N  Y F
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQGYCF 100

Query: 128 IEYLKS-HDANVALQTLNGIQIEG---KTVRINWAFQSQQTT------NSDDTFNLFVGD 177
           I++  S H AN  L+  NG+ I     + +++NWA  S           S +++++FVGD
Sbjct: 101 IDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVGD 158

Query: 178 LNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMP 236
           L  +V +  L   F +++ S   A ++ D  TG S+GYGFV F + ++ Q A++ MQG+ 
Sbjct: 159 LAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGVF 218

Query: 237 INGRAVRI 244
           +NGRA+++
Sbjct: 219 LNGRAIKV 226

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 302 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQ 361

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 362 GFPIANSRVRLSWGRS 377

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANV 138
           + ++  +++G L   + ED L+ YFQ  G I  VKI V K        F++Y+    A  
Sbjct: 301 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG-----CGFVQYVDRLSAEA 355

Query: 139 ALQTLNGIQIEGKTVRINWAFQSQQT 164
           A+  + G  I    VR++W   ++QT
Sbjct: 356 AIAGMQGFPIANSRVRLSWGRSAKQT 381

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPS--YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230
           +F+G L+  V ++ L   F  F +  YV+  V         +G GFV + D+  A+ A+ 
Sbjct: 307 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV--------GKGCGFVQYVDRLSAEAAIA 358

Query: 231 VMQGMPINGRAVRINWA 247
            MQG PI    VR++W 
Sbjct: 359 GMQGFPIANSRVRLSWG 375

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 96/175 (54%), Gaps = 5/175 (2%)

Query: 71  ASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIE 129
           + +T+G  E S   LYVG LD S+ E LL   F   G ++ +++  D     ++ YA++ 
Sbjct: 30  SESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVN 87

Query: 130 YLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSH 189
           +   +    A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+  +D++ L  
Sbjct: 88  FHDHNAGTTAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHD 146

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
            F  F + +   +  D +TG+SR +GFV F ++E A+EA++ + GM +NG  V +
Sbjct: 147 TFSVFGNILSCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    +D  ++ F   G IT   +  D +     + F+ +   + A  A++ LN
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282

Query: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189
                G+ + +  A          + Q  ++  +        NLFV +L+  +DDE L  
Sbjct: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +     VM D   G S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 250 RE 251
           +E
Sbjct: 402 KE 403

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S+ T     + +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F 
Sbjct: 30  SESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATK 249
           D      A+  +   PI GR  RI W+ +
Sbjct: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 99/178 (55%), Gaps = 17/178 (9%)

Query: 85  LYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVDKK---------NNNVNYAFIEYLKS- 133
           LY+G+LD S +E+ ++Q +  +G     +++M+             NN+ Y F+E+  + 
Sbjct: 47  LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEFPSTV 106

Query: 134 HDANVALQTLNGIQIEG---KTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHA 190
           H +N  L+  NG+QI     K +++NWA  S  +  + + +++FVGDL  +V +  L   
Sbjct: 107 HASNALLK--NGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQLFEL 164

Query: 191 F-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           F  +F S     +++D  TG S+GY FV F +    Q A+  MQG+ ++GRA+R++ A
Sbjct: 165 FISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIRVSNA 222

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 68  VVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAF 127
           V P  A     + ++  ++VG L   + ED L+ YFQ  G I  VKI V K        F
Sbjct: 268 VQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGK-----GCGF 322

Query: 128 IEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQ 163
           ++Y+    A  A+  + G  I    VR++W   ++Q
Sbjct: 323 VQYVDRISAETAIAKMQGFPIGNSRVRLSWGRSAKQ 358

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +     E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 280 PNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 339

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 340 GFPIGNSRVRLSWGRS 355

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 83/215 (38%), Gaps = 60/215 (27%)

Query: 85  LYVGNLDKSINED-LLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQT 142
           ++VG+L  ++ E  L + +       + VKI+ D+    +  YAF+++        AL  
Sbjct: 147 VFVGDLAPNVTESQLFELFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLE 206

Query: 143 LNGIQIEGKTVRIN---------------------------------------------W 157
           + GI + G+ +R++                                             +
Sbjct: 207 MQGIFLSGRAIRVSNAGHLQNSADGKSKATGAASASNANAVGGINTGNNSGLMSGSQFMY 266

Query: 158 AFQSQQTTNS---DDTFNLFVGDLNVDVDDETLSHAFDQFPS--YVQAHVMWDMQTGRSR 212
             Q Q   NS    +   +FVG L+  V ++ L   F  F +  YV+  V         +
Sbjct: 267 PVQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPV--------GK 318

Query: 213 GYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           G GFV + D+  A+ A+  MQG PI    VR++W 
Sbjct: 319 GCGFVQYVDRISAETAIAKMQGFPIGNSRVRLSWG 353

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 101/242 (41%), Gaps = 62/242 (25%)

Query: 70  PASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN--------- 120
           P S+T        R L++G+LD + +E  ++Q +   G+   VK++  KKN         
Sbjct: 16  PPSSTMQTSNEPPRTLWMGDLDPAFDESSIQQIWAALGKSVSVKLIRAKKNLLIPCSTSS 75

Query: 121 ----------------------------------NNVNYAFIEYLKSHDANVALQTLNGI 146
                                             ++  Y F+E+ K  DA  AL TLN  
Sbjct: 76  TFNAGEDASTAQLTDPQKIKINGVSFIDPNTTQLHHAGYCFVEFQKLEDAQWAL-TLNST 134

Query: 147 QIEG---------------KTVRINWAFQS--QQTTNSDDTFNLFVGDLNVDVDDETLSH 189
            +                 ++ R+NWA  +  Q    S   F+LFVGDL+    +  L  
Sbjct: 135 PLPNILSNSTHSQTNPTLQRSFRLNWASGATLQSAIPSTPEFSLFVGDLSPSATEAHLLS 194

Query: 190 AFDQ-FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWAT 248
            F + F S     VM D  TG SR +GFV FAD+++ + A+  M G+   GR +R+ +AT
Sbjct: 195 LFQKNFKSVKTVRVMTDPITGASRCFGFVRFADEQERRRALVEMNGVWCQGRCLRVAYAT 254

Query: 249 KR 250
            R
Sbjct: 255 PR 256

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P+ TT +IG +    +E  L  L   FG I +      KGC F+K+++   A   I  + 
Sbjct: 364 PKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQ 423

Query: 382 NFPFQGRNLRTGWGKE 397
            F   G  +R  WG+ 
Sbjct: 424 GFIVGGNPIRLSWGRS 439

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   I+E  L   F   G IT+V+I   K        F+++    DA  A+Q
Sbjct: 366 NTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGK-----GCGFVKFESRIDAEAAIQ 420

Query: 142 TLNGIQIEGKTVRINWAFQSQQTT 165
            + G  + G  +R++W   S + T
Sbjct: 421 GMQGFIVGGNPIRLSWGRSSGEKT 444

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 165 TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
           TN  +T  +F+G L   + +  L   F  F S     +       + +G GFV F  +  
Sbjct: 362 TNPKNT-TVFIGGLASQISEPQLYSLFLPFGSITNVRI------PQGKGCGFVKFESRID 414

Query: 225 AQEAMNVMQGMPINGRAVRINWA 247
           A+ A+  MQG  + G  +R++W 
Sbjct: 415 AEAAIQGMQGFIVGGNPIRLSWG 437

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 94/180 (52%), Gaps = 13/180 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            L+VG L  S++++ LK  F  +GG ++   IM    + +  Y ++++     A  AL+ 
Sbjct: 150 TLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKE 209

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           + G +I+G+ + ++ +        S+D            +  LF+G+L+ D D + L   
Sbjct: 210 MQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSFDADRDNLYEI 269

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F +F   +   +    +T + +G+G+V + + E A++A++ +QG  IN R VR++++T R
Sbjct: 270 FGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFSTPR 329

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 105/204 (51%), Gaps = 14/204 (6%)

Query: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK 118
           + A+++ESS           E +   ++VG L  SI+++ LK  F+  G +   +++ +K
Sbjct: 139 RKADDEESSESKKQKPDESEEPA--TIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEK 196

Query: 119 -KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQT-----------TN 166
             + +  Y ++++     A  A++ + G +I+G+ +  + +     +           T 
Sbjct: 197 GTDRSRGYGYVDFKNKTFAEKAIKEMQGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTP 256

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S+ +  LF+G+L+ D D + +   F ++   +   +    +T + +G+G+V + D E A+
Sbjct: 257 SEPSETLFLGNLSFDADRDNIYEVFSKYGEIISVRIPTHPETEQPKGFGYVQYGDVESAK 316

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
           +A++ +QG  IN R VR++++T R
Sbjct: 317 KALDALQGEYINNRPVRLDFSTPR 340

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 89/161 (55%), Gaps = 3/161 (1%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           LYVG LD S+ E LL   F   G ++ +++  D     ++ YA++ +   +    A++ L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N   I+G+  RI W+ Q   +     + N+F+ +L+  +D++ L   F  F + +   + 
Sbjct: 102 NYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
            D +TG+SR +GFV F ++E A+EA++ + GM +NG  V +
Sbjct: 161 TD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +YV N+D    ++  ++ F   G IT   +  D +     + F+ +   + A  A + LN
Sbjct: 223 VYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGKLRGFGFVNFEDHNAALKACEELN 282

Query: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189
               +G+ + +  A          + Q  ++  +        NLFV +L+  VDD+ L  
Sbjct: 283 DTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSVDDQKLEE 342

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F  F +     VM D + G S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 250 RE 251
           +E
Sbjct: 402 KE 403

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F D    + A+  +
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 233 QGMPINGRAVRINWATK 249
              PI GR  RI W+ +
Sbjct: 102 NYTPIKGRPCRIMWSQR 118

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 108/201 (53%), Gaps = 15/201 (7%)

Query: 56  AGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQ-YFQVGGQITDVKI 114
           A +QS  + +S   PA  +     +    LY+G+LD S +E+ ++  +  +G     VK+
Sbjct: 20  APQQSIHHTQSHSSPAEQS----ASRSNSLYMGDLDPSWDENAIRAVWANLGEPNVQVKL 75

Query: 115 MVDKKNNNVN--YAFIEYLKSHDANVALQTLNGIQI---EGKTVRINWAFQSQQTTNSDD 169
           + +  +   +  Y F+E+    +A+ AL   NG+ I     + +++NWA      T   +
Sbjct: 76  IRNSGSTGGSSGYCFVEFPSHLNASNALLK-NGLLIPNARNRYLKLNWA---SFATAPGN 131

Query: 170 TFNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
             ++FVGD+  +V +  L   F  ++ S + A +++D  TG S+GYGFV F  + + Q A
Sbjct: 132 EHSVFVGDIAPNVSEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRA 191

Query: 229 MNVMQGMPINGRAVRINWATK 249
           +  MQG+ +NGRAVR++  +K
Sbjct: 192 LLEMQGVFLNGRAVRVSTTSK 212

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   ++ED L+ YFQ  G I  VKI V K        F++Y+    A  A+ 
Sbjct: 272 NTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGK-----GCGFVQYVDRISAETAIA 326

Query: 142 TLNGIQIEGKTVRINWAFQSQQ 163
            + G  I    +R++W   ++Q
Sbjct: 327 KMQGYPIGNSRIRLSWGRSAKQ 348

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    +E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 329

Query: 382 NFPFQGRNLRTGWGKE 397
            +P     +R  WG+ 
Sbjct: 330 GYPIGNSRIRLSWGRS 345

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 90/228 (39%), Gaps = 63/228 (27%)

Query: 73  ATQGGRETSDRVLYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEY 130
           AT  G E S   ++VG++  +++E  L + +        + KI+ D+    +  Y F+++
Sbjct: 126 ATAPGNEHS---VFVGDIAPNVSEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKF 182

Query: 131 LKSHDANVALQTLNGIQIEGKTVRI----------------------------------- 155
            +  +   AL  + G+ + G+ VR+                                   
Sbjct: 183 GQESEQQRALLEMQGVFLNGRAVRVSTTSKNRSKFQQPLQQQQQPYMQQQQPYVQQQARA 242

Query: 156 ----NWAFQSQ------------QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQ 199
               N   QSQ            Q T+ ++T  +F+G L+  V ++ L   F  F S V 
Sbjct: 243 PAFNNGNVQSQFIYPVQQQPTLTQYTDPNNT-TVFIGGLSSLVSEDELRAYFQPFGSIVY 301

Query: 200 AHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
             +         +G GFV + D+  A+ A+  MQG PI    +R++W 
Sbjct: 302 VKIP------VGKGCGFVQYVDRISAETAIAKMQGYPIGNSRIRLSWG 343

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 108/206 (52%), Gaps = 18/206 (8%)

Query: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK 118
           + AE++E    P  A   G   +   ++VG L  SI+++ LKQ F+  G +   ++M ++
Sbjct: 155 RKAEDEEEESSPKKAKTDGEPAT---VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYER 211

Query: 119 -KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTN----------- 166
             + +  Y ++++     A  A++ ++G +I+G+ + ++ +  S+ T N           
Sbjct: 212 GTDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMS-TSKPTVNPREDRQKRFGD 270

Query: 167 --SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
             S+ +  LF+G+L+ + D + +   F +F   +   +    +T + +G+G+V +   + 
Sbjct: 271 IPSEPSDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDD 330

Query: 225 AQEAMNVMQGMPINGRAVRINWATKR 250
           A++A+  +QG  I+ R VR++++T +
Sbjct: 331 AKKALEALQGEYIDNRPVRLDYSTPK 356

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 96/179 (53%), Gaps = 17/179 (9%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN--------NVNYAFIEYLKSHDA 136
           LY+G+L+    E+ +K  + + G+  +V++ + K +N        N  Y F+E+     A
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGE-PNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAA 116

Query: 137 NVALQTLNGIQI---EGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAF-D 192
           + AL   +G+++       +++NWA      T     F LFVGDL  +V +  L   F  
Sbjct: 117 SNALMK-SGLRVPMDSNYALKLNWA---SFATAPGSEFTLFVGDLAPNVTEAQLFELFIS 172

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           ++ S + A +++D  TG S+GYGFV F ++ + Q A+  MQG  +NGRA+R+   +K +
Sbjct: 173 RYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSKNK 231

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   I ED L+ YFQ  GQI  VKI V K        F++Y+    A  A+ 
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGK-----GCGFVQYVDRISAETAIS 369

Query: 142 TLNGIQIEGKTVRINWA 158
            + G  I    +R++W 
Sbjct: 370 KMQGFPIGNSRIRLSWG 386

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 313 PNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQ 372

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 373 GFPIGNSRIRLSWGRS 388

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           Q T+ ++T  +F+G L+  + ++ L   F  F   V   +         +G GFV + D+
Sbjct: 309 QFTDPNNT-TVFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDR 361

Query: 223 EQAQEAMNVMQGMPINGRAVRINWA 247
             A+ A++ MQG PI    +R++W 
Sbjct: 362 ISAETAISKMQGFPIGNSRIRLSWG 386

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 96/179 (53%), Gaps = 12/179 (6%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK+ F+ +GG ++   IM    + +  Y ++++     A  A++ 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKE 222

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD-----------TFNLFVGDLNVDVDDETLSHAF 191
           + G +I+G+ + ++ +       N+D            +  LF+G+L+ + D + +S  F
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 192 DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            ++   +   +    +T + +G+G+V + + E A++A+  +QG  I+ R VR++++T R
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPR 341

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 97/178 (54%), Gaps = 11/178 (6%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK+ F+  G +   +++ ++  + +  Y ++++     A  A+Q 
Sbjct: 172 TIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQE 231

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN----------SDDTFNLFVGDLNVDVDDETLSHAFD 192
           + G +I+G+ + ++ +       N          S+ +  LF+G+L+ + D + +   F 
Sbjct: 232 MQGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFS 291

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           ++   +   +    +T + +G+G+V F++ E A++A+  +QG  I+ RAVR++++T R
Sbjct: 292 KYGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYSTPR 349

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 53/88 (60%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           Q T+  +   +FVG L+  +DDE L   F+     V A V+++  T RSRGYG+V F D+
Sbjct: 163 QKTSGGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDK 222

Query: 223 EQAQEAMNVMQGMPINGRAVRINWATKR 250
             A++A+  MQG  I+GR + ++ +T +
Sbjct: 223 SYAEKAIQEMQGKEIDGRPINVDMSTSK 250

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 101/189 (53%), Gaps = 26/189 (13%)

Query: 80  TSDRVLYVGNLDKSINEDLLKQYFQVGGQIT-DVKIMVDKK-----------NNNVNYAF 127
           T+   LY+G+LD + +++ ++Q +   G+   +V++M +              NN  Y F
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCF 110

Query: 128 IEYLKS-HDANVALQTLNGIQIEG---KTVRINWA-------FQSQQTTNSDDTFNLFVG 176
           +++  S H AN  L+  NG+ I     K +++NWA         S     S +  ++FVG
Sbjct: 111 VDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVG 168

Query: 177 DLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGM 235
           DL  +V +  L   F +++ S   A ++ D  TG S+GYGFV F + ++ Q A++ MQG+
Sbjct: 169 DLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGV 228

Query: 236 PINGRAVRI 244
            +NGRA+++
Sbjct: 229 FLNGRAIKV 237

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   + ED L+ YFQ  G I  VKI V K        F++Y+    A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKC-----CGFVQYVDRLSAEAAIA 366

Query: 142 TLNGIQIEGKTVRINWAFQSQQT 164
            + G  I    VR++W   ++QT
Sbjct: 367 GMQGFPIANSRVRLSWGRSAKQT 389

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCC-FIKYDTHEQAAVCIVAL 380
           P  TT +IG +    TE +L    Q FG I+ +   P   CC F++Y     A   I  +
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIV-YVKIPVGKCCGFVQYVDRLSAEAAIAGM 368

Query: 381 ANFPFQGRNLRTGWGKE 397
             FP     +R  WG+ 
Sbjct: 369 QGFPIANSRVRLSWGRS 385

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+  V ++ L   F  F + V   +      G+    GFV + D+  A+ A+  M
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPFGTIVYVKI----PVGKC--CGFVQYVDRLSAEAAIAGM 368

Query: 233 QGMPINGRAVRINWA 247
           QG PI    VR++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 98/238 (41%), Gaps = 60/238 (25%)

Query: 70  PASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN--------- 120
           P S T    +   R L++G+LD S +E  ++Q +   G    VK++  KKN         
Sbjct: 9   PPSTTIQTSDEPPRTLWMGDLDPSFDETTIQQIWMTLGHQVQVKLIRAKKNLLIPCSTSS 68

Query: 121 ----------------------------NNVNYAFIEYLKSHDANVALQTLNGIQIEG-- 150
                                       ++  Y F+++    +A   LQ LN   +    
Sbjct: 69  TLASSQHVEDERIQINGVSFIDPNTTQLHHAGYCFVQFPSLQEAQAGLQ-LNSTPLPNLI 127

Query: 151 -------------KTVRINWAFQSQQTTNSD----DTFNLFVGDLNVDVDDETLSHAFD- 192
                        +  R+NWA  S  T  SD      F+LFVGDL+    +  L   F  
Sbjct: 128 SSTTHNPTNPTAKRNFRLNWA--SGATLQSDIPTTPEFSLFVGDLSPTATEAHLLSLFQT 185

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +F S     VM D  TG SR +GFV FAD+++ + A+  M G+   GR +R+ +AT R
Sbjct: 186 KFKSVKTVRVMTDPITGASRCFGFVRFADEQERRRALVEMNGIWCQGRQLRVAYATPR 243

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG + +  TE+ L  L   FG IL     P KGC F+K++    A   I  + 
Sbjct: 395 PSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQ 454

Query: 382 NFPFQGRNLRTGWGK 396
            F      +R  WG+
Sbjct: 455 GFIVGNSAIRLSWGR 469

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 76  GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHD 135
           G  + S+  +++G L+  I E  L+  F   G I  VK+   K        F+++    D
Sbjct: 391 GYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGK-----GCGFVKFEHRLD 445

Query: 136 ANVALQTLNGIQIEGKTVRINWA 158
           A  A+Q + G  +    +R++W 
Sbjct: 446 AEAAIQGMQGFIVGNSAIRLSWG 468

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G LN  + +  L   F  F + +   V         +G GFV F  +  A+ A+  M
Sbjct: 400 VFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDAEAAIQGM 453

Query: 233 QGMPINGRAVRINWA 247
           QG  +   A+R++W 
Sbjct: 454 QGFIVGNSAIRLSWG 468

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 92/180 (51%), Gaps = 17/180 (9%)

Query: 85  LYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQT 142
           +Y+G LD +  E  +K  ++ +G ++ +VK++ +K    N  Y FIE+     A+ AL  
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQHASNALLK 131

Query: 143 LNGIQIE---GKTVRINWAF----------QSQQTTNSDDTFNLFVGDLNVDVDDETLSH 189
            NGI I     K V++NW             S Q  ++   +++FVGDL  +V +  L  
Sbjct: 132 -NGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLFD 190

Query: 190 AF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWAT 248
            F  +F S   A ++ D  T  S+ YGFV F D    Q A+  MQG+ +NGRA++I   T
Sbjct: 191 LFISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKIGTTT 250

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +FVG L+  V +E L H F  F + +   +         +G GFV + D+  A+ A+  M
Sbjct: 328 VFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPI------GKGCGFVQYFDRISAETAILRM 381

Query: 233 QGMPINGRAVRINWA 247
           QG PI    +R++W 
Sbjct: 382 QGFPIGNSRIRLSWG 396

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +    TE  L    Q FG I+       KGC F++Y     A   I+ + 
Sbjct: 323 PNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQ 382

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 383 GFPIGNSRIRLSWGRS 398

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  ++VG L   + E+ L+  FQ  G I  VKI + K        F++Y     A  A+
Sbjct: 324 NNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGK-----GCGFVQYFDRISAETAI 378

Query: 141 QTLNGIQIEGKTVRINWAFQSQQ 163
             + G  I    +R++W   S+Q
Sbjct: 379 LRMQGFPIGNSRIRLSWGRSSRQ 401

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 96/179 (53%), Gaps = 12/179 (6%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK  F+  G +   +++ ++  + +  Y ++++     A  A++ 
Sbjct: 166 TIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKE 225

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD-----------TFNLFVGDLNVDVDDETLSHAF 191
           ++G +I+G+ +  + +       N+D            +  LF+G+L+ + D + +S  F
Sbjct: 226 MHGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMF 285

Query: 192 DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            +F   V   +    +T + +G+G+V + + E A++A++ +QG  I+ R VR++++T R
Sbjct: 286 SKFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFSTPR 344

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 86/167 (51%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED+L+QYF   G + DVKIM D  N  +  + F+ +  S   +  ++T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ S + A +M
Sbjct: 212 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLM 266

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A +R
Sbjct: 267 LDKDTGRSRGFGFVTY-DSPDAVDKVCQNKFIEFKGKTIEIKRAEQR 312

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D+  +F+G LN D  ++ L   F+++ + +   +M D   G+SRG+GF++F +     
Sbjct: 146 SKDSCKMFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVD 205

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 206 EVVKTQH--ILDGKVIDPKRAIPRE 228

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 96/236 (40%), Gaps = 57/236 (24%)

Query: 70  PASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN--------- 120
           P S T        R L++G+LD S +E  ++  +   G    VK++  KKN         
Sbjct: 9   PPSTTVQTSSEPPRTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSS 68

Query: 121 ---------------------------NNVNYAFIEYLKSHDANVALQ------------ 141
                                      ++  Y F+++    +A   LQ            
Sbjct: 69  TLSASHVDEERIQINGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQLNATPLPNVVSP 128

Query: 142 -TLNGIQIEGK-TVRINWAFQSQQTTNSD----DTFNLFVGDLNVDVDDETLSHAFD-QF 194
            T N     GK   R+NWA  S  T  SD      F+LFVGDL+    +  L   F  +F
Sbjct: 129 TTRNPTNPTGKRNFRLNWA--SGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKF 186

Query: 195 PSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            S     VM D  TG SR +GFV FAD+++ + A+  M G+   GR +R+ +AT R
Sbjct: 187 KSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPR 242

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%)

Query: 325 TTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFP 384
           TT +IG + +  +E  L  L   FG IL     P +GC F++++    A   I  +  F 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 385 FQGRNLRTGWGK 396
             G  +R  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 8/104 (7%)

Query: 55  AAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKI 114
           AAG     N   S+  A+  Q   +T++  +++G L   I+E  L   F   G I  VK+
Sbjct: 301 AAGSLVGSN---SLPLAAPRQLPADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV 357

Query: 115 MVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
              +        F+ +    DA  A+Q + G  + G  +R++W 
Sbjct: 358 PPGR-----GCGFVRFENRMDAEAAIQGMQGFIVGGNAIRLSWG 396

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 169 DTFN--LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           DT N  +F+G L+  + +  L   F  F + +   V         RG GFV F ++  A+
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAE 375

Query: 227 EAMNVMQGMPINGRAVRINWA 247
            A+  MQG  + G A+R++W 
Sbjct: 376 AAIQGMQGFIVGGNAIRLSWG 396

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 101/196 (51%), Gaps = 29/196 (14%)

Query: 74  TQGGRETSDRVLYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVD---KKNN-------- 121
           TQG     + VLY+G LD S NE ++K  + +VG   T+V++M +   + NN        
Sbjct: 37  TQG---KGNNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKS 93

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQI---EGKTVRINW---------AFQSQQTTNSDD 169
           N+ Y F+E+     A+ A+   NG  I   +G+  ++NW         A  ++      +
Sbjct: 94  NLGYCFVEFSTHETASNAIMK-NGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSN 152

Query: 170 TFNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
            +++FVGDL  +V +  L + F   + S + + ++ D  T  S+GYGF+ F DQ    +A
Sbjct: 153 DYSVFVGDLGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDA 212

Query: 229 MNVMQGMPINGRAVRI 244
           ++ MQ   +NGR +++
Sbjct: 213 LSKMQNKILNGRGIKV 228

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  L V N  K I+ +  K YF   G + ++      K+ N N  F+ Y+    A  +++
Sbjct: 300 NTTLVVSNASKDISMNEFKSYFLPFGNLIEIS-----KDPNTNILFVTYVDRICAENSMR 354

Query: 142 TLNGIQIEGKTVRINWA 158
            L G  I G  ++I W 
Sbjct: 355 ILQGKVIRGNKIQIAWG 371

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 216 FVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           FV++ D+  A+ +M ++QG  I G  ++I W 
Sbjct: 340 FVTYVDRICAENSMRILQGKVIRGNKIQIAWG 371

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 96/180 (53%), Gaps = 13/180 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK+ F+ +GG I+   I     + +  Y ++++     A  A+Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           + G +I+G+ +  + +     + N++D            +  LF+G+L+ + D + +   
Sbjct: 208 MQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIFEL 267

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F +    V   +    +T + +G+G+V F++ E A++A++ +QG  I+ R VR+++++ R
Sbjct: 268 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 327

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 54/91 (59%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           + Q+   S++   +FVG L+  +DDE L   F+     + A V+++  T RSRGYG+V F
Sbjct: 136 KKQKNEESEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDF 195

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            ++  A++A+  MQG  I+GR +  + +T +
Sbjct: 196 ENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 226

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 94/180 (52%), Gaps = 13/180 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK  F+ +GG I+   I       +  Y ++++     A  A++ 
Sbjct: 212 TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKAIKE 271

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           + G +I+G+ + ++ +     +   +D            +  LF+G+L+ + D + +   
Sbjct: 272 MQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRDNIFEL 331

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F  + S +   +    +T + +G+G+V +A  E+AQ+A++ +QG  I+ R VR+++++ R
Sbjct: 332 FKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDFSSPR 391

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 73.2 bits (178), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 91/189 (48%), Gaps = 12/189 (6%)

Query: 72  SATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEY 130
           S +  G +  D  +YVGN+D SI ++LL + F     I  +    DK    +  YAFI++
Sbjct: 2   SGSGSGFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDF 61

Query: 131 LKSHDANVALQTL-NGIQIEGKTVRI---NWAFQSQQTTNSDDTFN------LFVGDLNV 180
               DAN A+Q   N +Q+  + +++   N    S+ +TN     +      +FV +L+ 
Sbjct: 62  YTEEDANYAIQAFNNNVQLNNRVLKVRKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDS 121

Query: 181 DVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240
            VD   LS  F +F S  +   ++ +  G  R   +V F D E+A EA+  + G  +  +
Sbjct: 122 SVDVAYLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNK 180

Query: 241 AVRINWATK 249
            + I +A K
Sbjct: 181 RINIEYAFK 189

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 47/102 (46%)

Query: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK 118
           +   N  SS    + +Q    T    ++V NLD S++   L + F+  G +     +   
Sbjct: 88  RKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDSSVDVAYLSKLFKKFGSLARESEIFHL 147

Query: 119 KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQ 160
            N  +  A++ +     A+ A+++L+G  +  K + I +AF+
Sbjct: 148 SNGELRCAYVYFKDYEKADEAIKSLDGQLVTNKRINIEYAFK 189

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 102/193 (52%), Gaps = 30/193 (15%)

Query: 80  TSDRVLYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVDKK-----------NNNVNYAF 127
           T+   LY+G+LD + +++ + Q +  +G    +V++M +              NN  Y F
Sbjct: 54  TAGNQLYMGDLDPTWDKNTISQIWGSLGEANINVRMMWNNPSNSSSRPSMGPKNNQGYCF 113

Query: 128 IEYLKS-HDANVALQTLNGIQIEG---KTVRINWA-----------FQSQQTTNSDDTFN 172
           +++  S H AN  L+  NG+ I     K +++NWA             S   + S + ++
Sbjct: 114 VDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNGNNGGNNSISNSKSGNNYS 171

Query: 173 LFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +FVGDL  +V +  L   F  ++ S   A ++ D  TG S+GYGFV F++ ++ Q A++ 
Sbjct: 172 IFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGYGFVKFSNADEQQLALSE 231

Query: 232 MQGMPINGRAVRI 244
           MQG+ +NGRA+++
Sbjct: 232 MQGVFLNGRAIKV 244

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 320 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQ 379

Query: 382 NFPFQGRNLRTGWGKE 397
            FP     +R  WG+ 
Sbjct: 380 GFPIANSRVRLSWGRS 395

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  +++G L   + ED L+ YFQ  G I  VKI V K        F++Y+    A  A+
Sbjct: 321 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG-----CGFVQYVDRLSAETAI 375

Query: 141 QTLNGIQIEGKTVRINWAFQSQQT 164
             + G  I    VR++W   ++QT
Sbjct: 376 AGMQGFPIANSRVRLSWGRSAKQT 399

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPS--YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230
           +F+G L+  V ++ L   F  F +  YV+  V         +G GFV + D+  A+ A+ 
Sbjct: 325 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV--------GKGCGFVQYVDRLSAETAIA 376

Query: 231 VMQGMPINGRAVRINWA 247
            MQG PI    VR++W 
Sbjct: 377 GMQGFPIANSRVRLSWG 393

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 85/167 (50%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED LK YF   GQ+TD+KIM D     +  + F+ + ++   +  ++T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 271 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 325

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GF+++ D   A + +   + +   G+ + I  A  R
Sbjct: 326 LDKDTGRSRGFGFITY-DTPDAVDRVCENKFIEFKGKRIEIKRAEPR 371

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++ L   F ++       +M D  TGRSRG+GF++FA+     
Sbjct: 205 SRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVD 264

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 265 EVVKTQH--ILDGKVIDPKRAIPRE 287

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 85/167 (50%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED LK YF   GQ+TD+KIM D     +  + F+ + ++   +  ++T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 270 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 324

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GF+++ D   A + +   + +   G+ + I  A  R
Sbjct: 325 LDKDTGRSRGFGFITY-DTPDAVDRVCENKFIEFKGKRIEIKRAEPR 370

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 161 SQQTTN----SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGF 216
           ++Q TN    S D   +F+G LN +  ++ L   F ++       +M D  TGRSRG+GF
Sbjct: 194 AEQRTNKADLSRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGF 253

Query: 217 VSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           ++FA+     E +       ++G+ +    A  RE
Sbjct: 254 LTFAEASSVDEVVKTQH--ILDGKVIDPKRAIPRE 286

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 106/206 (51%), Gaps = 17/206 (8%)

Query: 58  EQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD 117
           ++SAE+++ +V     T G   T    ++VG L  S++++ LK  F   G +   +++ +
Sbjct: 146 KRSAESEDDAVAKKQKTDGQPAT----IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE 201

Query: 118 K-KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDD------- 169
           +  + +  Y ++++     A  A++ ++G +I+G+ +  + +     +   +D       
Sbjct: 202 RGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGD 261

Query: 170 -----TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
                +  LF+G+L+ + D + L   F +  + +   +    ++ + +G+G+V +   E+
Sbjct: 262 TPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEE 321

Query: 225 AQEAMNVMQGMPINGRAVRINWATKR 250
           AQ A++ +QG  I+ R VRI++++ R
Sbjct: 322 AQAALDALQGEYIDNRPVRIDFSSPR 347

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 94/180 (52%), Gaps = 13/180 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK+ F+ +GG I+   I     + +  Y ++++     A  A+Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           + G +I+G+ +  + +       N++D            +  LF+G+L+ + D +T+   
Sbjct: 202 MQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFEL 261

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F +    V   +    +T + +G+G+V F+  E +++A+  +QG  I+ R VR+++++ R
Sbjct: 262 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSSPR 321

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           + Q+   S +   +FVG L+  +DDE L   F+     + A V+ +  T RSRGYG+V F
Sbjct: 130 KKQKNEESGEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDF 189

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            ++  A++A+  MQG  I+GR +  + +T +
Sbjct: 190 ENKSYAEKAIQEMQGKEIDGRPINCDLSTSK 220

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 92/180 (51%), Gaps = 13/180 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK  F  +GG ++   I     + +  Y ++++     A  A++ 
Sbjct: 188 TIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           ++G +I+G+ +  + +         DD            +  LF+G+L+ + D + +   
Sbjct: 248 MHGKEIDGRPINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIYEM 307

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F +F   V   +    +T + +G+G+V + + + A++A++ +QG  I+ R VR++++T R
Sbjct: 308 FSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYSTPR 367

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           + Q+   S +   +FVG L+  +DDE L + FD     V A V+++  T RSRGYG+V F
Sbjct: 176 KKQKVELSGEPATIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDF 235

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D+  A++A+  M G  I+GR +  + +T +
Sbjct: 236 EDKSYAEKAVKEMHGKEIDGRPINCDLSTSK 266

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 95/178 (53%), Gaps = 11/178 (6%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK+ F+  G +   +++ ++  + +  Y ++++     A  A+Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN----------SDDTFNLFVGDLNVDVDDETLSHAFD 192
           + G +I+G+ +  + +       N          S+ +  LF+G+L+ + D + +   F 
Sbjct: 229 MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFA 288

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +    V   +    +T + +G+G+V F++ E A++A++ +QG  I+ R VR+++++ R
Sbjct: 289 KHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 346

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 54/91 (59%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           + Q+   +++   +FVG L+  +DDE L   F+     + A V+++  T RSRGYG+V F
Sbjct: 157 KKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDF 216

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            ++  A++A+  MQG  I+GR +  + +T +
Sbjct: 217 ENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 247

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 82/169 (48%), Gaps = 11/169 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           +++G L+    E+ L+ YF   G +TD+KIM D    ++    +   E+  S D  V  Q
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    +   ++    D T  +FVG +  DV  +     F Q+ + + A 
Sbjct: 156 HI----LDGKVIDPKRSIPREE---QDKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDAQ 208

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +M D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 209 LMLDKDTGRSRGFGFVTY-DSPDAVDRVCQSKYIEFKGKQIEIKRAQPR 256

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  +ETL   F+++       +M D  TGRSRG+GF++F       
Sbjct: 90  SKDNCKMFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVD 149

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    +  RE
Sbjct: 150 EVVKTQH--ILDGKVIDPKRSIPRE 172

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 84/167 (50%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L+ YF   G +TD+KIM D     +  + F+ + +S   +  ++T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 244 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDAQLM 298

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GF+++ D   A + +   + +   G+ + I  A  R
Sbjct: 299 LDKDTGRSRGFGFITY-DTPDAVDRVCQNKFIEFKGKRIEIKRAEPR 344

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++ L   F ++ +     +M D  TGRSRG+GF++FA+     
Sbjct: 178 SRDMCKMFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVD 237

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 238 EVVKTQH--ILDGKVIDPKRAIPRE 260

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 89/181 (49%), Gaps = 13/181 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK  F  +GG ++   I     + +  Y ++++   H A  A++ 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           ++G +I+G+ +  + +         DD            +  LF+G+L+ + D + L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F Q    +   +    +T + +G+G+V +   + A++A   +QG  I+ R VR++++  R
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPR 353

Query: 251 E 251
           +
Sbjct: 354 Q 354

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 95/179 (53%), Gaps = 14/179 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK  F   G +   ++M+++  + +  Y ++++     A  A++ 
Sbjct: 158 TIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKE 217

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN-------------SDDTFNLFVGDLNVDVDDETLSH 189
           ++G +I+G+ +  + +      +N             S+ +  LF+G+L+ + D +++  
Sbjct: 218 MHGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWE 277

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWAT 248
            F +F   V   +    +T + +G+G+V + + + A++A+  +QG  I+ R VR++++T
Sbjct: 278 MFSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYST 336

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +FVG L+  +DDE L + FD     + A VM +  T RSRGYG+V F+D+  A++A+  M
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 233 QGMPINGRAVRINWATKR 250
            G  I+GR +  + +T +
Sbjct: 219 HGKEIDGREINCDMSTSK 236

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA  AL +LN   +                 +T R+NWA  +  Q +  S
Sbjct: 130 YCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 188

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F  +F S     VM D  TG SR +GFV F D+++ +
Sbjct: 189 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERR 248

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G    GRA+R+ +AT R
Sbjct: 249 RALIEMSGKWFQGRALRVAYATPR 272

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 357 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 382 NFPFQGRNLRTGWGK 396
            F   G  +R  WG+
Sbjct: 417 GFIVGGSPIRLSWGR 431

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 153 VRINWAFQSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRS 211
           +R+N +  S  T N+D T   +FVG L     +  L   F  F        + +++    
Sbjct: 342 MRVNDSLPSN-TYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPF------GPILNVRIPNG 394

Query: 212 RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           +  GFV F  +  A+ ++  +QG  + G  +R++W 
Sbjct: 395 KNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 430

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 81/169 (47%), Gaps = 11/169 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           L++G L+    ED LK YF   G + D+KIM D    ++    +   E   S D  V  Q
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A 
Sbjct: 255 HI----LDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 307

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +M D  TGRSRG+GF+++ D  +A + +   + +   G+ + I  A  R
Sbjct: 308 LMLDKDTGRSRGFGFITY-DSSEAVDRVCQNKYIDFKGKQIEIKRAAPR 355

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           S +   LF+G LN +  ++ L   F ++ + V   +M D  TGRSRG+GF++F
Sbjct: 189 SKECCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTF 241

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 95/181 (52%), Gaps = 14/181 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK+ F+ +GG I+   I+    + +  Y ++++     A  A+Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN-------------SDDTFNLFVGDLNVDVDDETLSH 189
           + G +I+G+ +  + +       N             S+ +  LF+G+L+ + D +T+  
Sbjct: 198 MQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFE 257

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F +    V   +    +T + +G+G+V + + + A++A++ +QG  I+ R VR+++++ 
Sbjct: 258 MFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYSSP 317

Query: 250 R 250
           R
Sbjct: 318 R 318

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           + Q+   S +   +FVG L+  +DDE L   F+     + A V+ +  T RSRGYG+V F
Sbjct: 126 KKQKNEESQEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDF 185

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            +Q  A++A+  MQG  I+GR +  + +T +
Sbjct: 186 ENQSYAEKAIQEMQGKEIDGRPINCDISTSK 216

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 90/181 (49%), Gaps = 13/181 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  SI+++ LK  F+  G +   ++M ++  + +  Y ++++     A  A++ 
Sbjct: 197 TIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKE 256

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           ++G +I+G+ +  + +         DD            +  LF+G+L+ + D + L   
Sbjct: 257 MHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEI 316

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F ++   V   +    +T + +G+G+V +   E A +A   +QG  IN R VR++++  +
Sbjct: 317 FGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYSIPK 376

Query: 251 E 251
           +
Sbjct: 377 Q 377

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNN-VNYAFIEYLKSHDAN 137
           E SD  L++GNL    + D L + F   G+I  V+I    +      + +++Y    DA 
Sbjct: 294 EPSD-TLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDAT 352

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNS 167
            A + L G  I  + VR++++   Q   N+
Sbjct: 353 KAFEGLQGEYINNRPVRLDYSIPKQNFGNN 382

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (66%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDL+  V +ETL   F +FPS+V A V  D  T +S G+G+++F D+E+A+ AM  +
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 233 QGMPINGRAVRI 244
               +NGR +RI
Sbjct: 153 NYTDVNGREIRI 164

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 71/178 (39%), Gaps = 6/178 (3%)

Query: 73  ATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLK 132
           A++  + +S   +++ NL      D +  +F   G I  + +    K   + +AF+ Y  
Sbjct: 293 ASKNNQSSSQNSIFIKNLPIITTRDDVLNFFSEVGPIKSIYLSNATKVKYL-WAFVTYKS 351

Query: 133 SHDANVALQTLNGIQIEGKTVRINWAFQSQQTTN---SDDTFNLFVGDLNVDVDDETLSH 189
           + D+  A++  N     GK + ++ A   ++      S     LF+ +L+   + E L +
Sbjct: 352 NEDSEKAIKRYNNFYFRGKKLLVSRAQDKEERAKFIESQKMSTLFLENLSAVCNKEFLKY 411

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGY-GFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
              Q  +     +  D     S  Y G + F + E A    N +    + G  V  +W
Sbjct: 412 LCHQ-ENIRPFKIQIDGYNESSATYSGHIKFRNFEDATRIFNFLNNRLVGGSIVMTSW 468

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 85/167 (50%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G + D+KIM D  +  +  + F+ + +    +  ++T 
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    +   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 219 H--ILDGKVIDPKRSIPREE---QDKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDAQLM 273

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GFV++ D  +A + +   + +   G+ + I  A  R
Sbjct: 274 LDKDTGRSRGFGFVTY-DSPEAVDRVCQNKYIDFKGKQIEIKRAEPR 319

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 83/167 (49%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L+ YF   G++ D+KIM D     +  + F+ +  S   +  ++T 
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 221 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLM 275

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 276 LDKDTGRSRGFGFVTY-DSPDAVDRVCQNKFIDFKGKKIEIKRAEPR 321

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++TL   F ++   +   +M D  TGRSRG+GF++F       
Sbjct: 155 SRDICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVD 214

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 215 EVVKTQH--ILDGKVIDPKRAIPRE 237

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 101/240 (42%), Gaps = 59/240 (24%)

Query: 69  VPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-------- 120
           +P  AT    +   R L++G+LD + +E  +K+ ++  G+   +K++  KKN        
Sbjct: 23  LPPFATVSTSDEPPRTLWMGDLDPTFDELTIKEIWKRLGKNVSIKLVRAKKNLLIPCSSF 82

Query: 121 --------------------------------NNVNYAFIEYLKSHDANVALQTLNGIQI 148
                                           ++  Y FIE+    DA   L +LN   I
Sbjct: 83  TNNSGGNSKNETEESSITINGISFIDPMTTQLHHAGYCFIEFDSLKDAQFGL-SLNSKPI 141

Query: 149 EG---------------KTVRINWAFQS--QQTTNSDDTFNLFVGDLNVDVDDETLSHAF 191
                            +T R+NWA  +  Q +  +   ++LFVGDL+    +  L   F
Sbjct: 142 PNFKSISTELETNPSGQRTFRLNWASGATLQSSIPTTPEYSLFVGDLSPMTTEADLLKLF 201

Query: 192 DQ-FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            + F S     VM D  TG SR +GF+  +D+ + +EA++ M G  ++GR +R+  A  R
Sbjct: 202 QKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDKMNGTLLHGRQLRVALANPR 261

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 81/220 (36%), Gaps = 59/220 (26%)

Query: 80  TSDRVLYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           T +  L+VG+L     E DLLK + +    +  V++M D     +  + FI      +  
Sbjct: 178 TPEYSLFVGDLSPMTTEADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFERE 237

Query: 138 VALQTLNGIQIEGKTVRINWA----------------------------------FQSQQ 163
            AL  +NG  + G+ +R+  A                                  F  + 
Sbjct: 238 EALDKMNGTLLHGRQLRVALANPRNANLQEQAPSQVVEDKKKHNEPLLLETAKKLFSKEL 297

Query: 164 TTNSDDTFN-----------------LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDM 206
             NS    N                 +FVG+LN  + ++ L   F+ F +  +  +    
Sbjct: 298 LKNSSSNVNDVKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKI---- 353

Query: 207 QTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
                +  GFV F ++  A+ +M  +QG  + G  +RI+W
Sbjct: 354 --PPGKKCGFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 62  ENQESSV--VPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK 119
           +N  S+V  V ++      + ++  ++VGNL+  I ED L++ F+  G I  VKI   KK
Sbjct: 299 KNSSSNVNDVKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKK 358

Query: 120 NNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINW 157
                  F+++    DA  ++  L G  + G  +RI+W
Sbjct: 359 -----CGFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++GN+    TE +L  + + FG I      P K C F+K+     A   +  L 
Sbjct: 319 PTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQ 378

Query: 382 NFPFQGRNLRTGWG 395
            +   G  +R  WG
Sbjct: 379 GYFVAGSPIRISWG 392

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G + ++KIM D     +  + F+ +      +  ++T 
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG L  DV  +     F Q+ + + A +M
Sbjct: 192 H--ILDGKVIDPKRAIPREEQ---DKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLM 246

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GFV++ D   A E +   +     G+ + I  A  R
Sbjct: 247 LDKDTGRSRGFGFVTY-DSPDAAEKVCESRYREFKGKQIEIKRAEPR 292

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDLN DV  ETL   F  +PS+V A V +D QT  S G+G+++F D+E A++A++  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 233 QGMPINGRAVRI 244
             M +  + +RI
Sbjct: 163 NCMKLGDKVIRI 174

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 70/143 (48%), Gaps = 4/143 (2%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQTL 143
           L++G+L++ + ++ L+  F V       K+  D + N ++ + ++ +    DA  A+   
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N +++  K +RI  + + + T  S  T N+F    N+  +D  L H+   F  + Q   +
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGT-NVFFT--NLPDEDNRLFHSRKFFEIFRQFGKI 219

Query: 204 WDMQTGRSRGYGFVSFADQEQAQ 226
              +   ++  GF+SF  +E A+
Sbjct: 220 LSCRLDPNKNIGFISFEHEEVAK 242

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 76/174 (43%), Gaps = 5/174 (2%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  ++V NL  SI  + ++ +F   G I ++  + DK ++N  +AF++Y  +  A  A++
Sbjct: 310 ENTVFVSNLPTSITVEEIRNHFNKIGNIMNL-FISDKISSNALWAFVKYSTAACAIRAIK 368

Query: 142 TLNGIQIEGKTVRINWAFQSQQT----TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
            LN   I  K + ++ AF+  +T    +       L++ +L+   D + +S    Q    
Sbjct: 369 ELNNTFIRKKQIVVSQAFRRGETQFHLSRKPTKRILYLKELSRICDKDFVSQFCHQRRIK 428

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
                +  +   +S     +     E A++  N +    I G  ++ +W    E
Sbjct: 429 FDEISLTKVNLEKSTHTARIKCRTDEDARKLYNSINNRLIAGSIIKASWENSNE 482

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA  AL +LN   +                 +T R+NWA  +  Q +  S
Sbjct: 129 YCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQSSIPS 187

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F  +F S     VM D  TG SR +GFV F ++++ +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G    GRA+R+ +AT R
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPR 271

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +     E  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 382 NFPFQGRNLRTGWGK 396
            F   G  +R  WG+
Sbjct: 416 GFIVGGSPIRLSWGR 430

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 8/96 (8%)

Query: 153 VRINWAFQSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRS 211
           VR N  F    T NSD T   +FVG L     +  L   F  F        + +++    
Sbjct: 341 VRAN-EFLPSNTYNSDPTNTTVFVGGLVPKTAEFQLRSLFKPF------GPILNVRIPNG 393

Query: 212 RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           +  GFV F  +  A+ ++  +QG  + G  +R++W 
Sbjct: 394 KNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 85/168 (50%), Gaps = 7/168 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G +T+VKIM D     +  + F+ +  +   +  ++T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F ++ S + A +M
Sbjct: 233 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDAQLM 287

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            D  TGRSRG+GF+++ D   A + +   + +   G+ + I  A  R+
Sbjct: 288 LDKDTGRSRGFGFITY-DSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQ 334

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++ L   F ++ +  +  +M D  TGRSRG+GF+SFAD     
Sbjct: 167 SRDINKMFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVD 226

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 227 EVVKTQH--ILDGKVIDPKRAIPRE 249

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA  AL +LN   +                 +T R+NWA  +  Q +  S
Sbjct: 129 YCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQSSIPS 187

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F  +F S     VM D  TG SR +GFV F ++++ +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G    GRA+R+ +AT R
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPR 271

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 353 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 412

Query: 382 NFPFQGRNLRTGWGK 396
            F   G  +R  WG+
Sbjct: 413 GFIVGGSPIRLSWGR 427

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 7/90 (7%)

Query: 159 FQSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFV 217
           F    T N+D T   +FVG L     +  L   F  F        + +++    +  GFV
Sbjct: 343 FLPSHTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPF------GPILNVRIPNGKNCGFV 396

Query: 218 SFADQEQAQEAMNVMQGMPINGRAVRINWA 247
            F  +  A+ ++  +QG  + G  +R++W 
Sbjct: 397 KFEKRIDAEASIQGLQGFIVGGSPIRLSWG 426

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 83/167 (49%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L+ YF   G++ D+KIM D     +  + F+ + +    +  ++T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 219 H--ILDGKVIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLM 273

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 274 LDKDTGRSRGFGFVTY-DSPDAVDRVCQNKFIDFKGKKIEIKRAEPR 319

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++TL   F ++   +   +M D  TGRSRG+GF++F +     
Sbjct: 153 SRDICKMFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVD 212

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 213 EVVKTQH--ILDGKVIDPKRAIPRE 235

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA  AL +LN   +                 +T R+NWA  +  Q +  S
Sbjct: 129 YCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 187

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F  +F S     VM D  TG SR +GFV F ++++ +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G    GRA+R+ +AT R
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPR 271

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 382 NFPFQGRNLRTGWGK 396
            F   G  +R  WG+
Sbjct: 416 GFIVGGSPIRLSWGR 430

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 50/113 (44%), Gaps = 11/113 (9%)

Query: 139 ALQTLNGIQI---EGKTVRINWAFQSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQF 194
           ALQ ++ + +       +R N +  S  T N+D T   +FVG L     +  L   F  F
Sbjct: 324 ALQNVHSVHLNESSNSNMRQNESLPSN-TFNTDPTNTTVFVGGLGPKTTEFQLRSLFKPF 382

Query: 195 PSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
                   + +++    +  GFV F  +  A+ ++  +QG  + G  +R++W 
Sbjct: 383 ------GPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 70/146 (47%), Gaps = 23/146 (15%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQI---------------EGKTVRINWAFQSQQTTNSD- 168
           Y F+E+    DA  AL +LN   I                 +  R+NWA  S  T NS  
Sbjct: 131 YCFVEFANQVDAKFAL-SLNSSPIPNFYSSSISLHTNPNNNRNFRLNWA--SGATLNSSI 187

Query: 169 ---DTFNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
                F+LFVGDL+  V +  L   F  +F S     VM D  TG SR +GF+ F D+ +
Sbjct: 188 PLTPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRCFGFIRFTDELE 247

Query: 225 AQEAMNVMQGMPINGRAVRINWATKR 250
            + A+  M G+  NGR +R+ +AT R
Sbjct: 248 RKNALIEMNGIWCNGRPLRVAYATPR 273

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 95/178 (53%), Gaps = 13/178 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQ-VGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  S++++ LK  F+ +GG I+   IM    + +  Y ++++     A  A++ 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 143 LNGIQIEGKTVRINWAF----------QSQQ--TTNSDDTFNLFVGDLNVDVDDETLSHA 190
           ++G +I+G+ +  + +           +++Q   T S  +  LF+G+L+ + D + +   
Sbjct: 317 MHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFET 376

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWAT 248
           F +    V   +    +T + +G+G+V ++  ++AQ+A   +QG  I+ R VR++++T
Sbjct: 377 FAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFST 434

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (57%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           +T ++ +   +FVG L+  VDDE L   F+     + A V+ +  T RSRGYG+V F ++
Sbjct: 248 KTESNGEPATIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENK 307

Query: 223 EQAQEAMNVMQGMPINGRAVRINWATKR 250
             A++A+  M G  I+GR +  + +T +
Sbjct: 308 FYAEKAVKEMHGKEIDGRPINCDMSTSK 335

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA  AL +LN   +                 +  R+NWA  +  Q +  S
Sbjct: 141 YCFVEFESQQDAQFAL-SLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSSIPS 199

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFDQ-FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F Q F S     VM D  TG SR +GFV F ++E+ +
Sbjct: 200 RPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERR 259

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G+   GR +R+ +AT R
Sbjct: 260 RALVEMNGVWCQGRCLRVAYATPR 283

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 321 PPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVAL 380
           PP  TT +IG +     EA L  L   FG IL       K C F+KY+    A   I  +
Sbjct: 382 PPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQGM 441

Query: 381 ANFPFQGRNLRTGWGKERNT 400
             F   G  +R  WG  RNT
Sbjct: 442 QGFIVGGNPVRLSWG--RNT 459

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   INE  L+  F   G I  VKI   K     N  F++Y    DA  A+Q
Sbjct: 385 NTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGK-----NCGFVKYENRIDAEAAIQ 439

Query: 142 TLNGIQIEGKTVRINWA 158
            + G  + G  VR++W 
Sbjct: 440 GMQGFIVGGNPVRLSWG 456

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           SQ  T   +   +F+G L   +++  L   F  F + +   +       + +  GFV + 
Sbjct: 376 SQAYTTPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKI------PQGKNCGFVKYE 429

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWA 247
           ++  A+ A+  MQG  + G  VR++W 
Sbjct: 430 NRIDAEAAIQGMQGFIVGGNPVRLSWG 456

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA   L +LN   +                 +  R+NWA  +  Q +  S
Sbjct: 160 YCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQSSIPS 218

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFDQ-FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F Q F S     VM D  TG SR +GFV F ++E+ +
Sbjct: 219 RPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERR 278

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G+   GR +R+ +AT R
Sbjct: 279 RALVEMNGVWCQGRCLRVAYATPR 302

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANV 138
           + ++  +++G L   INE+ L+  F   G I  VKI   K     N  F+++ K  DA  
Sbjct: 417 DPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGK-----NCGFVKFEKRIDAEA 471

Query: 139 ALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN 172
           A+Q + G  + G  +R++W   +  T  S  T N
Sbjct: 472 AIQGMQGFVVGGCPIRLSWGRNTVSTPTSAGTGN 505

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 33/79 (41%), Gaps = 2/79 (2%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +     E  L  L   FG IL       K C F+K++    A   I  + 
Sbjct: 418 PNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQGMQ 477

Query: 382 NFPFQGRNLRTGWGKERNT 400
            F   G  +R  WG  RNT
Sbjct: 478 GFVVGGCPIRLSWG--RNT 494

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           TT+ ++T  +F+G L   +++  L   F  F + +   +       + +  GFV F  + 
Sbjct: 415 TTDPNNT-TVFIGGLTPKINENQLQTLFSPFGNILTVKIP------QGKNCGFVKFEKRI 467

Query: 224 QAQEAMNVMQGMPINGRAVRINWA 247
            A+ A+  MQG  + G  +R++W 
Sbjct: 468 DAEAAIQGMQGFVVGGCPIRLSWG 491

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 91/180 (50%), Gaps = 13/180 (7%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  S++++ LK  F+  G +   +++ ++  + +  Y ++++     A  A++ 
Sbjct: 179 TIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKE 238

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD------------TFNLFVGDLNVDVDDETLSHA 190
           ++G QI+G+ +  + +       N  D            +  LF+G+L+ + D + +   
Sbjct: 239 MHGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYEL 298

Query: 191 FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           F +    +   +    +T + +G+G+V + +   AQ A++ +QG  I+ R VR++++T +
Sbjct: 299 FSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFSTPK 358

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           + +N  +T  +FVG L+  VDDE L + F+     + A V+++  T RSRGYG+V F+ +
Sbjct: 170 EDSNDGETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSK 229

Query: 223 EQAQEAMNVMQGMPINGRAVRINWATKR 250
             A+ A+  M G  I+GR +  + +T +
Sbjct: 230 SAAERAVKEMHGKQIDGREINCDMSTSK 257

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 94/221 (42%), Gaps = 54/221 (24%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-----------NNVN------- 124
           R L++G+LD   +E ++   +Q  G+   VK++  K N           NN +       
Sbjct: 20  RTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEIN 79

Query: 125 ----------------YAFIEYLKSHDANVALQTLNGIQI---------------EGK-T 152
                           Y F+E+    DA  AL TLN   I               +GK  
Sbjct: 80  GVSFIDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRK 138

Query: 153 VRINWAFQS--QQTTNSDDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTG 209
            R+NWA  +    T      F+LFVGDL+    +  L   F  ++ S     VM D  TG
Sbjct: 139 FRLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITG 198

Query: 210 RSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            SR +GFV FA++ + + A+  M G+   GR +R+ +AT R
Sbjct: 199 ASRCFGFVRFANETERRNALIEMNGVQFQGRQLRVAYATPR 239

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%)

Query: 325 TTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFP 384
           TT ++G +     E  L  L + FG I D    P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 385 FQGRNLRTGWGK 396
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           S   ++VG L+ +INE  L + F+  G ITDVKI   K+       F++Y +  +A  A+
Sbjct: 443 SSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQ-----CGFVKYNERLEAEAAI 497

Query: 141 QTLNGIQIEGKTVRINWA 158
             L G  I G  +R++W 
Sbjct: 498 NGLQGFIIMGSPIRLSWG 515

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +FVG LN ++++  L   F  F +      + D++    +  GFV + ++ +A+ A+N +
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGT------ITDVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 233 QGMPINGRAVRINWA 247
           QG  I G  +R++W 
Sbjct: 501 QGFIIMGSPIRLSWG 515

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 7/81 (8%)

Query: 326 TAYIGNIPHFATEADLIPLLQ---NFGFILDFSHYPEKGC--C--FIKYDTHEQAAVCIV 378
           + ++G++  FATEADL+ L Q   N    +     P  G   C  F+++    +    ++
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 379 ALANFPFQGRNLRTGWGKERN 399
            +    FQGR LR  +   RN
Sbjct: 220 EMNGVQFQGRQLRVAYATPRN 240

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 11/169 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           +++G L+    ED L+ YF   G + ++KIM D    ++    +   E   S D  V  Q
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A 
Sbjct: 226 HI----LDGKVIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDAQ 278

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +M D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 279 LMLDKDTGRSRGFGFVTY-DSPDAVDRVCQSKYIEFKGKQIEIKRAEPR 326

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D+  +F+G LN +  ++TL   F+++ S V+  +M D  TGRSRG+GF++F +     
Sbjct: 160 SKDSCKMFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVD 219

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 220 EVVKTQH--ILDGKVIDPKRAIPRE 242

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           L++G L+    E+ LK YF   G + D+KIM D    ++    +   E+  S D  V  Q
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A 
Sbjct: 291 HI----LDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 343

Query: 202 VMWDMQTGRSRGYGFVSF 219
           +M D  TGRSRG+GF+++
Sbjct: 344 LMLDKDTGRSRGFGFITY 361

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           S ++  LF+G LN +  +E L   F ++ + V   +M D  +GRSRG+GF+SF
Sbjct: 225 SKESCKLFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSF 277

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 85/170 (50%), Gaps = 13/170 (7%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN----YAFIEYLKSHDANVAL 140
           +++G L+    ED L+ YF   G + D+KIM   K+NN      + F+ + KS   +  +
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIM---KDNNTGKSRGFGFLTFEKSSSVDEVV 228

Query: 141 QTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQA 200
           +T +   ++GK +    A   ++    D T  +F+G +  DV  +     F ++ + + A
Sbjct: 229 KTQH--ILDGKVIDPKRAIPREE---QDKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDA 283

Query: 201 HVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            +M D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 284 QLMLDKDTGRSRGFGFVTY-DSPDAVDRVCQHKFIEFKGKQIEIKRAQPR 332

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D+  +F+G LN +  ++ L   F+++ + V   +M D  TG+SRG+GF++F       
Sbjct: 166 SKDSCKMFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVD 225

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 226 EVVKTQH--ILDGKVIDPKRAIPRE 248

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 91/194 (46%), Gaps = 14/194 (7%)

Query: 63  NQESSVVPASATQGGRETSDR---VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK- 118
           NQ+ +++P    Q  +    +    +++G L+    ED L+ YF   G + ++KIM D  
Sbjct: 174 NQQPAMLPPQPQQNVKADISKDSCKMFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGA 233

Query: 119 --KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVG 176
             ++    +   E+  S D  V  Q +    ++GK +    +   ++    D    +FVG
Sbjct: 234 TGRSRGFGFLTFEHPSSVDEVVKTQHI----LDGKVIDPKRSIPKEE---QDKIGKIFVG 286

Query: 177 DLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMP 236
            +  DV  +     F QF + + A +M D  TGRSRG+GF+++ D   A + +   + + 
Sbjct: 287 GIGTDVRPKEFEEFFAQFGTIIDAQLMLDKDTGRSRGFGFITY-DSADAVDKVCQNKYID 345

Query: 237 INGRAVRINWATKR 250
             G+ + +  A +R
Sbjct: 346 FKGKQIEVKRAQQR 359

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (66%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDL+  V +ETL   F ++PS+V A V  D  + +S G+G+++F D+E+A +AM  +
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 233 QGMPINGRAVRI 244
               +NG+ +RI
Sbjct: 153 NYTEVNGKEIRI 164

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 72/161 (44%), Gaps = 9/161 (5%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           L++G+L +++ E+ LK  F         K+ +D     ++ + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTF--NLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
           N  ++ GK +RI     S + T     F  N+F  +L ++    T    +D F  Y +  
Sbjct: 153 NYTEVNGKEIRI---MPSLRNTTFRKNFGTNVFFSNLPLNNPQLTTRAFYDTFSRYGK-- 207

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242
            +   +    +  GFV F D++ A+  + +       G+ +
Sbjct: 208 -ILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTNFFGKKI 247

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 75/190 (39%), Gaps = 10/190 (5%)

Query: 63  NQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNN 122
           N + S    S ++    +S   +++ NL      D +  +F   G I  + +    K   
Sbjct: 283 NDKQSKRNNSESKNNLPSSQNSIFIKNLPVITTRDDILNFFSEVGPIKSIYLSNATK--- 339

Query: 123 VNY--AFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTN---SDDTFNLFVGD 177
           V Y  AF+ Y    D+  A++  N     GK + ++ A   ++      S     LF+ +
Sbjct: 340 VKYLWAFVTYKSDDDSEKAIKRYNNFYFRGKKLSVSRAQNKEERAKFIESQKMSTLFLEN 399

Query: 178 LNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGY-GFVSFADQEQAQEAMNVMQGMP 236
           L+   + E L +   Q  +     +  D  +  S  Y G++ F + E+A    N +    
Sbjct: 400 LSAVCNKEFLKYLCHQ-ENIRPFKIQIDGYSENSSAYSGYIKFKNFEEATRIFNFLNNRL 458

Query: 237 INGRAVRINW 246
           + G  V  +W
Sbjct: 459 VGGSIVTTSW 468

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 80/167 (47%), Gaps = 7/167 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +++G L+    E+ L+ YF   G++ ++KIM D  NN        +L   DA    + + 
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKD--NNTGRSRGFGFLTFEDATSVDEVVK 215

Query: 145 GIQI-EGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
              I +GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 216 TQHILDGKVIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEDFFAQYGTIIDAQLM 272

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 273 LDKDTGRSRGFGFVTY-DSPDAVDRVCQNKFIEFKGKQIEIKRAEPR 318

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D+  +F+G LN +  +ETL   F+++   V+  +M D  TGRSRG+GF++F D     
Sbjct: 152 SKDSCKMFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVD 211

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 212 EVVKTQH--ILDGKVIDPKRAIPRE 234

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%), Gaps = 11/169 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           +++G L+    ED L+ YF   G++ ++KIM D    ++    +   E   S D  V  Q
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ + + A 
Sbjct: 184 HI----LDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 236

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +M D  TGRSRG+GF+++ D   A + +   + +   GR + I  A  R
Sbjct: 237 LMLDKDTGRSRGFGFITY-DTPDAVDKVCQNKFIDFKGRKIEIKRAAPR 284

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D+  +F+G LN +  ++ L   F ++    +  +M D  TGRSRG+GF++F       
Sbjct: 118 SKDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVD 177

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
           E +       ++G+ +    A  RE
Sbjct: 178 EVVKTQH--ILDGKVIDPKRAIPRE 200

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 11/169 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           +++G L+    ED LK YF   G + ++KIM D    ++    +   E   S D  V  Q
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    +   ++    D T  +FVG +  DV  +     F Q+ + + A 
Sbjct: 258 HI----LDGKVIDPKRSIPREE---QDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQ 310

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           +M D  TGRSRG+GFV++ D   A + +   + +   G+ + I  A  R
Sbjct: 311 LMLDKDTGRSRGFGFVTY-DSGDAVDRVCQNKYIEFKGKQIEIKRAEPR 358

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++ L + F ++ + V+  +M D  TGRSRG+GF++F +     
Sbjct: 192 SKDNCKMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVD 251

Query: 227 EAM 229
           E +
Sbjct: 252 EVV 254

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    DA  AL +LN   I                 +  R+NWA  +  Q +   
Sbjct: 166 YCFVEFQNQEDAQYAL-SLNSNPIPNILSDSNNLYTNPTGKRNFRLNWASGATLQSSIPV 224

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFDQ-FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              F+LFVGDL+    +  L   F Q + S     VM D  TG SR +GF+ F DQ++ +
Sbjct: 225 TPEFSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDERK 284

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A++ M G+   GR +R+ +AT R
Sbjct: 285 RALSEMNGVWCQGRPLRVAYATPR 308

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%)

Query: 324 VTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANF 383
           V+T +IG +     E+ +  L + FG I++    P K C F+K++    A   I  L  F
Sbjct: 379 VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGF 438

Query: 384 PFQGRNLRTGWGK 396
              G  +R  WGK
Sbjct: 439 IVAGNPIRLSWGK 451

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTL 143
            +++G L   INE  ++  F+  G I +VK+   K     N  F+++    DA  A+Q L
Sbjct: 381 TVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGK-----NCGFVKFENRIDAEAAIQGL 435

Query: 144 NGIQIEGKTVRINWAFQSQQTT 165
            G  + G  +R++W   S  T+
Sbjct: 436 QGFIVAGNPIRLSWGKASSMTS 457

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 87/218 (39%), Gaps = 51/218 (23%)

Query: 69  VPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-------- 120
           +P S+T        R L++G+LD S +E  ++Q ++   ++  VK++  KKN        
Sbjct: 10  LPPSSTIETSSEPPRTLWMGDLDPSFDESTIQQIWKSLDRLVTVKLIRAKKNLLIPCSST 69

Query: 121 ----------NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDT 170
                     +         L S  ++ +  T++    E K+  I     + QT ++  T
Sbjct: 70  INDSFSNSSNSLSPTNSSTRLSSAGSSASPTTVSSSSAENKSNSITNNLSTDQTEDASIT 129

Query: 171 FNLFVGDLNVDVDDETLSHAFD----QF--PSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
            NL   D + +  ++ L H  +     F  PS VQ H           GY FV F +QE 
Sbjct: 130 SNL---DDDTNGGNQNL-HKININGVSFIDPSTVQLH---------HAGYCFVEFQNQED 176

Query: 225 AQEAM--------------NVMQGMPINGRAVRINWAT 248
           AQ A+              N +   P   R  R+NWA+
Sbjct: 177 AQYALSLNSNPIPNILSDSNNLYTNPTGKRNFRLNWAS 214

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+  +++  +   F  F + V      +++    +  GFV F ++  A+ A+  +
Sbjct: 382 VFIGGLSPKINESQVRSLFKPFGNIV------NVKLPPGKNCGFVKFENRIDAEAAIQGL 435

Query: 233 QGMPINGRAVRINWA 247
           QG  + G  +R++W 
Sbjct: 436 QGFIVAGNPIRLSWG 450

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 71/136 (52%), Gaps = 6/136 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G +TD+KIM D     +  + F+ + K    +  ++T 
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A    +    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 224 H--ILDGKVIDPKRAIPRDE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 278

Query: 204 WDMQTGRSRGYGFVSF 219
            D  TG+SRG+GFV++
Sbjct: 279 LDKDTGQSRGFGFVTY 294

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           S ++  +F+G LN D  ++ L   F ++ +     +M D  TGRSRG+GF+SF
Sbjct: 158 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 210

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 83/171 (48%), Gaps = 13/171 (7%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQT- 142
           +++G L+    ED L++YF   G +T+VKIM D     +  + F+ +  +   +  ++T 
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 143 --LNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQA 200
             L+G  I+ K        +S  T  +     +FV  +  DV  +     F Q+ S + A
Sbjct: 225 HILDGKVIDPK--------ESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDA 276

Query: 201 HVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            +M D  TGRSRG+GF+++ D   A + +   + +   G+ + I  A  R+
Sbjct: 277 QLMLDKDTGRSRGFGFITY-DSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQ 326

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S D   +F+G LN +  ++ L   F ++ +  +  +M D  TGRSRG+GF+SFAD     
Sbjct: 159 SRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVD 218

Query: 227 EAMNV 231
           E +  
Sbjct: 219 EVVKT 223

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 6/112 (5%)

Query: 68  VVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYA 126
           + P  +   GR      ++V  +   +     +++F   G I D ++M+DK    +  + 
Sbjct: 232 IDPKESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFG 291

Query: 127 FIEYLKSHDANVALQTLNGIQIEGKTVRINWA----FQSQQTTNSDDTFNLF 174
           FI Y  S DA   +     I+ +GK + I  A     Q Q+TTN+  T   F
Sbjct: 292 FITY-DSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQVQKQRTTNASPTGQPF 342

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 71/136 (52%), Gaps = 6/136 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G +TD+KIM D     +  + F+ + K    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A    +    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 221 H--ILDGKVIDPKRAIPRDE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 275

Query: 204 WDMQTGRSRGYGFVSF 219
            D  TG+SRG+GFV++
Sbjct: 276 LDKDTGQSRGFGFVTY 291

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           S ++  +F+G LN D  ++ L   F ++ +     +M D  TGRSRG+GF+SF
Sbjct: 155 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 207

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 93/181 (51%), Gaps = 15/181 (8%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
            ++VG L  +I++  LK  F+  G +   +++ ++    +  Y ++++     A  A++ 
Sbjct: 237 TIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKE 296

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN-------------SDDTFNLFVGDLNVDVDDETLSH 189
           ++G +++G+ +  + +  S+ T N             S+ +  LF+G+L+ + D + +  
Sbjct: 297 MHGKELDGRPINCDMS-TSKPTVNPREDRAKRFGDMPSEPSDTLFLGNLSFNADRDQIYE 355

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F      +   +    +T + +G+G+V +A  + AQ+A+  +QG  I+ R VR++++T 
Sbjct: 356 LFSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQGEYIDNRPVRLDFSTP 415

Query: 250 R 250
           +
Sbjct: 416 K 416

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 53/90 (58%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S++   S +   +FVG L+ ++DD+ L + F+       A V+++  + RSRGYG+V F 
Sbjct: 226 SKKAKLSGEPATIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFT 285

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           D+  A++A+  M G  ++GR +  + +T +
Sbjct: 286 DKSYAEKAVKEMHGKELDGRPINCDMSTSK 315

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 71/136 (52%), Gaps = 6/136 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G +TD+KIM D     +  + F+ + K    +  ++T 
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A    +    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 223 H--ILDGKVIDPKRAIPRDE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 277

Query: 204 WDMQTGRSRGYGFVSF 219
            D  TG+SRG+GFV++
Sbjct: 278 LDKDTGQSRGFGFVTY 293

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           S ++  +F+G LN D  ++ L   F ++ +     +M D  TGRSRG+GF+SF
Sbjct: 157 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 209

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 71/136 (52%), Gaps = 6/136 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQTL 143
           +++G L+    ED L++YF   G +TD+KIM D     +  + F+ + K    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           +   ++GK +    A    +    D T  +FVG +  DV  +     F Q+ + + A +M
Sbjct: 221 H--ILDGKVIDPKRAIPRDE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 275

Query: 204 WDMQTGRSRGYGFVSF 219
            D  TG+SRG+GFV++
Sbjct: 276 LDKDTGQSRGFGFVTY 291

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           S ++  +F+G LN D  ++ L   F ++ +     +M D  TGRSRG+GF+SF
Sbjct: 155 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 207

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 81/170 (47%), Gaps = 11/170 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK---KNNNVNYAFIEYLKSHDANVALQ 141
           +++G L+    E+ L+ YF   G + +VKIM D    ++    +   E   S D  V  Q
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            +    ++GK +    A   ++    D T  +FVG +  DV  +     F Q+ S + A 
Sbjct: 248 HI----LDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 300

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           +M D  TGRSRG+GF+++ D   A + +   + +   G+ + I  A  R+
Sbjct: 301 LMLDKDTGRSRGFGFITY-DTPDAVDRVCQNKFIEFKGKQIEIKRAEPRQ 349

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (47%), Gaps = 17/143 (11%)

Query: 125 YAFIEYLKSHDANVAL-----------QTLNGIQIEG---KTVRINWAFQS--QQTTNSD 168
           Y F+E+    DA   L            T  G  I     +T R+NWA  +  Q +  + 
Sbjct: 172 YCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIPTT 231

Query: 169 DTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQE 227
             ++LFVGDL+    +  L   F  +F S     VM D  TG SR +GFV F ++E+ + 
Sbjct: 232 PEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRR 291

Query: 228 AMNVMQGMPINGRAVRINWATKR 250
           A+  M G+   GR +R+ +AT R
Sbjct: 292 ALIEMNGVHFQGRTLRVAYATPR 314

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT ++G +     E  L  + Q FG IL     P K C F+K++    A   I  L 
Sbjct: 464 PTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 382 NFPFQGRNLRTGWGK 396
            F      +R  WG+
Sbjct: 524 GFVLVENPIRLSWGR 538

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  ++VG L  ++ E  L++ FQ  G I  +KI   K     N  F+++    DA  A+
Sbjct: 465 TNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGK-----NCGFVKFEHKIDAEAAI 519

Query: 141 QTLNGIQIEGKTVRINWA 158
           Q L G  +    +R++W 
Sbjct: 520 QGLQGFVLVENPIRLSWG 537

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 328 YIGNIPHFATEADLIPLLQN-------FGFILDFSHYPEKGCCFIKYDTHEQAAVCIVAL 380
           ++G++   ATEADL+ L Q           + D      +   F+++   E+    ++ +
Sbjct: 237 FVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEM 296

Query: 381 ANFPFQGRNLRTGWGKERNTFI 402
               FQGR LR  +   R+T +
Sbjct: 297 NGVHFQGRTLRVAYATPRSTTV 318

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 78/203 (38%), Gaps = 37/203 (18%)

Query: 69  VPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFI 128
           +P ++T    +   R L++G+LD S +E+ +++ +   G+   VK++  KKN  +  +  
Sbjct: 32  LPPTSTIQTSDEPPRTLWMGDLDPSYDEETIQEIWSHLGKHVTVKLIRAKKNLLIPCSST 91

Query: 129 EYLKSHDANVALQTLNGIQIEGKTVR---INWAFQSQQTTNSDDTFNLFVGD------LN 179
                  A       NG Q   +  R    N    +  T  SD       G+      L 
Sbjct: 92  SDPAPVPAASVPSGQNGAQPPQEDTRDSPSNTTGSASNTPASDSGIQTSEGEQSTQQPLK 151

Query: 180 VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM---------- 229
           ++++  +        P+  Q H           GY FV F  Q+ AQE +          
Sbjct: 152 ININGVSFID-----PATTQLH---------HAGYCFVEFESQKDAQEGLALNSTPLPNF 197

Query: 230 -NVMQGMPING---RAVRINWAT 248
            +   G  IN    R  R+NWA+
Sbjct: 198 VSTTTGQDINPTGQRTFRLNWAS 220

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           T  S     LF+GDL+  V ++ L   F++F S+V A +  D  T +S GYG+++F+++E
Sbjct: 113 TLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEE 172

Query: 224 QAQEAMNVMQGMPINGRAVRI 244
            A+  +     +PI GR VRI
Sbjct: 173 DAERVIEEFNYIPIFGREVRI 193

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 69/159 (43%), Gaps = 5/159 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           L++G+LD+ + E  L+  F         KI +D     ++ Y ++ +    DA   ++  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N I I G+ VRI  + ++     +  T N+F  +L ++    T    +D F  Y +   +
Sbjct: 182 NYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPLENLALTTRVFYDAFKKYGK---I 237

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242
              +  R +  GFV F     A++A+    G    G  +
Sbjct: 238 LSCKLDRRKNIGFVYFEKDSSAKQAIAEYNGKQFYGNNI 276

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN--YAFIEYLKSHDANVALQT 142
           +++ NL  + + DLL  YF    QI  VK +     + +N  +AFI + K  DA  A+ +
Sbjct: 331 VFIKNLPLNSDSDLLLDYF---SQIGPVKSIFTSNVSKLNSAWAFITFKKGSDAQDAIDS 387

Query: 143 LNGIQIEGKTVRINWA---FQS 161
           LN  Q+ G+T+ ++ A   FQS
Sbjct: 388 LNHSQLLGRTIELSRAQKNFQS 409

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           T  S     LF+GDL+  V ++ L   F++F S+V A +  D  T +S GYG+++F+++E
Sbjct: 109 TLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEE 168

Query: 224 QAQEAMNVMQGMPINGRAVRI 244
            A+  +     +PI GR VRI
Sbjct: 169 DAERVIEEFNYIPIFGREVRI 189

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 69/159 (43%), Gaps = 5/159 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           L++G+LD+ + E  L+  F         KI +D     ++ Y ++ +    DA   ++  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N I I G+ VRI  + ++     +  T N+F  +L ++    T    +D F  + +   +
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPLENLALTTRVFYDAFKKFGK---I 233

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242
              +  R +  GFV F     A++A+    G    G  +
Sbjct: 234 LSCKLDRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNI 272

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 95/190 (50%), Gaps = 18/190 (9%)

Query: 66  SSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVN 124
           SS VPA+            +YVGN+D  ++++LL + F   G +  ++   DK    +  
Sbjct: 4   SSTVPANT-----------VYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQG 52

Query: 125 YAFIEYLKSHDANVALQTLNG-IQIEGKTVRI---NWAFQSQQTTNSDDT-FNLFVGDLN 179
           +AF+E+    DA  A + LN  +++  +T+++   N A  S  + N+ D    LF+ +++
Sbjct: 53  FAFVEFNSPQDAEYASKCLNNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKNID 112

Query: 180 VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING 239
             VD E L+  F +F S V+   ++ ++ G  R   ++ ++  E +  A+  +    +  
Sbjct: 113 ELVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMVMN 171

Query: 240 RAVRINWATK 249
           + + I++A K
Sbjct: 172 KCISIDYAYK 181

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 40/81 (49%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           L++ N+D+ ++ ++L + F   G +     +   K   +  A+I Y     ++ AL+ LN
Sbjct: 106 LFIKNIDELVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRCAYICYSTFEHSDAALEKLN 165

Query: 145 GIQIEGKTVRINWAFQSQQTT 165
              +  K + I++A++    T
Sbjct: 166 NQMVMNKCISIDYAYKEGSKT 186

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 89/179 (49%), Gaps = 16/179 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQTL 143
           LY+G+L+K + ED+LK +F +   +  VKI VD  +  ++ Y ++      +A+  ++  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N   I GK VRI  + ++ QT  +  T N+F  DL +     T    ++ F +Y     +
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGT-NVFFSDLPLSEKSITTRDFYNFFKAYGN---I 216

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMN------VMQGMPING-----RAVRINWATKRE 251
              +   S+  GF+ F ++  A+E ++      ++ G  IN      +++R N  T+++
Sbjct: 217 LSCKLNTSKNIGFIFFENESSAKEVISKFNANELLYGYKINCGVHIDKSIRKNLGTEKQ 275

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           S  +  L++GDL   V ++ L + F  + S +   +  D  +G S GYG+++   +E+A 
Sbjct: 95  SKQSIALYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEAD 154

Query: 227 EAMNVMQGMPINGRAVRI 244
           + M      PI G+ VRI
Sbjct: 155 DLMERFNYTPIFGKVVRI 172

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEGKTV---------------RINWAFQSQQTTNSDD 169
           Y F+E+    DA  AL TLN   +   T                R+NWA  +   +    
Sbjct: 112 YCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIPS 170

Query: 170 T--FNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           T  F+LFVGDL+    +  L   F  +F S     VM D  TG SR +GFV F D+++ +
Sbjct: 171 TPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERR 230

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+  M G+   GR +R+ +AT R
Sbjct: 231 RALVEMNGVWCQGRNLRVAYATPR 254

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    +E  L  L   FG I++    P KGC F+KY     A   I  + 
Sbjct: 393 PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 382 NFPFQGRNLRTGWGK 396
            F   G  +R  WG+
Sbjct: 453 GFIVGGNPIRLSWGR 467

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L   I+E  L   F   G I +VKI   K        F++Y    DA  A+Q
Sbjct: 395 NTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGK-----GCGFVKYAYRIDAEAAIQ 449

Query: 142 TLNGIQIEGKTVRINWAFQSQQT 164
            + G  + G  +R++W   S  T
Sbjct: 450 GMQGFIVGGNPIRLSWGRTSADT 472

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 13/96 (13%)

Query: 158 AFQSQQT------TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRS 211
           AF +Q T      TN ++T  +F+G L   + +  L   F  F + +      +++    
Sbjct: 378 AFMAQPTAPRSAFTNPNNT-TVFIGGLTSQISERQLHSLFSPFGAII------NVKIPPG 430

Query: 212 RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           +G GFV +A +  A+ A+  MQG  + G  +R++W 
Sbjct: 431 KGCGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSWG 466

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 85/169 (50%), Gaps = 5/169 (2%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNN----VNYAFIEYLKSHDANVAL 140
           +YVGNLD  +N+ LL + F   G I+ +K   +K++ +      YAFI+++      V  
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 141 QTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQA 200
              N + + GK +++  + +  +TT+ D    LFV +L+  +D   LS+ F  F   ++ 
Sbjct: 65  LFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLRK 124

Query: 201 HVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
             ++ +Q G  R   +V F   + + EA+  +    +  + + I++A K
Sbjct: 125 PEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYK 172

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 45/87 (51%)

Query: 158 AFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFV 217
              SQ    S  T  LF+GDL+  +D+E L   F +F S     V  D +TG+S GYG++
Sbjct: 90  GLDSQSVIESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYL 149

Query: 218 SFADQEQAQEAMNVMQGMPINGRAVRI 244
           +F+ ++    A       PI G+ VRI
Sbjct: 150 NFSRRQDTLAATEEFNYRPIFGKEVRI 176

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 86/188 (45%), Gaps = 13/188 (6%)

Query: 64  QESSVVPASA-TQGGRETSDRV-------LYVGNLDKSINEDLLKQYFQVGGQITDVKIM 115
           QES V  ++  TQ G ++   +       L++G+LD+ I+E++L Q F+    +T VK+ 
Sbjct: 76  QESGVATSNTNTQNGLDSQSVIESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVC 135

Query: 116 VDKKN-NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLF 174
            D +   ++ Y ++ + +  D   A +  N   I GK VRI  + ++     +  T N+F
Sbjct: 136 TDAETGKSLGYGYLNFSRRQDTLAATEEFNYRPIFGKEVRIMPSLRNTFYRKNIGT-NIF 194

Query: 175 VGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQG 234
             +L ++  + T    +D F  Y     +   +  + +  GF+ F +   A+  +    G
Sbjct: 195 FSNLPLENSNLTTRVFYDTFKVYGN---ILSCKLDKRKNIGFIYFDNDHAARVVIKEFNG 251

Query: 235 MPINGRAV 242
               G  +
Sbjct: 252 SEFFGNKI 259

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           ++V NL  S  +D +  YF   G +  V      K  + ++AF+ Y K  D N A++  +
Sbjct: 316 IFVKNLPPSCPDDEILDYFSNLGPVKSVFSSTSHKYES-SWAFVTYKKGSDTNKAVKIYH 374

Query: 145 GIQIEGKTVRI 155
           G Q +G+ + +
Sbjct: 375 GAQFKGRKLSV 385

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 151 KTVRINWAFQSQQTTNSDDT--FNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQ 207
           +  R+NWA  +   +    T  F+LFVGDL+    +  L   F  +F S     VM D  
Sbjct: 153 RNFRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPI 212

Query: 208 TGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           TG SR +GFV F D+++ + A+  M G+   GR +R+ +AT R
Sbjct: 213 TGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPR 255

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    +E  L  L   FG I++    P KGC F+KY     A   I  + 
Sbjct: 403 PNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 462

Query: 382 NFPFQGRNLRTGWGK 396
            F   G  +R  WG+
Sbjct: 463 GFIVGGNPIRLSWGR 477

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           +  +++G L    +E  L   F   G I +VKI   K        F++Y    DA  A+Q
Sbjct: 405 NTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGK-----GCGFVKYAYRIDAEAAIQ 459

Query: 142 TLNGIQIEGKTVRINWAFQSQQTT 165
            + G  + G  +R++W   S  T+
Sbjct: 460 GMQGFIVGGNPIRLSWGRTSTDTS 483

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 165 TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
           TN ++T  +F+G L     +  L   F  F + +      +++    +G GFV +A +  
Sbjct: 401 TNPNNT-TVFIGGLTSHTSERQLHSLFAPFGTII------NVKIPPGKGCGFVKYAYRID 453

Query: 225 AQEAMNVMQGMPINGRAVRINWA 247
           A+ A+  MQG  + G  +R++W 
Sbjct: 454 AEAAIQGMQGFIVGGNPIRLSWG 476

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 87/176 (49%), Gaps = 8/176 (4%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137
           + ++  +YVGNLD  ++++LL + F     ++ ++   DK K  +  +AF+E     D +
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 138 VALQTLNG-IQIEGKTVRINWAFQSQQTTNSDDTF---NLFVGDLNVDVDDETLSHAFDQ 193
            A+++LN  + + GK +++    ++ +  NS   F    LFV +L+  +D   L   F +
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAK--NSAPVFARAKLFVKNLDSTIDAVQLQKLFGK 120

Query: 194 FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
           F    +   ++ ++ G  R   +V F     + EA+  +    +  + + I++A K
Sbjct: 121 FGPLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+G+L++DV++E L   F +FPS V   +  +  T  S GYG+++F D+E A++A    
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 233 QGMPINGRAVRI 244
             + + G  V+I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (47%), Gaps = 5/146 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQTL 143
           L++GNL   +NE+ LKQ F+    +  VKI  +     ++ Y ++ +    DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N I + G  V+I  + ++     +  T NLF  +L +D  + T    +D F  Y +   +
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGT-NLFFCNLPLDNKELTTRRFYDTFKKYGK---I 195

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAM 229
              +  + +  GFV F + + A+E +
Sbjct: 196 LSCKLDKRKNIGFVYFDNDKSAKEVI 221

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (62%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDL+  V ++ L   F+++PS V   +  D  + RS GYG+++F++ E A++A    
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 233 QGMPINGRAVRI 244
             +P+ G+ VRI
Sbjct: 164 NYVPLFGKEVRI 175

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 5/168 (2%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           L++G+LD+ + E +L+  F     +  VKI VD     ++ Y +I +    DA  A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N + + GK VRI  + ++     +  T N+F  +L ++    T    +D F  Y +   +
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGT-NVFFSNLPLENLSLTTRAFYDTFKKYGK---I 219

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
              +  R +  GF+ F     A+ A++   G    G  +       RE
Sbjct: 220 LSCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDRE 267

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 79/201 (39%), Gaps = 38/201 (18%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           ++V NL  + NED +  +F   G +  V      K N+ ++AF+ Y K  D + A++ LN
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYNS-SWAFVTYKKGSDTSEAIEKLN 372

Query: 145 GIQIEGKTVRINWA---FQ---------------------SQQTTNSDDTFNLFVGDLNV 180
           G   + + + +  A   FQ                     +  T++  ++FNL      +
Sbjct: 373 GEIFKHRKIEVARAQKNFQHPSNNANSRASDCDTSSKKEYAASTSDRSESFNLHANGYKL 432

Query: 181 DVDDETLSH-AFDQFPSYVQAH----------VMWDMQTGRSRGYGFVSFADQEQAQEAM 229
            V    +S    ++F SY+ A            ++D +T    G   V    +  A    
Sbjct: 433 SVYLSNMSSICTEEFLSYLCAQERIKTKKISVCLYDEKTLTYSGS--VLCQTRNDANRLF 490

Query: 230 NVMQGMPINGRAVRINWATKR 250
            +M    +    V+ +W +KR
Sbjct: 491 ELMDQKLLGDSIVKASWQSKR 511

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S+Q  N  D   LFV  +  DV DE L+  F  F     A V+ D+   RSRG+GFVSFA
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNK-RSRGFGFVSFA 74

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            ++  +EA+   +    NG ++R++ A +R+
Sbjct: 75  VEDDTKEALAKARKTKFNGHSLRVDVAKRRD 105

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           +++  N  + F++FV ++  D  +E+L+  F +F S   A  + D  TG ++G  FV+F 
Sbjct: 282 TRKVQNKREDFSIFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFK 341

Query: 221 DQEQAQEAMNVMQGMPING 239
           DQ    E    ++  P+ G
Sbjct: 342 DQYTYNE---CVKNAPVAG 357

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           Q   T  S+    LF+GDL  +V ++ L + F++F S+    +  D  T +S GYG+++F
Sbjct: 127 QQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNF 186

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRI 244
            D + A+ A++    MPI GR +R+
Sbjct: 187 GDPKDAENAVDEYNYMPIFGREIRM 211

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 70/151 (46%), Gaps = 5/151 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           L++G+L  ++ ED+L   F        VKI VD     ++ Y ++ +    DA  A+   
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N + I G+ +R+  + ++     +  T N+F  +L +D    T    +D+F  + +   +
Sbjct: 200 NYMPIFGREIRMMPSLRNTYFRKNIGT-NVFFSNLPLDNTKLTTRVFYDEFKKFGK---I 255

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQG 234
              +  R +  GF+ F +   A+EA+    G
Sbjct: 256 LSCKLDRRKNIGFIYFENDAAAKEAIKQYNG 286

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 72/170 (42%), Gaps = 9/170 (5%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           ++V NL  + + D L  +F   G +  V    D    + ++AFI Y +  D   A++ LN
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSV-YTSDVSKFDSSWAFITYKRIQDTKTAIEKLN 446

Query: 145 GIQIEGKTVRINWA----FQSQQTTNSDDTFN----LFVGDLNVDVDDETLSHAFDQFPS 196
           G +   +T+ +        +  Q  N+    N    +F+ +L+V  ++E L+    Q   
Sbjct: 447 GCKYMKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEEFLNFLCGQERI 506

Query: 197 YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
             +  V+   +       G+V  A +  AQ    +M+   +    V+ +W
Sbjct: 507 KTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASW 556

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 76/138 (55%), Gaps = 12/138 (8%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAF----------QSQQ--TTNSDDTFN 172
           Y ++++     A  A++ ++G +I+G+ + ++ +           +++Q   T S  +  
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+G+L+ + + + +   F ++   V   +    +T + +G+G+V ++  E AQ+A++ +
Sbjct: 71  LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDAL 130

Query: 233 QGMPINGRAVRINWATKR 250
           QG  I+ R VR++++T +
Sbjct: 131 QGHYIDNRPVRLDFSTPK 148

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 29/43 (67%)

Query: 208 TGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           T RSRGYG+V F D+  A++A+  M G  I+GR + ++ +T +
Sbjct: 5   TDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSK 47

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQT 142
            L++GNL  +   D + + F   G +  V++    + N    + +++Y    +A  AL  
Sbjct: 70  TLFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDA 129

Query: 143 LNGIQIEGKTVRINWA 158
           L G  I+ + VR++++
Sbjct: 130 LQGHYIDNRPVRLDFS 145

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 136 ANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFP 195
            N+  QT N    EGK ++I           S +TF+LF+GDL+  V  E L + F ++P
Sbjct: 28  VNLYGQTTN---YEGKKIKI---------LESGETFSLFIGDLHPKVTQEILENIFGKYP 75

Query: 196 SYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           S++ A V +D +T  S G+G+++F+ +  +++A++      +    +R+
Sbjct: 76  SFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDFNCTRLFDSVIRL 124

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           + N  ++F LF+G LN  V  E L   F  FPS++ A V  DM+T +S GYG+++F++Q
Sbjct: 87  SLNDKNSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQ 145

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 87/175 (49%), Gaps = 11/175 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           LY+GN+D ++ +DLL + F     I+ ++   DK  + +  YAFIE+    DA+  ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 144 NG-IQIEGKTVRINWA----FQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQF-PSY 197
           N  +Q+  +T+++  A      SQ + + +    LFV +L+  VD   L+  F +F P  
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 198 VQAHVMWDMQTGRSRGY-GFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            Q  +    Q      Y  + +F D +QA   +N      +  R++ +++A K E
Sbjct: 132 KQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLN---NQIVFNRSISVDYAFKDE 183

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           L+V NLD  ++   L + F   G  +    +   K  +   A+I Y    D++ AL  LN
Sbjct: 106 LFVKNLDDLVDVAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLN 165

Query: 145 GIQIEGKTVRINWAFQSQQ 163
              +  +++ +++AF+ ++
Sbjct: 166 NQIVFNRSISVDYAFKDEK 184

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 82/177 (46%), Gaps = 13/177 (7%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQTL 143
           +YVGN+D  + ++LL + F   GQ+  VK   DK +     +AFIE+  + DA+  L  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 144 -NGIQIEGKTVRINWAFQSQQTTNSDDTFNL----------FVGDLNVDVDDETLSHAFD 192
            N +++  K ++I  + Q+ Q  +++    L          FV D+   V+   L+  F 
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQLFS 127

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
           +F    +   ++ +  G  R   F+ F   + A  A+  + G  I  +   + +A K
Sbjct: 128 KFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFK 183

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHD-ANVALQTL 143
           ++V ++  ++    L Q F   G +     +    N  V  AFI Y K +D A++A+QTL
Sbjct: 108 VFVKDIADTVEVRHLTQLFSKFGPLAKTPEVFTVSNGEVRCAFI-YFKFYDNADLAIQTL 166

Query: 144 NGIQIEGKTVRINWAFQSQQTTN 166
           NG  I  K   + +AF+     N
Sbjct: 167 NGQFIMNKKASLEYAFKENGRKN 189

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDL+  V +ETL   F ++PS+V + V  D  T +S G+G+++F D+E+A++AM  +
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 233 QGMPINGRAVRI 244
               +NG+ +RI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 75/161 (46%), Gaps = 9/161 (5%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           L++G+LD+++ E+ LK+ F+        K+ +D     ++ + ++ +    +A  A++ L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTF--NLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
           N  ++ GK +RI     S + T     F  N+F  +L ++    T    +D F  Y +  
Sbjct: 153 NYTKVNGKEIRI---MPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGK-- 207

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242
            +   +    +  GFV F D++ A+  + +       G+ +
Sbjct: 208 -ILSCKLDSRKDIGFVYFEDEKTARSVIKMYNNTNFFGKKI 247

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK--KNNNVNYAFIEYLKSHDANVALQT 142
           L++ NL    N++ LK Y      I   KI +D+  +N++    +I++    DA      
Sbjct: 395 LFLENLSAVCNKEFLK-YLCHQENIRPFKIQIDRYDENSSTYSGYIKFRNFEDATRIFNF 453

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD 169
           LN   + G  V  +W  QS  +   DD
Sbjct: 454 LNSRLVGGSIVMTSWERQSNSSKYQDD 480

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 67/173 (38%), Gaps = 10/173 (5%)

Query: 80  TSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNY--AFIEYLKSHDAN 137
           +S   +++ NL      D +  +F   G I  + +    K   V Y  AF+ Y  + D+ 
Sbjct: 300 SSQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATK---VKYLWAFVTYKSNDDSE 356

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTN---SDDTFNLFVGDLNVDVDDETLSHAFDQF 194
            A++  N     G+ + +  A   ++      S     LF+ +L+   + E L +   Q 
Sbjct: 357 KAIKRYNNFYFRGRKLLVTRAQGKEERAKYIESQKISTLFLENLSAVCNKEFLKYLCHQ- 415

Query: 195 PSYVQAHVMWDMQTGRSRGY-GFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246
            +     +  D     S  Y G++ F + E A    N +    + G  V  +W
Sbjct: 416 ENIRPFKIQIDRYDENSSTYSGYIKFRNFEDATRIFNFLNSRLVGGSIVMTSW 468

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 49/72 (68%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDL+  V +ETL   F ++PS+V A V  D  T +S G+G+++F D+E+A++AM  +
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 233 QGMPINGRAVRI 244
               +NG+ +RI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 73/161 (45%), Gaps = 9/161 (5%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           L++G+L +++ E+ LK  F+        K+ +D     ++ + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTF--NLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
           N  ++ GK +RI     S + T     F  N+F  +L ++    T    +D F  Y +  
Sbjct: 153 NYTKVNGKEIRI---MPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGK-- 207

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242
            +   +    +  GFV F D++ A+  + +       G+ +
Sbjct: 208 -ILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKI 247

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 78/202 (38%), Gaps = 11/202 (5%)

Query: 51  SEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT 110
           +E     EQS  N++ S      ++    +S   +++ NL      D +  +F   G I 
Sbjct: 272 AETIIEKEQSL-NEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPIK 330

Query: 111 DVKIMVDKKNNNVNY--AFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTN-- 166
            + +    K   V Y  AF+ Y  S D+  A++  N     GK + +  A   ++     
Sbjct: 331 SIYLSNATK---VKYLWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKFI 387

Query: 167 -SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGY-GFVSFADQEQ 224
            S     LF+ +L+   + E L +   Q  +     +  D     S  Y GF+ F + E 
Sbjct: 388 ESQKISTLFLENLSAVCNKEFLKYLCHQ-ENIRPFKIQIDGYDENSSTYSGFIKFRNFED 446

Query: 225 AQEAMNVMQGMPINGRAVRINW 246
           A    N +    + G  V  +W
Sbjct: 447 ATRIFNFLNNRLVGGSIVTTSW 468

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S+Q  N  D   LFV  +  DV DE L+  F  F     A V+ D    RSRG+GFVSFA
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            ++  +EA+   +    NG  +R++ A +R+
Sbjct: 75  VEDDTKEALAKARKTKFNGHTLRVDVAKRRD 105

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           +++  N  + F++FV ++  D  +E+L+  F +F S   A  + D  TG ++G  FV+F 
Sbjct: 285 TRKVQNKKEDFSVFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFK 344

Query: 221 DQ 222
           DQ
Sbjct: 345 DQ 346

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 41/227 (18%), Positives = 88/227 (38%), Gaps = 36/227 (15%)

Query: 58  EQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD 117
           E++ EN ESS    S  Q       + L+V ++ + + ++ L  +F     I    ++ D
Sbjct: 2   EKTIENIESSKSNVSK-QNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKD 60

Query: 118 KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDD-------- 169
               +  + F+ +    D   AL      +  G T+R++ A +  +T+ S +        
Sbjct: 61  TNKRSRGFGFVSFAVEDDTKEALAKARKTKFNGHTLRVDVAKRRDRTSKSPEGAEKSTPE 120

Query: 170 ------------------TFNLFVGDLNVDV--------DDETLSHAFDQFPSYVQAHVM 203
                               +L  G   + +        D   L   F ++ + V+A + 
Sbjct: 121 SFEKISGQKNENDNDADDEDSLLKGKPKLIIRNMPWSCRDPTKLKKIFTRYGTVVEATIP 180

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
              + G+  G+ FV+       + A+   + + I+GR V +++A ++
Sbjct: 181 R-KRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFAVQK 226

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + +  I   +      +AF+   K  +  +AL+    ++I+G+ V +++A
Sbjct: 164 LKKIFTRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFA 223

Query: 159 FQSQQ 163
            Q  +
Sbjct: 224 VQKNR 228

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 139 ALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYV 198
           A+Q +N  ++    +  N ++ ++      D   +F+G LNV++ +  +   F Q+   V
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNEYK----DRAYIFIGGLNVELTEADILTIFSQYGIPV 61

Query: 199 QAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRIN--WATKRE 251
              ++ D +TG S+G+G++ + DQ  A  A++ + G  I GR ++++  W T R+
Sbjct: 62  DVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHAWYTPRD 116

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           T  S     LF+GDL   V +  L   F +F S     +  D  +G+S GYG+++FA+ E
Sbjct: 90  TLESKSVVALFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSE 149

Query: 224 QAQEAMNVMQGMPINGRAVRI 244
            A++A       PI G+ VRI
Sbjct: 150 DAEKATEEFNYRPIEGQEVRI 170

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 77/159 (48%), Gaps = 5/159 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQTL 143
           L++G+L+ S+ E++L+  F     +T VKI +D  +  ++ Y ++ +  S DA  A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N   IEG+ VRI  + ++     +  T N+F  +L ++    T    +D F  Y +   +
Sbjct: 159 NYRPIEGQEVRIMPSLRNSFYRKNVGT-NVFFSNLPLEDSRLTTRVFYDTFKKYGK---I 214

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242
              +  + +  GF+ F + + A++ +    G    G  V
Sbjct: 215 LSCKLDKRKDIGFIYFNNDQSARKVIKDYNGKEFFGNKV 253

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S+Q  N  D   LFV  +  DV DE L+  F  F     A V+ D    RSRG+GFVSFA
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            ++  +EA+   +    NG  +R++ A +R+
Sbjct: 75  VEDDTKEALIKARKTKFNGHTLRVDVAKRRD 105

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/173 (20%), Positives = 65/173 (37%), Gaps = 49/173 (28%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK  F   G + +  I   +      +AF+   K  +  +AL+    ++I+G+ V +++A
Sbjct: 164 LKDIFSRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENSKDLKIDGRKVAVDFA 223

Query: 159 FQ-------------------------------------------------SQQTTNSDD 169
            Q                                                 +++  N  +
Sbjct: 224 VQKNRWEDYKKAQPEVKDESNNESQDEDEEVDDEDKQVEEDSDDDPKTEEPTRKVQNKKE 283

Query: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
            F++FV ++  D  +E+L   F +F S   A  + D  TG ++G  FV+F DQ
Sbjct: 284 EFSVFVRNVPYDATEESLVAHFSKFGSVKYALPVIDRSTGLAKGTAFVAFKDQ 336

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/202 (16%), Positives = 78/202 (38%), Gaps = 35/202 (17%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++ + + ++ L  +F     I    ++ D    +  + F+ +    D   AL  
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALIK 85

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD--------TFNLFVGDLNV---DVDDE------ 185
               +  G T+R++ A +  ++  S +        +F   +G       D D E      
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRSKKSSEGAPMKASESFEKTIGQKTENEHDADGEDSMLKG 145

Query: 186 -----------------TLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
                             L   F ++ + V+A +    + G+  G+ FV+       + A
Sbjct: 146 KPKLIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 229 MNVMQGMPINGRAVRINWATKR 250
           +   + + I+GR V +++A ++
Sbjct: 205 LENSKDLKIDGRKVAVDFAVQK 226

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQS--QQTTNS 167
           Y F+E+    D   AL +LN   I                 +T R+NWA  +  Q    +
Sbjct: 121 YCFVEFESQQDVIAAL-SLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQSLIPA 179

Query: 168 DDTFNLFVGDLN-VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
              ++LF+GDL+ +  + + LS    ++ S     VM D   G SRG+GF+ F+D+++ +
Sbjct: 180 TPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDEDERK 239

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
           +A+  M G+  + R  R+  AT R
Sbjct: 240 DALENMNGVMCHSRYFRLALATPR 263

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANV 138
           + S+  +++G L  S NE  L+  F+  G I  VKI + K     N  F+++ +  +AN 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGK-----NCGFVKFKRKIEANA 392

Query: 139 ALQTLNGIQIEGKTVRINWA 158
           A++ + G  I G  +R++W 
Sbjct: 393 AIKGMQGFIINGNPIRLSWG 412

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%)

Query: 325 TTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFP 384
           TT +IG +     E +L  L + FG IL       K C F+K+    +A   I  +  F 
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANAAIKGMQGFI 401

Query: 385 FQGRNLRTGWGKERN 399
             G  +R  WGK  N
Sbjct: 402 INGNPIRLSWGKSNN 416

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+   ++  L   F+ F + +   +         +  GFV F  + +A  A+  M
Sbjct: 344 VFIGGLSTSTNEYELQVLFEPFGNILSVKIPI------GKNCGFVKFKRKIEANAAIKGM 397

Query: 233 QGMPINGRAVRINWA 247
           QG  ING  +R++W 
Sbjct: 398 QGFIINGNPIRLSWG 412

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           L++GDL  DV +  L+  F+ + S+V A +  D +TG S GYG+++ +++E+A   +   
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 233 QGMPINGRAVRI 244
               I GR VRI
Sbjct: 214 NYTNIFGREVRI 225

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 63/148 (42%), Gaps = 5/148 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQTL 143
           LY+G+L K + E +L   F         KI +D K   ++ Y ++      +A   L+  
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N   I G+ VRI  + ++        T N+++  L++     T    +D F  Y +   +
Sbjct: 214 NYTNIFGREVRIMPSLRNSTMRKQIGT-NIYLAGLSLKKKGITTRIFYDYFKIYGK---I 269

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNV 231
              +    +  GF+ F ++  A + + +
Sbjct: 270 LSCKLNFEKDIGFIFFENKSIANKVIEI 297

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 163 QTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           +T N  D   LFV  +  DV DE L   F  F     A V+ D+   +SRG+GFVSFA +
Sbjct: 14  RTDNGLDMKTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNK-KSRGFGFVSFATE 72

Query: 223 EQAQEAMNVMQGMPINGRAVRINWATKRE 251
           E  ++A+   +   +NG  +R++ A +R+
Sbjct: 73  EDTKDALGKARRSKLNGNVLRVDIAKRRD 101

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           N  + +++FV ++  D   E+L   F +F     A  + D +TG ++G  FV+F ++E  
Sbjct: 287 NRKEDYSVFVRNVPYDATKESLVDHFSKFGPVKYALPVIDRETGLAKGTAFVAFRNEETY 346

Query: 226 QEAM 229
           +  +
Sbjct: 347 KSCL 350

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + +  I   +      +AF+   K  +  +AL+    ++I+G+ V +++A
Sbjct: 157 LKKIFGRFGNVVEASIPRKRDGKLCGFAFVTMKKISNCRLALENTKDLKIDGRNVAVDFA 216

Query: 159 FQSQQ 163
            Q  +
Sbjct: 217 VQKNR 221

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 115/319 (36%), Gaps = 63/319 (19%)

Query: 116 VDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEG---------------KTVRINWAFQ 160
           +  ++   NY  +E+    +A  AL TLNG+ +                    R+NWA  
Sbjct: 92  IKSEHKQANYCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINASQLSVFRLNWAVW 150

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
                 S + + LFVG+L+    +  L   F  ++ S     +M +   G+S  +GF+ F
Sbjct: 151 PTVNGLSPE-YPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIPGKSDSFGFICF 209

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXM 279
           A+ E+ + A   M G+    + +++  A  R+                           M
Sbjct: 210 ANCEERRLAAEEMNGICFQDKYIKVAIANPRD--------------------------NM 243

Query: 280 IP-----PTALGMPPM-----DGMIXXXXXXXXXXXXXXXXXXIDDMIRR---------A 320
           IP     P    +PP+     D +                   +   +R          +
Sbjct: 244 IPSSTDVPPVKNIPPLIKTANDLLTNNLNAVQEQTAQLALSTVVTGNLRSNGNIRQGLGS 303

Query: 321 PPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVAL 380
             + +T ++G +    +E +L  L + FG I+D      K C F+ +     A   I  L
Sbjct: 304 NSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGL 363

Query: 381 ANFPFQGRNLRTGWGKERN 399
             F  +G  +R  WGK  N
Sbjct: 364 HGFLVRGCPIRLSWGKTFN 382

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 55  AAGEQSAENQESSVVPASAT------QG-GRETSDRVLYVGNLDKSINEDLLKQYFQVGG 107
           A  EQ+A+   S+VV  +        QG G  + +  ++VG L   ++E  L + F+  G
Sbjct: 273 AVQEQTAQLALSTVVTGNLRSNGNIRQGLGSNSKNSTIFVGGLSTDVSEQELNELFRPFG 332

Query: 108 QITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           +I DVKI + KK       F+ + +  DA  A++ L+G  + G  +R++W 
Sbjct: 333 EIMDVKIPLGKK-----CGFVTFKRRIDAKAAIKGLHGFLVRGCPIRLSWG 378

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 17/136 (12%)

Query: 112 VKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTF 171
           +K   D   NN+N      ++   A +AL T+    + G  +R N   +    +NS ++ 
Sbjct: 260 IKTANDLLTNNLNA-----VQEQTAQLALSTV----VTGN-LRSNGNIRQGLGSNSKNS- 308

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
            +FVG L+ DV ++ L+  F  F       +M D++    +  GFV+F  +  A+ A+  
Sbjct: 309 TIFVGGLSTDVSEQELNELFRPF-----GEIM-DVKIPLGKKCGFVTFKRRIDAKAAIKG 362

Query: 232 MQGMPINGRAVRINWA 247
           + G  + G  +R++W 
Sbjct: 363 LHGFLVRGCPIRLSWG 378

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (58%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +LF+GDL+  V ++ L HAF  F +     +  D +T +S GYG+++F   ++A EA+  
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 232 MQGMPINGRAVRI 244
              + + G+ VRI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 74/147 (50%), Gaps = 5/147 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQTL 143
           L++G+LDK + E +L   F     +  VKI +D +   ++ Y ++ +  + +A+ A++  
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           + +++ GK VRI  + ++     +  T N+F  +L ++    T    ++ F  Y +   +
Sbjct: 156 SYVKLFGKEVRIMPSMRNSYFRKNIGT-NVFFTNLPLENPALTTRVFYESFRKYGR---V 211

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAMN 230
              +  R +  GFV F     A++A++
Sbjct: 212 LSCKLDRRKNIGFVYFESDISAKKAID 238

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+GDL+ +V ++ L+  F  FPS +   +  D +TG S GYG+++F   + A+ A+   
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 233 QGMPINGRAVRI 244
             + + GR VRI
Sbjct: 77  SYVNLFGREVRI 88

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 78/153 (50%), Gaps = 7/153 (4%)

Query: 80  TSDRV--LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDA 136
           TS +V  L++G+LD ++ E +L   F+V   +  VKI VD +   ++ Y ++ +  S DA
Sbjct: 10  TSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDA 69

Query: 137 NVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPS 196
             A++T + + + G+ VRI  + ++     +  T N+F  +L ++    T    ++ F  
Sbjct: 70  ETAIETFSYVNLFGREVRIMPSMRNSYFRKNIGT-NVFFSNLPLEQPALTTRVFYETFRE 128

Query: 197 YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
           Y +   +   +  R +  GFV F     A++A+
Sbjct: 129 YGK---VLSCKLDRRKNIGFVYFESDAAARKAI 158

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S+Q  +  D   LFV  +  DV DE L+  F  F     A V+ D    RSRG+GFVSFA
Sbjct: 16  SKQNDDGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            ++  +EA+   +    NG  +R++ A +R+
Sbjct: 75  VEDDTKEALAKARKTKFNGHILRVDIAKRRD 105

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
            ++  N  + F++FV ++  D  +E+L+  F +F S   A  + D  TG ++G  FV+F 
Sbjct: 280 KRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFK 339

Query: 221 DQ 222
           DQ
Sbjct: 340 DQ 341

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + +  I   +      +AF+   K  +  +AL+    ++I+G+ V +++A
Sbjct: 164 LKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFA 223

Query: 159 FQSQQ 163
            Q  +
Sbjct: 224 VQKNR 228

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 162 QQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFAD 221
           +Q  N  D   LFV  + +DV DE L+  F  F     A V+ D+   +SRG+GFVSFA 
Sbjct: 17  KQNDNGLDMKTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAV 75

Query: 222 QEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           ++  +EA+   +   + G  +R++ A +R+
Sbjct: 76  EDDTKEALKKARQTKLKGHLLRVDIAKRRD 105

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/204 (19%), Positives = 82/204 (40%), Gaps = 37/204 (18%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++   + ++ L  YF          ++ D    +  + F+ +    D   AL+ 
Sbjct: 26  KTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKK 85

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFV----------GDLNVD----VDDET-- 186
               +++G  +R++ A +  +++ SDD     V          GD N D    VD+E+  
Sbjct: 86  ARQTKLKGHLLRVDIAKRRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESLL 145

Query: 187 --------------------LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
                               L   F +F + V+A +    + G+  G+ FV+        
Sbjct: 146 KGKPKLIIRNMPWSCRDPEKLKKVFGRFGNVVEATIPR-KRDGKLCGFAFVTMKKLSNCH 204

Query: 227 EAMNVMQGMPINGRAVRINWATKR 250
            A+   + + I+GR V +++A ++
Sbjct: 205 LALENTKDLKIDGRPVAVDFAVQK 228

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%)

Query: 162 QQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFAD 221
           ++  N  + +++FV ++  D  +E+L+  F +F     A  + D  TG ++G  FV+F D
Sbjct: 293 RKGKNKREDYSIFVRNVPYDATEESLAAHFSKFGLVKYALPVIDRATGLAKGTAFVAFKD 352

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 33/65 (50%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + +  I   +      +AF+   K  + ++AL+    ++I+G+ V +++A
Sbjct: 166 LKKVFGRFGNVVEATIPRKRDGKLCGFAFVTMKKLSNCHLALENTKDLKIDGRPVAVDFA 225

Query: 159 FQSQQ 163
            Q  +
Sbjct: 226 VQKNR 230

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 162 QQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFAD 221
           +Q  N  D   LFV  + +DV DE L+  F  F     A V+ D+   +SRG+GFVSFA 
Sbjct: 17  KQNDNGLDMKTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAV 75

Query: 222 QEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           ++  +EA+   +   + G  +R++ A +R+
Sbjct: 76  EDDTKEALKQARKAKLKGHLLRVDIAKRRD 105

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           N  + F++FV ++  D  +E+L+  F +F     A  + D  TG ++G  FV+F D 
Sbjct: 298 NKKEDFSIFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDH 354

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/198 (16%), Positives = 78/198 (39%), Gaps = 31/198 (15%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++   + ++ L  YF          ++ D    +  + F+ +    D   AL+ 
Sbjct: 26  KTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKQ 85

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN--------SDDTFNLFVGDLNVDVDDET-------- 186
               +++G  +R++ A +  ++               +    D N +VD+E+        
Sbjct: 86  ARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIARDENEEVDEESLLKGKPKL 145

Query: 187 --------------LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
                         L   F +F + V+A +    + G+  G+ FV+         A+   
Sbjct: 146 IIRNMPWSCRDPNQLKKIFSRFGTVVEASIP-KKRDGKLCGFAFVTMKKLSNCTIALENT 204

Query: 233 QGMPINGRAVRINWATKR 250
           + + I+GR+V +++A ++
Sbjct: 205 KDLKIDGRSVAVDFAVQK 222

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 33/65 (50%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + +  I   +      +AF+   K  +  +AL+    ++I+G++V +++A
Sbjct: 160 LKKIFSRFGTVVEASIPKKRDGKLCGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFA 219

Query: 159 FQSQQ 163
            Q  +
Sbjct: 220 VQKNR 224

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 169 DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           D   LFV ++     D  L+  F QF     A ++ D   G SRG+GFVSFA  E  Q A
Sbjct: 14  DQKTLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGD-GNSRGFGFVSFAVDEDTQTA 72

Query: 229 MNVMQGMPINGRAVRINWATKRE 251
           +N  + M   GR +R++ A +RE
Sbjct: 73  LNEGRKMKFQGRLLRVDIAKRRE 95

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/202 (18%), Positives = 82/202 (40%), Gaps = 29/202 (14%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDA 136
           G     + L+V N+  +  +  L  +F     +    I+ D   N+  + F+ +    D 
Sbjct: 10  GHNLDQKTLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGDGNSRGFGFVSFAVDEDT 69

Query: 137 NVALQTLNGIQIEGKTVRINWAFQSQQTTNS--------------------DDTFNLFVG 176
             AL     ++ +G+ +R++ A + +++  S                    D +  +  G
Sbjct: 70  QTALNEGRKMKFQGRLLRVDIAKRRERSKKSEGDEGEGGKETASRDKTVEEDSSDAMMKG 129

Query: 177 DLNVDV--------DDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
              + +        D E L   F +F + V+  +    + GR  G+ FV+       ++A
Sbjct: 130 KPKLIIRNMPWSCRDAEKLKKIFSRFGTVVETTIPR-KRDGRLCGFAFVTMKKLANCEKA 188

Query: 229 MNVMQGMPINGRAVRINWATKR 250
           +   +G+ I+GR V +++A ++
Sbjct: 189 IEGSKGLKIDGRDVAVDFAVQK 210

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 5/78 (6%)

Query: 326 TAYIGNIPHFATEADLIPLLQNF-----GFILDFSHYPEKGCCFIKYDTHEQAAVCIVAL 380
           T ++ NIP  AT+A+L      F       I+       +G  F+ +   E     +   
Sbjct: 17  TLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGDGNSRGFGFVSFAVDEDTQTALNEG 76

Query: 381 ANFPFQGRNLRTGWGKER 398
               FQGR LR    K R
Sbjct: 77  RKMKFQGRLLRVDIAKRR 94

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 78/169 (46%), Gaps = 13/169 (7%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +++GNL     E+ L+ +F   G++ + ++M   +  +     +E+    DA  A++  N
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM-SYRGRSKGMGTVEFTNPADAEEAIRQYN 138

Query: 145 GIQIEGKTVRINW---------AFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFP 195
           G+   G+ + +            F+S + T     +  FV +L   +  + L   F +  
Sbjct: 139 GVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQ--GYEAFVVNLPYSITWQNLKDIFRECG 196

Query: 196 SYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
             ++A V  D   G SRG+G V +A++E   +A++   G  + GR + +
Sbjct: 197 DVIRADVELDY-NGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 73/203 (35%), Gaps = 40/203 (19%)

Query: 86  YVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNG 145
           +V NL  SI    LK  F+  G +    + +D    +  +  + Y    D   A+ + NG
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNG 234

Query: 146 IQIEGKTVRI---------------------------------------NWAFQSQQTTN 166
            ++EG+ + +                                       N +F    + +
Sbjct: 235 AELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGD 294

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
            +    ++  +L +      L   F        A +++D +TG S G   V +A Q+ A 
Sbjct: 295 GERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAAD 353

Query: 227 EAMNVMQGMPINGRAVRINWATK 249
             +N + G    GR + I +A++
Sbjct: 354 VCINKLNGYNYGGRDLHITYASR 376

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 6/101 (5%)

Query: 64  QESSVVPA----SATQG--GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD 117
           +E  V+P     S T+G  G    +  +Y  NL  S     L   F   G+I   +++ D
Sbjct: 274 EEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD 333

Query: 118 KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           +   +   A +EY     A+V +  LNG    G+ + I +A
Sbjct: 334 ETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYA 374

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 323 RVTTAYIGNIPHFATEADLIPLLQNFGFI-LDFSHYPEKG----CCFIKYDTHEQAAVCI 377
           R  T Y  N+P   T  DL  L  + G I +    Y E G       ++Y + + A VCI
Sbjct: 297 RNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCI 356

Query: 378 VALANFPFQGRNLRTGW 394
             L  + + GR+L   +
Sbjct: 357 NKLNGYNYGGRDLHITY 373

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 85/174 (48%), Gaps = 7/174 (4%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVAL 140
           D  +YVGN+D  +  ++L + F     +  ++   DK    +  +AF+E+  + D   A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 141 QTL-NGIQIEGKTVRI---NWAFQSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQFP 195
           + L N +++  +T+++   N A  +    N+ D    LFV +++  VD   L+  F +F 
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 196 SYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
              +A  ++ ++ G  +   +VS+   E + +A+  +    +  + + +++A K
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALK 181

>NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {ON}
           Anc_5.76 YGR250C
          Length = 717

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 86/204 (42%), Gaps = 39/204 (19%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK----------KNNNVNYAFIEYLKSH 134
           +++G ++  I+E  ++  F+  G I  +K+  D+           +N + Y FI ++   
Sbjct: 183 IFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGS 242

Query: 135 DANVALQTLNGIQIEGKTVRINWAFQSQQT----------TNSDDTFN-LFVGDLNVDVD 183
            A+  +   NG  IEG  + +N+  + ++            N D+ F  +F+G+L   + 
Sbjct: 243 QASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPTTLT 302

Query: 184 DETLSHAFDQ------------------FPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           D T+    D+                  FP     +   + ++   +GYGFV+    EQA
Sbjct: 303 DLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQA 362

Query: 226 QEAMNVMQGMPINGRAVRINWATK 249
            + +  + G+   G  + +N A +
Sbjct: 363 LKVIQTLDGLEWKGNRLVVNKAVQ 386

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSR---------GYGFVSFADQ 222
           N+F+G +N  +D+  +   F++F S +   +  D     +          GYGF+SF   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 223 EQAQEAMNVMQGMPINGRAVRINWATKRE 251
            QA E +N   G  I G  + +N+  +R+
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERK 270

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           NL++  +  D+  + L   FD F   +   ++ D+ TG S GYGF+SF    +A   +N 
Sbjct: 230 NLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINK 289

Query: 232 MQGMPINGRAVRINWATKRE 251
           + G  +NG  + IN+  +R+
Sbjct: 290 LNGTAMNGSTLFINYHVERK 309

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           LY+  + K +  D LK  F   G++  +KI+ D     ++ Y FI +    +A+  +  L
Sbjct: 231 LYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINKL 290

Query: 144 NGIQIEGKTVRINWAFQSQQT----------TNSDDTFN-LFVGDL 178
           NG  + G T+ IN+  + ++            N D+ F  +F+G++
Sbjct: 291 NGTAMNGSTLFINYHVERKEREKVFWNNFKENNDDNKFKGIFIGNI 336

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 212 RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
           +GYGF+ F + E A +AM  ++ + + G  + IN A
Sbjct: 436 KGYGFIKFQEHEHAIDAMTKLEDLRLFGNKLIINKA 471

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 169 DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           D   LFV  +   V DE L+  F  F     A V+ D+   +SRG+GFVSFA +E  +EA
Sbjct: 15  DLQTLFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNK-KSRGFGFVSFASEEDTKEA 73

Query: 229 MNVMQGMPINGRAVRINWATKRE 251
           +   +   +NG+ +R++ A +RE
Sbjct: 74  LLKARKEKLNGQLLRVDIAKRRE 96

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 34/195 (17%), Positives = 78/195 (40%), Gaps = 29/195 (14%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTL 143
            L+V  +  ++ ++ L ++F          ++ D    +  + F+ +    D   AL   
Sbjct: 18  TLFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNKKSRGFGFVSFASEEDTKEALLKA 77

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFN--------------------LFVGDLNVDV- 182
              ++ G+ +R++ A + ++    +D  N                     F G   + + 
Sbjct: 78  RKEKLNGQLLRVDIAKRRERNKRKEDASNGIAAPKPEHKEKRTYGDEDDQFKGKPKLIIR 137

Query: 183 -------DDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGM 235
                  D  TL + F +F + V AH+    + G+  G+ FV+       + A+   + +
Sbjct: 138 NMPWSCRDPNTLKNIFGRFGTVVDAHIPR-KRDGKLCGFAFVTMNKISNCKNALENTKDL 196

Query: 236 PINGRAVRINWATKR 250
            I+GR V +++A ++
Sbjct: 197 KIDGRQVAVDFAVQK 211

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           N  + +++F+ ++  +   E+L+  F +F     A  ++D +TG ++G  FV+F D+
Sbjct: 285 NMREDYSIFIRNVPYEATSESLAEHFAKFGPVKYALPVFDKETGLAKGTAFVAFKDE 341

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+G+L+ DV ++ L   F  +PS++ A V ++  T  S G+G+++F  +E A++A   M
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 233 QGMPINGRAVRI 244
               +    +RI
Sbjct: 151 NYSKVLNNEIRI 162

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 5/146 (3%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQTL 143
           L++GNLDK + E  L+  F V       K+  +   N ++ + ++ +    DA  A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203
           N  ++    +RI  + +         T N++  +L  + +  T  + +D F  Y +   +
Sbjct: 151 NYSKVLNNEIRIMPSMRDPDYRKKVGT-NVYFRNLPTENNMLTTRYFYDSFRKYGK---I 206

Query: 204 WDMQTGRSRGYGFVSFADQEQAQEAM 229
              +  RS+  GF+ FA +  A E +
Sbjct: 207 LSCKIERSKKIGFIYFACEVTANEVI 232

>TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {ON}
           Anc_2.80 YNL175C
          Length = 388

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 97/234 (41%), Gaps = 32/234 (13%)

Query: 48  DPVSEAPAAGEQSAENQESSVVPASATQGGRE-TSDRV-----LYVGNLDKSINEDLLKQ 101
           DP S      E   + Q +   P S++  G + T+D+      +++GNL     ++ L +
Sbjct: 68  DPTSVEEFKKESEVKEQATKEKPESSSADGEQPTADKKDKKYGVWIGNLSFDTTKEDLVR 127

Query: 102 YFQV-------GGQITDVKIMV---------DKKNNNVNYAFIEYLKSHDANVALQTLNG 145
           +F         G QIT+  I+           KK  N  + ++++  +     A+ +L+ 
Sbjct: 128 FFSAKTKESEDGAQITEETIVRVNMPLAQNDGKKIRNKGFCYMDFETTEQMEAAI-SLSE 186

Query: 146 IQIEGKTVRINWAFQSQQTTNSDDTFNL---------FVGDLNVDVDDETLSHAFDQFPS 196
             + G+ + I  +       + +D  +L         FVG+L+ D  DE L   F     
Sbjct: 187 SHLNGRNLLIKNSKSFDGRPDKNDLVSLSKNPPSRILFVGNLSFDTTDELLKKHFQHCGE 246

Query: 197 YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
            V+  +     +G+ +G+ FV F D+E A  A+       I  R +R+ +   R
Sbjct: 247 IVKIRMATFQDSGKCKGFAFVDFKDEEGATNALKDKGCRKIAQRPIRMEYGEDR 300

>KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 450

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 88/190 (46%), Gaps = 19/190 (10%)

Query: 79  ETSDRVLYVGNLDKSINEDLLKQYF-QVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137
           E S   L+  N   + ++  L Q F Q GG +  V++   + ++   +A+I+     +A+
Sbjct: 113 ELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRFAYIDMASKQEAS 172

Query: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTF----NLFVGDLNVDVDDETLSHAFDQ 193
           +AL+ L+G++IE   + +  +  S     +D        + V +LN + ++  LS  F +
Sbjct: 173 LALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLNYNTNEAALSAIFAK 232

Query: 194 FPSYVQAHV-------------MWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240
           F    Q ++               + +   + G+ F++F+D   A+ +++ + G  I+ R
Sbjct: 233 FGHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASCARSSLS-LNGTEIDNR 291

Query: 241 AVRINWATKR 250
            + +  A +R
Sbjct: 292 ILDVTLADRR 301

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 82/186 (44%), Gaps = 24/186 (12%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVA 139
           SD  +YVGN+D  I +D L + F     +  +K   DK       YAFIE+    DA   
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 140 LQTLNG-IQIEGKTVRINWAFQSQQTTNSDDTFN---------------LFVGDLNVDVD 183
           +Q +N  +++  + +++      +Q TNS  T N               LFV +L   +D
Sbjct: 67  IQIMNNTVKLYDRLIKV------RQVTNSVGTANLSSNNSKDIALPIAKLFVKNLADSID 120

Query: 184 DETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVR 243
            + L+  F +F   +    ++ +  G+ +    V F D E+A  A+  +    +    + 
Sbjct: 121 IDQLAKIFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRIT 179

Query: 244 INWATK 249
           I++A K
Sbjct: 180 IDYAFK 185

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           +T+SD T  ++VG+++  +  + L   F Q    ++     D      +GY F+ F ++E
Sbjct: 4   STDSDST--VYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKE 61

Query: 224 QAQEAMNVMQG-MPINGRAVRINWAT 248
            A+  + +M   + +  R +++   T
Sbjct: 62  DAEYVIQIMNNTVKLYDRLIKVRQVT 87

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 164 TTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           + N  D   LFV ++  D  D  L+  F QF     A ++ D   G SRG+GFVSFA + 
Sbjct: 9   SKNGLDLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKD-NAGSSRGFGFVSFAVES 67

Query: 224 QAQEAMNVMQGMPINGRAVRINWATKRE 251
             Q A++  +     GR +R++ A +RE
Sbjct: 68  DTQAALDKGRKTQFKGRLLRVDVAKRRE 95

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQ 222
           N  + F++FV ++  D   ETL   F +F     A  + D +TG  +G  FV+F D+
Sbjct: 283 NRRENFSVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDE 339

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 31/65 (47%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + +  I          +AF+   K  +   A++   G++I+G+ V +++A
Sbjct: 147 LKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLKIDGREVAVDFA 206

Query: 159 FQSQQ 163
            Q  +
Sbjct: 207 VQKSK 211

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 4/100 (4%)

Query: 155 INWAFQSQQTTNSDDTFN---LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRS 211
           I  A Q   +T S+D  +   LFV  +  DV DE +   F  F     A ++ D Q  +S
Sbjct: 7   IESAKQEVSSTKSNDGLDMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQK-KS 65

Query: 212 RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           RG+GFVSFA ++    A+   +   +  R +RI+ A +R+
Sbjct: 66  RGFGFVSFAVEDDTLAALKEARKTKLKDRLLRIDIAKRRD 105

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/211 (18%), Positives = 92/211 (43%), Gaps = 26/211 (12%)

Query: 65  ESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN 124
           ES+    S+T+       + L+V ++   + ++ + ++F     I    I+ D +  +  
Sbjct: 8   ESAKQEVSSTKSNDGLDMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQKKSRG 67

Query: 125 YAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQ--------------SQQTTNSD-- 168
           + F+ +    D   AL+     +++ + +RI+ A +              S+ T ++D  
Sbjct: 68  FGFVSFAVEDDTLAALKEARKTKLKDRLLRIDIAKRRDRNKKKGEESKPTSEDTESADGP 127

Query: 169 -DTFNLFVGDLNVDV--------DDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
            D  +L  G   + +        D E L + F +F + V+A +    + G+  G+ FV+ 
Sbjct: 128 IDEESLLKGKPKIIIRNMPWSCRDPEKLKNIFSRFGTVVEAKIP-KKKDGKLCGFAFVTM 186

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
                 + A+   + + I+GR V +++A ++
Sbjct: 187 KKLVNCKTAIENSKDLKIDGRKVAVDFAVQK 217

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           N  + F++FV ++  D  +E+L   F +F     A  + D +TG ++G  FV+F+ +   
Sbjct: 290 NKVEDFSVFVRNVPYDATEESLVEHFGKFGPVKYALPVIDRETGLAKGTAFVAFSSK--- 346

Query: 226 QEAMNVMQGMPING 239
           Q   + +Q  P  G
Sbjct: 347 QAYDDCLQNAPAAG 360

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 31/65 (47%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK  F   G + + KI   K      +AF+   K  +   A++    ++I+G+ V +++A
Sbjct: 155 LKNIFSRFGTVVEAKIPKKKDGKLCGFAFVTMKKLVNCKTAIENSKDLKIDGRKVAVDFA 214

Query: 159 FQSQQ 163
            Q  +
Sbjct: 215 VQKNK 219

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 64/335 (19%), Positives = 119/335 (35%), Gaps = 58/335 (17%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           +++GNL  +   + LK+YF   G++    I+   + ++     +E+  S D + A++  +
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIIT-SRGHHRGMGTVEFNNSTDVDTAIRDCD 201

Query: 145 GIQIEGKTVRIN---------------WAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSH 189
           G  + G+ + +                           D+ F +FV  L   V+ + L  
Sbjct: 202 GAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKD 261

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F      + A V+ D + G+SRG+G V  A +EQ  +A+    G    GR + +     
Sbjct: 262 MFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDVKEGKG 320

Query: 250 REXXXXXXXXXXXXXXXXXXXXXXXXXXXMIPPTALGMPPMDGMIXXXXXXXXXXXXXXX 309
                                          PP  L   P+D                  
Sbjct: 321 TSTRTAATGADTYIPRQPRNE----------PPATLKPKPLD------------------ 352

Query: 310 XXXIDDM-IRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFIL-------DFSHYPEKG 361
              ID + I     R +  +  N+P   TE+DL  L  +   ++          H+    
Sbjct: 353 ---IDPLAITTGGDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNS 409

Query: 362 CCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 396
            C  +++T E A +CI  L  + +    L+  + +
Sbjct: 410 YC--QFETPEDADICISKLDKYSYGDHELKVTYAR 442

>Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 79/180 (43%), Gaps = 12/180 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVA 139
           S   +YVGN+D  I ++ L + F     I  +K   DK       YAFIE+    DA   
Sbjct: 7   SGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYV 66

Query: 140 LQTLNG-IQIEGKTVRINWAFQSQQTTNSDDT---------FNLFVGDLNVDVDDETLSH 189
           +Q +N  +++  + +++     S    N+              LFV +L   VD E L  
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGAANASSNNSKGISLPIAKLFVKNLADSVDIEQLEK 126

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F++F   V    ++ + TG+ +   +V F D E+A  A+  +    +    + +++A K
Sbjct: 127 IFNKFGKTVNKPEIFHLSTGKLKC-AYVYFEDFEKADMAIKSLNNQLVANNRITVDYAFK 185

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           +D    ++VG+++  +  E L   F Q    ++     D      +GY F+ F  +E AQ
Sbjct: 5   TDSGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQ 64

Query: 227 EAMNVMQG-MPINGRAVRINWAT 248
             + +M   + +  R +++   T
Sbjct: 65  YVIQIMNNTVKLYDRLIKVRQVT 87

>KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.797
           YOR319W
          Length = 201

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 6/139 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           LYVGN+D  +  + L + F     +  ++   DK       YAF+      DA+ A+Q L
Sbjct: 8   LYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADYAVQLL 67

Query: 144 -NGIQIEGKTVRINWAF-QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPS-YVQA 200
            N + + G+ ++I  A   S +  ++     L+VG L   VD + L+  F +F + Y   
Sbjct: 68  HNCVTLHGRPLKIRRARPDSAEAADTAPVARLYVGGLAATVDAQQLARVFGKFGALYRPP 127

Query: 201 HVMWDMQTGRSRGYGFVSF 219
            V    + GR   Y  V F
Sbjct: 128 TVHPAGEAGRR--YALVEF 144

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQE 227
           + T NL+VG+++  V  E L   F Q    V      D      +GY FV     + A  
Sbjct: 3   NSTTNLYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADY 62

Query: 228 AMNVMQG-MPINGRAVRINWA 247
           A+ ++   + ++GR ++I  A
Sbjct: 63  AVQLLHNCVTLHGRPLKIRRA 83

>KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {ON}
           weakly similar to uniprot|Q00916 Saccharomyces
           cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog,
          Length = 301

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 4/88 (4%)

Query: 157 WAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGF 216
           W  +S    +SD    LFVG L+  VD+  L  +F ++       ++ D Q G+SRGYGF
Sbjct: 101 WHPESDANISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGF 159

Query: 217 V---SFADQEQAQEAMNVMQGMPINGRA 241
           V   S+ D +Q    + V +G+ I GR 
Sbjct: 160 VQFTSYEDSKQCFRELGVRKGIEIMGRT 187

>SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs)
          Length = 697

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 3/92 (3%)

Query: 162 QQTTNSD--DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           +Q+ N D  D   LFV  +  D +DE  +  F QF     + ++ D +  +SRG+GFVSF
Sbjct: 15  KQSPNDDGLDMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSF 73

Query: 220 ADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           A ++  +EA+   +      R +RI+ A +RE
Sbjct: 74  AVEDDTKEALAQARKAKFKNRLLRIDIAKRRE 105

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           Q +Q  N  ++F++FV ++  D   E+L   F +F     A  + D +TG ++G  FV+F
Sbjct: 287 QPRQKKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAF 346

Query: 220 ADQEQAQEAMN 230
             +E   E ++
Sbjct: 347 KTEEAFSECVD 357

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNV-NYAFIEYLKSHDANVALQTL 143
           +YVGNLD  + ++ L + F   G +  ++   DK       +AF+E+  + D   A+++L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 144 -NGIQIEGKTVRINWAFQSQQTTNSDDT-FNLFVGDLNVDVDDETLSHAFDQFPSYVQAH 201
            N + + GK +++    ++        +   LFV +L+  VD + L   F +F   V+  
Sbjct: 69  NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQP 128

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            ++ ++ G  +   ++ ++  + + EA+  +    +  R + I++A K
Sbjct: 129 EIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFK 175

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%)

Query: 76  GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHD 135
           GG   S   L+V NLD S++   L++ F   G +     +   KN  +  A+I Y     
Sbjct: 91  GGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQPEIFTLKNGTLKCAYIYYSTFKH 150

Query: 136 ANVALQTLNGIQIEGKTVRINWAFQ 160
           ++ ALQ LN   +  + + I++AF+
Sbjct: 151 SDEALQKLNKQILANRVISIDYAFK 175

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 86/195 (44%), Gaps = 31/195 (15%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD----KKNNNVNYAFIEYLKSHDANVAL 140
           L++G +DK+I    L   F V G I  +K++ D     KNN  NY F+ Y     A   +
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 141 QTLNGIQIEGKTVRINWA-----------FQSQQTTNSDDTFNLFVGDL-NVDVDDETLS 188
             LNG +I    + IN+              + +  N+ +   +F+G+L  V V+ E ++
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 189 HAF----------DQFPSY-VQAHVM----WDMQTGRSRGYGFVSFADQEQAQEAMNVMQ 233
                        +QF ++ + +H       D ++   +GYGFV  A  E+A E +N   
Sbjct: 290 CGMILETIKDRLKEQFANFEILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSFN 349

Query: 234 GMPINGRAVRINWAT 248
           G   +G  + +N A 
Sbjct: 350 GYEFHGSKLIVNRAV 364

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%)

Query: 165 TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
           TN  +   LFVG+L  ++  E L+  F  + S++ A V  +    RS G+G+++F ++E 
Sbjct: 58  TNVQNNIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKED 117

Query: 225 AQEAMNVMQGMPINGRAVRI 244
           A+ A        I G+ +RI
Sbjct: 118 AERATEDFNYNKIMGKEIRI 137

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 69/148 (46%), Gaps = 9/148 (6%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQTL 143
           L+VGNL + I  + L + F+V       K+  +  +N ++ + +I +    DA  A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHA--FDQFPSYVQAH 201
           N  +I GK +RI  + +      +  T N+F    N+ +  E L+H   +D F  Y    
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGT-NIFFS--NLPLQKEKLTHRMFYDIFRKYGN-- 180

Query: 202 VMWDMQTGRSRGYGFVSFADQEQAQEAM 229
            +  ++   S+  GFV F D   A++ +
Sbjct: 181 -VLSVKLDSSKNIGFVYFEDDTIARDVI 207

>ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL061C
           (SNP1); 1-intron
          Length = 320

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 156 NWAFQSQQTTNSDDTFN-LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGY 214
            WA ++       D F  +FVG L+ DVD+  L   F +F    +  ++ D  T + RGY
Sbjct: 91  KWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGY 150

Query: 215 GFVSFADQEQAQEA---MNVMQGMPINGRAV 242
            FV F D E +++A   + V +G+ I GR+ 
Sbjct: 151 AFVLFRDPECSKKAYREIGVHRGLMIRGRSA 181

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQ 141
           R ++VG L   ++E  L+++F   G+I  V+I+ DK  N    YAF+ +     +  A +
Sbjct: 107 RTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYR 166

Query: 142 TL---NGIQIEGKTV 153
            +    G+ I G++ 
Sbjct: 167 EIGVHRGLMIRGRSA 181

>YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-snRNP
           associated splicing factor with similarity to the
           mammalian splicing factor SAP49; proposed to function as
           a U2-snRNP assembly factor along with Hsh155p and
           binding partner Cus1p; contains two RNA recognition
           motifs (RRM)
          Length = 213

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 12/180 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVA 139
           S   +YVGN+D  I ++ L + F     +  +K   DK       YAFIE+    DA  A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 140 LQTLNG-IQIEGKTVRINWAFQSQQTTN-----SDDTF----NLFVGDLNVDVDDETLSH 189
           ++ +N  +++  + +++     S  TTN     S D       LF+ +L   +D + L  
Sbjct: 67  IKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVK 126

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F++F   ++   ++ +  G+ +   +V F D E+A  A+  +    +    + +++A K
Sbjct: 127 IFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFK 185

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           L++ NL  SI+ D L + F   G++     +    N  +  A++ +     A++A+++LN
Sbjct: 110 LFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLN 169

Query: 145 GIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSH 189
              +    + +++AF+     N+      +  D++  ++ E L H
Sbjct: 170 NQLVANNRITVDYAFKENGKGNAK-----YGDDVDRLLNKEALKH 209

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 165 TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
           T +  T +LF+G+L   V +E L   F ++ S+  A V  D  T +S GYG+++F D+  
Sbjct: 105 TKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKND 164

Query: 225 AQEAMNVMQGMPINGRAVRI 244
           A+ A          G+ V+I
Sbjct: 165 AESARKEFNYTVFFGQEVKI 184

>ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR429C (TIF35)
          Length = 269

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 168 DDTFNLFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           DD   L +  LN + D+ T+       FP+  +  V+ + +TGRSRG  +V+FA ++ A+
Sbjct: 185 DDAMTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAE 244

Query: 227 EAMNVMQGMPINGRAVRINWATKRE 251
            A+ ++ G       ++++W+  ++
Sbjct: 245 TALRLLHGRGFMNLILQVDWSKPKK 269

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           NS D   LFV  +  +  DE L++ F +      A ++ D +   SRG+GFVSFA ++  
Sbjct: 16  NSLDMKTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKN-SRGFGFVSFAVEDDT 74

Query: 226 QEAMNVMQGMPINGRAVRINWATKRE 251
           ++A+   +     GR +R++ A +RE
Sbjct: 75  KDALEKARKTKFKGRLLRVDIAKRRE 100

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 82/190 (43%), Gaps = 23/190 (12%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++     ++ L  YF     I    I+ D + N+  + F+ +    D   AL+ 
Sbjct: 21  KTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKNSRGFGFVSFAVEDDTKDALEK 80

Query: 143 LNGIQIEGKTVRINWAFQ-------------SQQTTNSDDTFN--------LFVGDLNVD 181
               + +G+ +R++ A +             S+Q  N ++  N        L + ++   
Sbjct: 81  ARKTKFKGRLLRVDIAKRRERSKGDQRSSSSSEQAGNVENKENELMGGKPKLIIRNMPWS 140

Query: 182 VDD-ETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240
           V   E L   F +F + V+A +      G+  G+ FV+       ++A+   + + I+GR
Sbjct: 141 VRKPEQLKQIFMRFGTVVEAKIP-KKPDGKLCGFAFVTMKKLAACKKAIEDSKDLKIDGR 199

Query: 241 AVRINWATKR 250
            V +++A ++
Sbjct: 200 QVAVDFAIQK 209

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           N  +  ++FV ++  D   E+L   F +F     A  + D +TG ++G  FV F  ++  
Sbjct: 294 NKHEQLSVFVRNVPYDATQESLEEHFGKFGPVKYALPVQDKETGLAKGSAFVVFKSKDAF 353

Query: 226 QEAMN 230
            E +N
Sbjct: 354 DECVN 358

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 9/118 (7%)

Query: 142 TLNGIQIEGKTVRINWAFQSQQTTNSDDTFN---------LFVGDLNVDVDDETLSHAFD 192
           +L+  Q+ G+ + I  +   +   N DD  +         LFVG+L+ D  DE L   F 
Sbjct: 184 SLSECQLNGRKLLIKNSKNYEGRPNRDDLVSMSKNPPSRILFVGNLSYDTTDELLRSHFQ 243

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
                V+        TG+ +G+ F+ F  +E A +A+       I GR +R+ +   R
Sbjct: 244 HCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDKSCRKIAGRPIRMEYGEDR 301

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL     ++LL+ +FQ  G+I  ++    +       ++FI++L    A  AL+
Sbjct: 222 RILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALK 281

Query: 142 TLNGIQIEGKTVRINWA 158
             +  +I G+ +R+ + 
Sbjct: 282 DKSCRKIAGRPIRMEYG 298

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 83/172 (48%), Gaps = 8/172 (4%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           +YVGN+D  + ++ L + F     I +++   DK    +  +AF+E+    D    +Q L
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQLL 71

Query: 144 NG-IQIEGKTVRINWA-FQSQQTTNSDDTF----NLFVGDLNVDVDDETLSHAFDQFPSY 197
           N  +Q+  + +++  A  QS  +   D T      +FV +L+  +D+  LS  F +F   
Sbjct: 72  NNTVQLYDRFLKVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPL 131

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            +   ++ +  G+ R   ++ F + + +  A+  + G  +  + V +++A K
Sbjct: 132 AKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 67  SVVPASATQGGRETSDRVL------YVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN 120
            V  A+    G +T D  +      +V NLD SI+E  L + F   G +     +    +
Sbjct: 83  KVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSD 142

Query: 121 NNVNYAFIEYLKSHD-ANVALQTLNGIQIEGKTVRINWAFQSQQTTNS 167
             +  A+I Y K++D +++AL TLNG  +  K V +++AF+     N+
Sbjct: 143 GQLRCAYI-YFKNYDHSDLALATLNGQLVVNKKVTVDYAFKENGKGNA 189

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 42/75 (56%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+  LN     + ++  F +F +     ++ D  TG S GYGF+ F D++  ++A   M
Sbjct: 244 LFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKSCEQAYKKM 303

Query: 233 QGMPINGRAVRINWA 247
           +G+ I+ R + ++++
Sbjct: 304 EGVIIDDRRIHVDFS 318

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHD 135
           G + S RVL++  L+       +   FQ  G I  V+I+ DK   +++ Y FI++     
Sbjct: 236 GIKPSPRVLFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKS 295

Query: 136 ANVALQTLNGIQIEGKTVRINWA 158
              A + + G+ I+ + + ++++
Sbjct: 296 CEQAYKKMEGVIIDDRRIHVDFS 318

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 169 DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           D   LFV  +  +  DE   + F QF     A ++ D + G SRG+GFVSFA ++  + A
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGE-GASRGFGFVSFAVEDDTKTA 71

Query: 229 MNVMQGMPINGRAVRINWATKRE 251
           +N  +     GR +RI+ A +RE
Sbjct: 72  LNQARKTKFMGRLLRIDIAKRRE 94

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           Q     N  + F++FV ++  D   E+L   F  F     A  + D +TG ++G  FV+F
Sbjct: 285 QDTVKKNRKEDFSIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAF 344

Query: 220 ADQEQAQEAMN 230
             ++   + +N
Sbjct: 345 RSEDAYNDCLN 355

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           NLFV +L+  VDDE L   F  F + + A VM   + G+S+ +GFV F+  E+A  A+  
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMR-TEDGKSKNFGFVCFSTPEEATRAITE 80

Query: 232 MQGMPINGRAVRINWATKRE 251
                + G+ + +  A ++E
Sbjct: 81  KNQQIVAGKPLYVAIAQRKE 100

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           L+V NLD S++++ L++ F   G I   K+M  +   + N+ F+ +    +A  A+   N
Sbjct: 23  LFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTEDGKSKNFGFVCFSTPEEATRAITEKN 82

Query: 145 GIQIEGKTVRINWA 158
              + GK + +  A
Sbjct: 83  QQIVAGKPLYVAIA 96

>TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.491
           YPL043W
          Length = 742

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           S  T N  D   LFV  + +D  D  L+  F  F     A ++ D Q  RSRG+GFV+FA
Sbjct: 24  SNSTDNDLDFKTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDDQK-RSRGFGFVTFA 82

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            +E  +EA+   +   +    +R++ A +R+
Sbjct: 83  VEEDTKEALKQARKTKLKNHLIRVDIAKRRD 113

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%)

Query: 160 QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF 219
           Q +   N  + F++FV ++  D  +E+L   F +F     A  + D +TG ++G  FV+F
Sbjct: 304 QEKSKQNRREDFSVFVRNVPYDASEESLVEHFTKFGPVKYALPVIDRETGLAKGTAFVAF 363

Query: 220 ADQE 223
            +++
Sbjct: 364 RNKD 367

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK+ F   G + D  I   +      +AF+   K  +  +AL+    ++I+G+ V +++A
Sbjct: 175 LKKIFSRFGNVVDASIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRAVAVDFA 234

Query: 159 FQSQQTTNSDDTFN 172
            Q  +  +   T N
Sbjct: 235 IQKNRWEDYKKTHN 248

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 38/205 (18%), Positives = 80/205 (39%), Gaps = 38/205 (18%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++     +  L  YF     I    I+ D +  +  + F+ +    D   AL+ 
Sbjct: 34  KTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDDQKRSRGFGFVTFAVEEDTKEALKQ 93

Query: 143 LNGIQIEGKTVRINWAFQ---------SQQTTNSDDTFNLFV----GDLNVDVDDE---- 185
               +++   +R++ A +         S+Q +N  ++    V    G+ N D +D     
Sbjct: 94  ARKTKLKNHLIRVDIAKRRDRNKTKASSEQISNDQNSEKKQVIDNHGEYNNDNEDPEDSE 153

Query: 186 --------------------TLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
                                L   F +F + V A +    + G+  G+ FV+       
Sbjct: 154 FKGKPKLIIRNMPWSCRDPIKLKKIFSRFGNVVDASIPR-KRDGKLCGFAFVTMKKISNC 212

Query: 226 QEAMNVMQGMPINGRAVRINWATKR 250
           + A+   + + I+GRAV +++A ++
Sbjct: 213 RIALENTKDLKIDGRAVAVDFAIQK 237

>KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q00916 Saccharomyces cerevisiae
           YIL061C SNP1 U1snRNP 70K protein homolog
          Length = 278

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 7/106 (6%)

Query: 144 NGIQIEGKTVRINWAF----QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQ 199
           N  Q+E K +    A     +     +SD    +FVG L   V +  L   F +F    +
Sbjct: 71  NARQVEAKALNAKLAIWNPDEDPNIADSDPYRTIFVGRLPFAVTEVELQKEFVRFGEIEK 130

Query: 200 AHVMWDMQTGRSRGYGFVSFADQEQAQEA---MNVMQGMPINGRAV 242
             V+ D  + +SRGYGF+ F D+  A+ A   + V +G+ I GR V
Sbjct: 131 VRVVRDKTSNKSRGYGFIMFKDEISARSACREIGVHRGVQIGGRPV 176

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R ++VG L  ++ E  L++ F   G+I  V+++ DK +N    Y FI +     A  A +
Sbjct: 102 RTIFVGRLPFAVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKDEISARSACR 161

Query: 142 TL---NGIQIEGKTV 153
            +    G+QI G+ V
Sbjct: 162 EIGVHRGVQIGGRPV 176

>ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL175C
           (NOP13)
          Length = 375

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 81/190 (42%), Gaps = 25/190 (13%)

Query: 85  LYVGNLDKSINEDLLKQYF------QVGGQITDVKIMV---------DKKNNNVNYAFIE 129
           +++GN+     ++ L+++          G++TD  I+           K+  N  +A+++
Sbjct: 107 VWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVD 166

Query: 130 YLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN---------LFVGDLNV 180
           +  S   + A+  L+  Q+ G+ + I  A         +D  +         LFVG+L+ 
Sbjct: 167 FATSAQMD-AVIGLSEAQLNGRNLLIKNAKSYDGRPAKNDLISMSKNPPSRILFVGNLSF 225

Query: 181 DVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240
           D  DE L   F      V+  +     +G+ +G+ FV F D+  A  A+       I GR
Sbjct: 226 DTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSCRAIAGR 285

Query: 241 AVRINWATKR 250
            +R+ +   R
Sbjct: 286 PLRMEYGEDR 295

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 86/206 (41%), Gaps = 33/206 (16%)

Query: 77  GRETSDRV------LYVGNLD-KSINEDLLKQYFQVGGQITDVKIMVDKKN--------- 120
           G+E++D+       +++GNL   +  EDL++       Q  D + +V++K+         
Sbjct: 98  GKESADKPKEEKFGVWIGNLSFDTTREDLMRFILGKTKQNEDSEKVVEEKDIVRFKLPLA 157

Query: 121 -------NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN- 172
                   N  + +I++         L+ LN  Q+ G+ + I  +   +   + +D  + 
Sbjct: 158 NNDGKKIKNKGFCYIDFSTEQKMKAVLE-LNENQLNGRNLLIKNSKNFEGRPDKNDLVSM 216

Query: 173 --------LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
                   LFVG+L+ D  DE L   F      ++  +     +G+ +G+ FV F  +E 
Sbjct: 217 SKNPPSRILFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEG 276

Query: 225 AQEAMNVMQGMPINGRAVRINWATKR 250
           A  A+       I  R +R+ +   R
Sbjct: 277 ATNALKDKTCRRIASRPIRMEYGEDR 302

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFV  LN   + + L+  F +F   +   ++ D  TGRS GYGF+ F  +   + A + M
Sbjct: 244 LFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNM 303

Query: 233 QGMPINGRAVRINWA 247
           +G+ I+ + + ++++
Sbjct: 304 EGVIIDDKKIHVDFS 318

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 10/103 (9%)

Query: 62  ENQESSV-----VPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMV 116
           ENQE ++     +P+S  +  +     VL+V  L+   N   L Q F   GQI  V+I+ 
Sbjct: 220 ENQELALEIIGDIPSSTIKPLK----TVLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVR 275

Query: 117 DKKN-NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           DK    ++ Y FIE+       +A   + G+ I+ K + ++++
Sbjct: 276 DKDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDFS 318

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 158 AFQSQQTTNSDDTFN--LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYG 215
           A +++Q    DD ++  ++V  L     ++ LS  F QF    +A +  + ++G SR YG
Sbjct: 76  AAKNKQGNTKDDEYSSIIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYG 135

Query: 216 FVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
           FV FA++E A+ A   M    + G  +R+    K
Sbjct: 136 FVEFANKEDAKVAQETMDNYLLMGHLLRVRLMGK 169

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQT 142
           ++YV  L    +E  L +YF   G + + ++  +KK+ N+ +Y F+E+    DA VA +T
Sbjct: 92  IIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKEDAKVAQET 151

Query: 143 LNGIQIEGKTVRI 155
           ++   + G  +R+
Sbjct: 152 MDNYLLMGHLLRV 164

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 160 QSQQTTNSD--DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFV 217
           +S  ++  D  D   LFV  +  D  DE L++ F        A ++ D Q   SRG+GFV
Sbjct: 8   ESNSSSRKDLLDMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFV 66

Query: 218 SFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           SFA ++  ++A++  +     GR +R++ A +R+
Sbjct: 67  SFAVEDDTKDALDKARKTKFKGRLLRVDIAKRRD 100

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           N  +   +FV ++  D   E+L   F++F     A  + D +TG ++G  FV F  QE  
Sbjct: 286 NKKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQEAF 345

Query: 226 QEAMN 230
            E +N
Sbjct: 346 DECVN 350

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 79/190 (41%), Gaps = 23/190 (12%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++     ++ L  YF     I    I+ D + N+  + F+ +    D   AL  
Sbjct: 21  KTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDK 80

Query: 143 LNGIQIEGKTVRINWAFQSQQTTN-------SDDTF--------------NLFVGDLNVD 181
               + +G+ +R++ A +  +T         S+DT                L V ++   
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWS 140

Query: 182 VDD-ETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGR 240
           V + + L   F ++ + V+A +      G+  G+ FV+       + A+   + + I GR
Sbjct: 141 VRNPDELKKIFMRYGTVVEAKIP-KRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGR 199

Query: 241 AVRINWATKR 250
            V +++A ++
Sbjct: 200 QVAVDFAVQK 209

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 199 QAHVMWDMQ---TGRSRGYGFVSFADQEQA 225
           QA V+ +++   TGRSRGYGFV F D + A
Sbjct: 538 QAKVIMEVKGSSTGRSRGYGFVEFRDHKAA 567

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 85  LYVGNLDKSI-NEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTL 143
           L V N+  S+ N D LK+ F   G + + KI          +AF+   K     +A++  
Sbjct: 132 LIVRNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEES 191

Query: 144 NGIQIEGKTVRINWAFQSQQ 163
             ++I G+ V +++A Q  +
Sbjct: 192 KSLKIGGRQVAVDFAVQKNK 211

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 162 QQTTNSDDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFA 220
           + +   DD   L +  LN + D+ TL       F    +A V+ + +TGRSRG  FV+F+
Sbjct: 184 RDSKERDDMCTLKIMQLNENADENTLREELLFPFAPIPKAVVVRNRETGRSRGLAFVTFS 243

Query: 221 DQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
            +E A++A++ + G       +R+ W+  ++
Sbjct: 244 SEEMAEKALHFLDGRGFMNLILRVEWSKPKK 274

>TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {ON}
           Anc_7.159 YIR005W
          Length = 140

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 56/89 (62%), Gaps = 3/89 (3%)

Query: 85  LYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDKK-NNNVNYAFIEYLKSHDANVALQT 142
           +++GNL+K++ E D+L  + Q G  I D+K++ +K+ N+++ +A+++Y  S    +A+  
Sbjct: 36  IFIGNLNKNLTEGDILTVFSQFGNPI-DLKLIRNKQTNHSMGFAYLKYEDSRSCILAIDN 94

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDDTF 171
           LNG ++ G T++I+  +       +D+ +
Sbjct: 95  LNGSKVAGNTLKIDHFWHDPNKNKNDEEY 123

 Score = 40.0 bits (92), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 140 LQTLNGIQIEGKTVRI--NWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197
           +Q LN  +++   + I  +W +      N  D   +F+G+LN ++ +  +   F QF + 
Sbjct: 7   IQQLNDTELQNNILSIEKSWHY------NYIDYGYIFIGNLNKNLTEGDILTVFSQFGNP 60

Query: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRIN 245
           +   ++ + QT  S G+ ++ + D      A++ + G  + G  ++I+
Sbjct: 61  IDLKLIRNKQTNHSMGFAYLKYEDSRSCILAIDNLNGSKVAGNTLKID 108

>KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.250
           YIL061C
          Length = 305

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           +D    +FVG L  D  +  L   F ++ +  +  V+ D ++ +SRGYGFV FAD + ++
Sbjct: 98  TDPYKTIFVGRLPYDTTELDLQEIFGKYGAVDKVRVVRD-KSNKSRGYGFVLFADPQASK 156

Query: 227 EAMN---VMQGMPINGRAVRINWATKR 250
             M    V +G+PI GR   +++   R
Sbjct: 157 RTMRETGVHRGIPIKGRTCIVDFERGR 183

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + ++VG L     E  L++ F   G +  V+++ DK N +  Y F+ +     +   ++ 
Sbjct: 102 KTIFVGRLPYDTTELDLQEIFGKYGAVDKVRVVRDKSNKSRGYGFVLFADPQASKRTMRE 161

Query: 143 L---NGIQIEGKTVRINW 157
                GI I+G+T  +++
Sbjct: 162 TGVHRGIPIKGRTCIVDF 179

>TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON}
           Anc_5.536 YDR429C
          Length = 278

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 168 DDTFNLFVGDLNVDVDDETLSHA----FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           DD   L +  LN + D+ TL       F   P  V   V+ + +TGRSRG  FV+FA +E
Sbjct: 189 DDMATLKITQLNENADENTLREELLFPFAPIPKVV---VVRNRETGRSRGLSFVTFASEE 245

Query: 224 QAQEAMNVMQGMPINGRAVRINWA 247
            A++A++ + G       +R+ W+
Sbjct: 246 IAEQALHFLDGRGFMNLILRVEWS 269

>Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 83/180 (46%), Gaps = 12/180 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVA 139
           S   +YVGNLD  I ++ L + F     +  +K   DK    +  YAFIE+    DA   
Sbjct: 7   SGNTVYVGNLDPRITKEQLYELFIQINPVLRIKYPKDKVLQTHQGYAFIEFYNREDAQYV 66

Query: 140 LQTL-NGIQIEGKTVRINWAFQSQQTTN------SDDTF---NLFVGDLNVDVDDETLSH 189
           +Q + N +++  + +++     S  T+N       D T     LF+ +L   ++ + L+ 
Sbjct: 67  IQIMHNTVKLYDRLIKVRQVTSSIGTSNLASNSSRDITLPVAKLFIKNLADSINCDQLTK 126

Query: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F++F   +    ++ +  G+ +   +V F D E+A  A+  +    +    + +++A K
Sbjct: 127 IFNKFGRTISEPKIFHLSNGKLKC-AYVYFEDFEKADLAIKSLDNQLVANSRINVDYAFK 185

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           N+D    ++VG+L+  +  E L   F Q    ++     D      +GY F+ F ++E A
Sbjct: 4   NTDSGNTVYVGNLDPRITKEQLYELFIQINPVLRIKYPKDKVLQTHQGYAFIEFYNREDA 63

Query: 226 QEAMNVMQG-MPINGRAVRINWAT 248
           Q  + +M   + +  R +++   T
Sbjct: 64  QYVIQIMHNTVKLYDRLIKVRQVT 87

>NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa]
           {ON} Anc_4.33 YHL024W
          Length = 626

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 68  VVPASATQGGRETSDRVLYVGNLDKSINEDLL----KQYFQVGGQITDVKIMVDKKNNNV 123
           + PA  T+  R      ++V +L  ++ +D L      YF+  G+I  VK++ D+ N   
Sbjct: 43  IPPAMNTKPFRGRPSSCVFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQANRP- 101

Query: 124 NYAFIEYLKSHDANVALQTLNGIQIEGKTVR 154
            YAF++Y    DAN AL+T +G  + G+ +R
Sbjct: 102 -YAFVQYTNDKDANNALKTAHGSLLNGRRLR 131

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + ++VG L +   ++ L+ +F   G+I D+ ++   K  NV +AFI+Y     A  AL+T
Sbjct: 277 KSIFVGQLPQETTKEDLETHFWKHGKILDLNLI--HKPTNV-FAFIQYESEKSAAAALET 333

Query: 143 LNGIQIEGKTVRINW 157
            N      KT+ + +
Sbjct: 334 ENHSIFISKTIHVQY 348

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 173 LFVGDLNVDVDDETL----SHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           +FV  L   + D+ L    +  F +F   V+  V+ D     +R Y FV + + + A  A
Sbjct: 60  VFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQA---NRPYAFVQYTNDKDANNA 116

Query: 229 MNVMQGMPINGRAVR 243
           +    G  +NGR +R
Sbjct: 117 LKTAHGSLLNGRRLR 131

>TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.491
           YPL043W
          Length = 697

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQA 225
           N  D   LFV  + +   D+  +  F  F     A ++ D    +SRG+GFVSFA +E +
Sbjct: 17  NEFDLKTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNK-KSRGFGFVSFASEEDS 75

Query: 226 QEAMNVMQGMPINGRAVRINWATKRE 251
           QEA+   +   I    +R+++A +R+
Sbjct: 76  QEALTKARTSKIQNHLLRVDFAKRRD 101

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           N  + +++F+ ++  D  +E+L+  F +F     A  + D  TG ++G  FV+F DQ+
Sbjct: 300 NRQEDYSVFIRNVPYDATEESLAEHFTKFGDVKYALPVIDRNTGLAKGTAFVAFKDQK 357

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 36/207 (17%), Positives = 83/207 (40%), Gaps = 40/207 (19%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++     +D    +F     +    I+ D    +  + F+ +    D+  AL  
Sbjct: 22  KTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNKKSRGFGFVSFASEEDSQEALTK 81

Query: 143 LNGIQIEGKTVRINWAFQ----SQQTTNSDDTFNLFVG-------------DLNVDVDDE 185
               +I+   +R+++A +      +T  S+ T  +                D + D D+E
Sbjct: 82  ARTSKIQNHLLRVDFAKRRDRSKTRTEGSEQTKEIVKKTFKKSATERDDGKDEDKDFDEE 141

Query: 186 T----------------------LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           +                      L + F ++ +  +A +    + G+  G+ FV+F +  
Sbjct: 142 SSLKGKPKLIIRNMPWSCRDSAKLKNIFSRYGTVDEATIPR-KRDGKLCGFAFVTFKNLA 200

Query: 224 QAQEAMNVMQGMPINGRAVRINWATKR 250
             + A+   +G+ I+GRAV +++A ++
Sbjct: 201 NCKVALEKSKGLKIDGRAVAVDFAVQK 227

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%)

Query: 99  LKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           LK  F   G + +  I   +      +AF+ +    +  VAL+   G++I+G+ V +++A
Sbjct: 165 LKNIFSRYGTVDEATIPRKRDGKLCGFAFVTFKNLANCKVALEKSKGLKIDGRAVAVDFA 224

Query: 159 FQSQQTTN 166
            Q  +  N
Sbjct: 225 VQKNRWEN 232

>SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 10/142 (7%)

Query: 118 KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN----- 172
           KK  N  +A++++      N  +  L+  Q+ G+ + I  +   +   + +D        
Sbjct: 168 KKIRNKGFAYMDFKNKEQMNAVI-GLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNP 226

Query: 173 ----LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
               LFVG+L+ D  DE L   F      V+  +     +G+ +G+ F+ F D++   EA
Sbjct: 227 PSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEA 286

Query: 229 MNVMQGMPINGRAVRINWATKR 250
           +       I GR +R+ +   R
Sbjct: 287 LTDKSCRKIAGRPLRMEFGEDR 308

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL     ++LL+++FQ  G+I  V++   + +     +AFI++        AL 
Sbjct: 229 RILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALT 288

Query: 142 TLNGIQIEGKTVRINWA 158
             +  +I G+ +R+ + 
Sbjct: 289 DKSCRKIAGRPLRMEFG 305

>ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {ON}
           similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043W NOP4 Nucleolar protein essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis contains four RNA recognition motifs
           (RRMs)
          Length = 714

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 169 DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           D   LFV  +  +  DE LS  F  F     A ++ D +  +SRG+GFVSFA ++   EA
Sbjct: 25  DMKTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKD-KNQKSRGFGFVSFAVEDDTMEA 83

Query: 229 MNVMQGMPINGRAVRINWATKR 250
           +   +   +NG  VR++ A +R
Sbjct: 84  LKQARRTKLNGHQVRVDLAKRR 105

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 166 NSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           N  + +++FV ++  D  +E+L+  F++F     A  + D +TG +RG  F++F +++
Sbjct: 304 NRTEEYSVFVKNVPYDATEESLAEHFEKFGPVKYALPVIDRETGLARGTAFIAFRNKQ 361

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 35/201 (17%), Positives = 79/201 (39%), Gaps = 34/201 (16%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + L+V ++  +  ++ L  +F     I    ++ DK   +  + F+ +    D   AL+ 
Sbjct: 27  KTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKDKNQKSRGFGFVSFAVEDDTMEALKQ 86

Query: 143 LNGIQIEGKTVRINWAFQSQQTTNSDD-------------------------TFNLFVGD 177
               ++ G  VR++ A +  ++  +D+                            L  G 
Sbjct: 87  ARRTKLNGHQVRVDLAKRRHRSGKNDEGAQHQQQAAEVHIARHNEGDHEDDDEDALLKGK 146

Query: 178 LNVDV--------DDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
             + +        D E L   F ++   V+A +      G+ RG+ FV+       ++A+
Sbjct: 147 PKIIIRNMPWSCRDPEKLKSIFGKYGLVVEATIPR-KPNGQLRGFAFVTMKKISNCKKAI 205

Query: 230 NVMQGMPINGRAVRINWATKR 250
              + + I+GR V +++A ++
Sbjct: 206 EDSKNLKIDGRPVAVDFAVQK 226

>Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 91/224 (40%), Gaps = 57/224 (25%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQTL 143
           ++VG + KS++   L   F   G +  +K++ DK     N Y F  Y     A++ ++ L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIREL 256

Query: 144 NGIQIEGKTVRINWAFQSQQT----------TNSDDTFN-LFVGDLN------------- 179
           NG  + G T+ IN+  + ++            N+DD +  LF+G+L              
Sbjct: 257 NGKTVSGSTLFINYHVERKERERIHWDHVKENNNDDNYRCLFIGNLPYHNTEKEESLITP 316

Query: 180 ---VDVDDETLSHAFDQFP--SY---------------------VQAHVMWDMQTGRS-- 211
              +DV    LS  F  F   SY                     V ++ + ++  G +  
Sbjct: 317 KDVIDVIKRELSKRFSDFDIISYYFPKKSNARSSSSVSFQDDGSVDSNKISNITAGAAQE 376

Query: 212 ----RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
               +GYGF+   + EQA  A+ +  G   +G  + +N A + +
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIEIFNGFMWHGNRLVVNKAVQHK 420

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           N+FVG +   +    LS  F ++   +   +++D   G   GYGF S+    QA   +  
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIRE 255

Query: 232 MQGMPINGRAVRINWATKRE 251
           + G  ++G  + IN+  +R+
Sbjct: 256 LNGKTVSGSTLFINYHVERK 275

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 206 MQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING-RAVRINWATKR 250
           +  G SRGYGFVSF     A +A++   G  ++  + + +++A KR
Sbjct: 594 LPVGSSRGYGFVSFESPLDAAKAISNTDGYQVSKDQVLSVSFAQKR 639

>KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.167
           YNL110C
          Length = 229

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 63  NQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK-NN 121
            +  +      + G R+    +LYV  L    +E  L +YF   G + +V++  +KK  N
Sbjct: 80  KRRDTAAAGGKSSGARDEHSSILYVSRLPHGFHERELSRYFSQFGDLKEVRLARNKKTGN 139

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRIN 156
           + +Y FIE+ +  DA VA +T+N   + G  +++ 
Sbjct: 140 SRHYGFIEFAEVGDAQVAQETMNNYLLMGHLLQVR 174

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA---DQEQAQEAM 229
           L+V  L     +  LS  F QF    +  +  + +TG SR YGF+ FA   D + AQE M
Sbjct: 102 LYVSRLPHGFHERELSRYFSQFGDLKEVRLARNKKTGNSRHYGFIEFAEVGDAQVAQETM 161

Query: 230 N 230
           N
Sbjct: 162 N 162

>ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [1230
           bp, 409 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 409

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/347 (18%), Positives = 123/347 (35%), Gaps = 80/347 (23%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           ++VGNL      + LK YF   G +    I+   + ++     +E+  + D + A++  +
Sbjct: 105 VFVGNLTYDCAPEDLKDYFSQIGNVVRADIIT-SRGHHRGMGTVEFTNTEDVDEAIRRFD 163

Query: 145 GI----------------------QIEGKTVRINWAFQSQQTTNSDDT--------FNLF 174
           G                       +++ +     +A  S  + N  +         + +F
Sbjct: 164 GAYFMDRQIFVRQDNPPPESNSHERVQERRKERTFAGASSGSNNGTNAGGNSNGPIYEVF 223

Query: 175 VGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQG 234
           V +L   ++ + L   F +  + ++A V    + G SRG+G V +   E+ Q+A+    G
Sbjct: 224 VANLPYSINWQALKDMFKECGNVIRADVEL-ARNGYSRGFGTVIYGTPEEMQDAIARFHG 282

Query: 235 MPINGRAVRINWATKREXXXXXXXXXXXXXXXXXXXXXXXXXXXMIPPTALGMPPMDGMI 294
             + GR + +    K                                 +A+  PP + + 
Sbjct: 283 YELEGRILEVREGRK---------------------------------SAVDPPPQEPID 309

Query: 295 XXXXXXXXXXXXXXXXXXIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFI--- 351
                              +++I          Y  N+P     +DL  L +  G +   
Sbjct: 310 DSSNFNSEFTEGVTDGGERNNLI----------YCANLPFSTATSDLYDLFETIGKLNNA 359

Query: 352 -LDF-SHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 396
            L F S     G   ++Y+  E A VCI  L N+ + G +L   +GK
Sbjct: 360 ELRFDSKGAPTGVAIVEYENVEDADVCIDRLNNYNYGGCDLEISYGK 406

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 74  TQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKS 133
           T GG   +  ++Y  NL  S     L   F+  G++ + ++  D K      A +EY   
Sbjct: 323 TDGGERNN--LIYCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAPTGVAIVEYENV 380

Query: 134 HDANVALQTLNGIQIEGKTVRINWA 158
            DA+V +  LN     G  + I++ 
Sbjct: 381 EDADVCIDRLNNYNYGGCDLEISYG 405

>SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 aa]
           {ON} similar to uniprot|Q00916 Saccharomyces cerevisiae
           YIL061C SNP1 U1snRNP 70K protein homolog
          Length = 302

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 155 INWAFQSQQTTNSDDTFN-LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRG 213
           + W  ++ +     D F  +F+G L  +V +  L   F +F    +  V+ D  T +SRG
Sbjct: 90  LEWDPENDEHIKGTDPFRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRG 149

Query: 214 YGFVSFADQEQAQEA---MNVMQGMPINGRAV 242
           Y F+ F D+  ++ A   + V +G+ I GR+V
Sbjct: 150 YAFIVFRDETGSRAACKEIGVHRGLDIQGRSV 181

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R +++G L   + E  L+++F   G+I  V+++ DK  +    YAFI +     +  A +
Sbjct: 107 RTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACK 166

Query: 142 TL---NGIQIEGKTV 153
            +    G+ I+G++V
Sbjct: 167 EIGVHRGLDIQGRSV 181

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 95/217 (43%), Gaps = 31/217 (14%)

Query: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLD-KSINEDLLKQYFQVGG-QITDVKIMV 116
           +  E+++S+    S+ +  R+     +++GNL   +  ED+ +  F VG  + TDV+I  
Sbjct: 92  KDGESKDSAKESESSVKDSRKNG---VWIGNLSFDTTKEDITR--FIVGKTKGTDVEITE 146

Query: 117 D--------------KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQ 162
           +              K+  N  + ++++        A++ L+  Q+ G+ + I  +   +
Sbjct: 147 EDLVRVNMPLAKNDGKQIKNKGFCYVDFKTQEQVEAAIK-LSESQLNGRNLLIKNSKSYE 205

Query: 163 QTTNSDDTFN---------LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRG 213
              +  D  +         LFVG+L+ D  DE L   F      V+  +     +G+ +G
Sbjct: 206 GRPDKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKG 265

Query: 214 YGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250
           + FV F ++E A  A+       I GR +R+ +   R
Sbjct: 266 FAFVDFKNEEGATNALKDKSCRKIAGRPLRMEFGEDR 302

>TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.382
           YHR086W
          Length = 362

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%)

Query: 322 PRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALA 381
           P  TT +IG +    TE +L  L Q FG I+       KGC F++Y+T + A + I  + 
Sbjct: 252 PTNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGCGFVQYETRKAAELAIHKMK 311

Query: 382 NFPFQGRNLRTGWGKERNT 400
               +   +R  WGK   T
Sbjct: 312 GVSIKNSKIRLSWGKAAKT 330

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 81  SDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVAL 140
           ++  +++G L   + E+ L+  FQ  G+I  VKI   K        F++Y     A +A+
Sbjct: 253 TNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGK-----GCGFVQYETRKAAELAI 307

Query: 141 QTLNGIQIEGKTVRINWAFQSQQTTNS 167
             + G+ I+   +R++W  ++ +T+N+
Sbjct: 308 HKMKGVSIKNSKIRLSWG-KAAKTSNT 333

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G L+  V +  L   F  F   V   + +       +G GFV +  ++ A+ A++ M
Sbjct: 257 VFIGGLSSLVTENELRSLFQPFGEIVYVKIPF------GKGCGFVQYETRKAAELAIHKM 310

Query: 233 QGMPINGRAVRINWA 247
           +G+ I    +R++W 
Sbjct: 311 KGVSIKNSKIRLSWG 325

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+  LN     E ++  F++F   +   ++ D +TG S GYGF+ F  +E  ++A + M
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 233 QGMPINGRAVRINWA 247
               I+ R + ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 75  QGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKS 133
           + G + ++ VL++  L+     + +   F+  G +  V+I+ DKK  N++ Y FIE+   
Sbjct: 233 KAGIKPAENVLFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETK 292

Query: 134 HDANVALQTLNGIQIEGKTVRINWA 158
                A   ++   I+ + + ++++
Sbjct: 293 EACEQAYSKMDNTLIDDRRIHVDFS 317

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN--------- 172
           N  + ++++ K+ +  +A+  L+  Q+ G+ + +  +   +   + +D  +         
Sbjct: 165 NKGFCYLDF-KTDEKMLAVVALSESQLNGRNLLVKNSKDYEGRPDKNDLISMSKNPPSRI 223

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFVG+L+ D  D+ L   F      ++  +     TG+ +G+ FV F ++E A +A+   
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 233 QGMPINGRAVRINWATKR 250
               I GR +R+ +   R
Sbjct: 284 SCRKIAGRPLRMEFGEDR 301

>Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947)
           [999 nt, 333 aa]
          Length = 332

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 10/78 (12%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQT-------GRSRGYGFVSFADQ--- 222
           +FVG L  DV++  L   F++F    +  ++ D +T       G SRGY F+ FADQ   
Sbjct: 110 IFVGRLPYDVNEMDLQKLFNKFGQIEKVRIVRDKKTITKTNPLGNSRGYAFIVFADQLSS 169

Query: 223 EQAQEAMNVMQGMPINGR 240
           + A + + V +G+ INGR
Sbjct: 170 KMACKEIGVHRGIEINGR 187

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN--------NNVNYAFIEYLKSH 134
           R ++VG L   +NE  L++ F   GQI  V+I+ DKK         N+  YAFI +    
Sbjct: 108 RTIFVGRLPYDVNEMDLQKLFNKFGQIEKVRIVRDKKTITKTNPLGNSRGYAFIVFADQL 167

Query: 135 DANVALQTL---NGIQIEGK 151
            + +A + +    GI+I G+
Sbjct: 168 SSKMACKEIGVHRGIEINGR 187

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFVG+L+ D  DE L   F      V+  +     TG+ +G+ FV F D+E    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 233 QGMPINGRAVRINWATKR 250
               I GR +R+ +   R
Sbjct: 297 TCRKIAGRPLRMEFGEDR 314

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL     ++LLK++FQ  G I  +++   +       +AF+++        AL+
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALK 294

Query: 142 TLNGIQIEGKTVRINWA 158
                +I G+ +R+ + 
Sbjct: 295 DKTCRKIAGRPLRMEFG 311

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFVG+L+ D  DE L   F      V+  +     +G+ +G+ FV F ++E A +A++  
Sbjct: 235 LFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDK 294

Query: 233 QGMPINGRAVRINWATKR 250
               I GR +R+ +   R
Sbjct: 295 SCRKIAGRPLRMEFGEDR 312

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL     ++LL+++FQ  G I  +++   + +     +AF+++     A  AL 
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 142 TLNGIQIEGKTVRINWA 158
             +  +I G+ +R+ + 
Sbjct: 293 DKSCRKIAGRPLRMEFG 309

>Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp,
           331 aa] {ON} similar to Ashbya gossypii ADL063W 1-intron
          Length = 331

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 6/118 (5%)

Query: 129 EYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN-LFVGDLNVDVDDETL 187
            +L  ++   +L   N   +E +  +  W  +     N  D F  +FVG L  +VD+  L
Sbjct: 66  RHLDKYEEVRSLTARNERLLEAEQAK--WVPEEDSNINDTDPFRTIFVGRLPYEVDELEL 123

Query: 188 SHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA---MNVMQGMPINGRAV 242
              F +F    +  ++ D  T   +GY FV F D E +++A   + V +G+ I GR V
Sbjct: 124 QKQFIKFGDIERVRIVRDKLTNEPKGYAFVLFKDTEGSRKAYREIGVHRGLLIKGRPV 181

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 49/90 (54%), Gaps = 6/90 (6%)

Query: 156 NWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYG 215
           +W F+ +      D   +FVG L+ D+ +  +   F Q+   V   ++ D ++G S+G+ 
Sbjct: 25  SWHFEYK------DQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFA 78

Query: 216 FVSFADQEQAQEAMNVMQGMPINGRAVRIN 245
           ++ + DQ     A++ + G+ I GR++R++
Sbjct: 79  YLKYEDQRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 47/74 (63%), Gaps = 3/74 (4%)

Query: 85  LYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQT 142
           ++VG L K + E D+L  + Q G  + D+K++ D+++  +  +A+++Y       +A+  
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPV-DLKLVRDRESGESKGFAYLKYEDQRSTVLAVDN 94

Query: 143 LNGIQIEGKTVRIN 156
           LNG++I G+++R++
Sbjct: 95  LNGVKIAGRSIRVD 108

>YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON}
           Putative RNA binding protein; localizes to stress
           granules induced by glucose deprivation; interacts with
           Rbg1p in a two-hybrid
          Length = 781

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 91/224 (40%), Gaps = 57/224 (25%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQTL 143
           ++VG + KS++   L   F   G I  +K++ DK     N Y FI Y     A++ ++ L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKEL 256

Query: 144 NGIQIEGKTVRINWAFQSQQT----------TNSDDTFN-LFVGDLN------------- 179
           NG  + G T+ IN+  + ++            N+DD F  LF+G+L              
Sbjct: 257 NGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLITP 316

Query: 180 ---VDVDDETLSHAFDQFP--SY---------------------VQAHVMWDMQTGRS-- 211
              ++V  + LS  F  F   SY                     V+++   +   G +  
Sbjct: 317 KEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNAQD 376

Query: 212 ----RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
               +GYGF+   + EQA  A+    G   +G  + +N A + +
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHK 420

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           N+FVG +   +    LS  F ++   +   +++D   G   GYGF+S+    QA   +  
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 232 MQGMPINGRAVRINWATKRE 251
           + G  +NG  + IN+  +R+
Sbjct: 256 LNGRTVNGSTLFINYHVERK 275

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 205 DMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING-RAVRINWATKR 250
           D+  G SRGYGFVSF     A +A+    G  ++  + + +++A KR
Sbjct: 593 DLPVGSSRGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

>Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON}
           (34514..35347) [834 nt, 278 aa]
          Length = 277

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +++G +  D  +E L          V   +M+D QTG+S+GY FV + D E +  A+  +
Sbjct: 16  VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVRNL 75

Query: 233 QGMPINGRAVRINWATKRE 251
            G PI  R ++  +++  +
Sbjct: 76  NGYPIGSRFLKCGYSSNSD 94

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 321 PPRVTTAYIGNIPHFATEADLIPLLQNFG------FILDFSHYPEKGCCFIKYDTHEQAA 374
           P RV   Y+G+IP+  TE  L+ L +N G       + D      KG  F++Y   E +A
Sbjct: 12  PSRV--VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSA 69

Query: 375 VCIVALANFPFQGRNLRTGW 394
             +  L  +P   R L+ G+
Sbjct: 70  SAVRNLNGYPIGSRFLKCGY 89

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQ 141
           RV+Y+G++     E+ L    +  G + ++K+M D +   +  YAF+EY     +  A++
Sbjct: 14  RVVYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVR 73

Query: 142 TLNGIQIEGKTVRINWAFQS 161
            LNG  I  + ++  ++  S
Sbjct: 74  NLNGYPIGSRFLKCGYSSNS 93

>ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR005W (IST3)
          Length = 173

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 139 ALQTLNGIQIEGKTV--RINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPS 196
           ++Q L+  ++E   +    +W +Q +     D  +  F G LNV++ +  +   F QF  
Sbjct: 6   SIQKLSETELEHGILSEEASWHYQYK-----DQAYIHFSG-LNVELTEGDILTVFSQFGV 59

Query: 197 YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRIN 245
                ++ D +TG SRG+GF+ + DQ     A++ + G+ + GR ++++
Sbjct: 60  PTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKVD 108

>NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {ON}
           Anc_4.33 YHL024W
          Length = 588

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (55%), Gaps = 8/93 (8%)

Query: 70  PASATQGGRETSDRVLYVGNLDKSINEDLL----KQYFQVGGQITDVKIMVDKKNNNVNY 125
           P   T  GR +S   ++V +L  ++++D L      YF+  G+I  VK++ D+ N    Y
Sbjct: 130 PYEPTFRGRPSS--CVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQANRP--Y 185

Query: 126 AFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           AF++Y   +DANVAL+  +G  + G+ +R   A
Sbjct: 186 AFVQYTNDNDANVALKEAHGSILNGRRLRCERA 218

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + ++VG L +   E++LK +F   G+I D+ ++   KN    +AFI+Y   + A +AL+T
Sbjct: 357 KSIFVGQLPEETTEEVLKIHFSKHGKILDLNLIHKPKN---VFAFIQYETENAAAIALET 413

Query: 143 LNGIQIEGKTVRINW 157
            N      KT+ + +
Sbjct: 414 ENHSIFISKTIHVQY 428

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 7/79 (8%)

Query: 173 LFVGDLNVDVDDETL----SHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           +FV  L  ++ D+ L    +  F +F   ++  V+ D     +R Y FV + +   A  A
Sbjct: 143 VFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQA---NRPYAFVQYTNDNDANVA 199

Query: 229 MNVMQGMPINGRAVRINWA 247
           +    G  +NGR +R   A
Sbjct: 200 LKEAHGSILNGRRLRCERA 218

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 326 TAYIGNIPHFATEADLIPLLQNFGFILDFS--HYPEKGCCFIKYDTHEQAAVCI 377
           + ++G +P   TE  L       G ILD +  H P+    FI+Y+T   AA+ +
Sbjct: 358 SIFVGQLPEETTEEVLKIHFSKHGKILDLNLIHKPKNVFAFIQYETENAAAIAL 411

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 88/193 (45%), Gaps = 31/193 (16%)

Query: 76  GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHD 135
           G     +R +Y+GNL K +  + +    + GG + +VK++ D+     +  F+ ++    
Sbjct: 444 GPNNLGNRTVYLGNLPKDVKVEEICNVVR-GGLLQNVKVLSDR-----HVCFVTFIDPTA 497

Query: 136 AN--VALQTLNGIQIEGKTVRINWAFQSQQTTNS-------DDTFNLFVGDLNVDVD--- 183
           A    A+ +L+GI I+ +  R+ W        N+         + N++VG++N D D   
Sbjct: 498 AAQFYAMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR 557

Query: 184 ------DETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPI 237
                 + +L   F Q+    Q + + +      R   FV++ +   A  A++ ++G P+
Sbjct: 558 EDPIFTESSLRSIFQQWGEVEQINYLPE------RNCCFVNYTNISNAILAIDKIKGHPV 611

Query: 238 NGRAVRINWATKR 250
             + ++IN+   R
Sbjct: 612 -FKDLKINFGKDR 623

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 12/81 (14%)

Query: 328 YIGNI----------PHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCI 377
           Y+GNI          P F TE+ L  + Q +G +   ++ PE+ CCF+ Y     A + I
Sbjct: 545 YVGNINFDEDSKREDPIF-TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAI 603

Query: 378 VALANFPFQGRNLRTGWGKER 398
             +   P   ++L+  +GK+R
Sbjct: 604 DKIKGHPVF-KDLKINFGKDR 623

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 326 TAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCI---VALAN 382
           T Y+GN P   T  +L+  +++ G + D    P+K C F+ +   E AA+       L  
Sbjct: 211 TVYLGNTPITLTVKELLDHVRS-GVVEDVRILPDKMCAFVSF-VDESAALLFHSDAILKR 268

Query: 383 FPFQGRNLRTGWGK 396
               GR+++ GWGK
Sbjct: 269 LHIDGRDIKIGWGK 282

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%)

Query: 337 TEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 396
           TE  L   LQ FG I       EKG  F+ + +   A   +  LAN     RN +  +GK
Sbjct: 329 TEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYRNKKIFYGK 388

Query: 397 ERNTFI 402
           +R  FI
Sbjct: 389 DRCAFI 394

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 3/74 (4%)

Query: 326 TAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAA--VCIVALANF 383
           T Y+GN+P      ++  +++  G + +     ++  CF+ +     AA    + +L   
Sbjct: 452 TVYLGNLPKDVKVEEICNVVRG-GLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLHGI 510

Query: 384 PFQGRNLRTGWGKE 397
             Q R  R GWGK 
Sbjct: 511 TIQKRRCRVGWGKH 524

>ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {ON}
           highly similar to gnl|GLV|CAGL0J11154g Candida glabrata
           CAGL0J11154g and similar to YNL175C uniprot|P53883
           Saccharomyces cerevisiae
          Length = 376

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 63/142 (44%), Gaps = 10/142 (7%)

Query: 118 KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN----- 172
           KK  N  + ++++        A++ L+  Q+ G+ + I  +   +   + DD        
Sbjct: 153 KKIKNKGFCYVDFKTIEQMESAVK-LSESQLNGRNLLIKNSKNFEGRPDKDDLVAASKNP 211

Query: 173 ----LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
               LFVG+L+ D  D+ L   F      ++  +     +G+ +G+ FV F +++ A  A
Sbjct: 212 PSRILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNA 271

Query: 229 MNVMQGMPINGRAVRINWATKR 250
           +       I GR++R+ +   R
Sbjct: 272 LKDKSCRKIAGRSIRMEYGEDR 293

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL    ++DLL+++FQ  G I  V++   + +     +AF+++ +   A  AL+
Sbjct: 214 RILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALK 273

Query: 142 TLNGIQIEGKTVRINWA 158
             +  +I G+++R+ + 
Sbjct: 274 DKSCRKIAGRSIRMEYG 290

>Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON}
           (221318..222142) [825 nt, 275 aa]
          Length = 274

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 7/88 (7%)

Query: 168 DDTFNLFVGDLNVDVDDETLSHA----FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           DD   L +  LN + D+ TL       F   P  V   V+ + +TGRSRG  FV+F+ +E
Sbjct: 188 DDMATLKITQLNENADETTLREELLFPFGNIPRVV---VVRNRETGRSRGLAFVTFSSEE 244

Query: 224 QAQEAMNVMQGMPINGRAVRINWATKRE 251
            A++A  ++ G       ++++W+  +E
Sbjct: 245 VAEKARRLLNGRGFMNLILQVDWSKPKE 272

>SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {ON}
           conserved hypothetical protein
          Length = 340

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFV  LN     + L+  F +F   V   ++ D  TG S GYGF+ F++Q+  + A + M
Sbjct: 246 LFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQKACELAYSKM 305

Query: 233 QGMPINGRAVRINWA 247
            G+ ++ R + ++++
Sbjct: 306 DGVLVDDRRIHVDFS 320

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHDANVALQT 142
           VL+V  L+       L   F   G+I  V+I+ DK    ++ Y FIE+ +     +A   
Sbjct: 245 VLFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQKACELAYSK 304

Query: 143 LNGIQIEGKTVRINWA 158
           ++G+ ++ + + ++++
Sbjct: 305 MDGVLVDDRRIHVDFS 320

>TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON}
           Anc_2.167 YNL110C
          Length = 212

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQT 142
           ++YV  L    +E  L +YF   G + +V++  +KKN N+ +Y FIE+    DA VA +T
Sbjct: 84  IIYVSRLPHGFHERELSKYFSQFGDLKEVRLARNKKNGNSRHYGFIEFANKDDAKVAHET 143

Query: 143 LNGIQIEGKTVRI 155
           +N   I G  +++
Sbjct: 144 MNNYLIMGHLLQV 156

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           ++V  L     +  LS  F QF    +  +  + + G SR YGF+ FA+++ A+ A   M
Sbjct: 85  IYVSRLPHGFHERELSKYFSQFGDLKEVRLARNKKNGNSRHYGFIEFANKDDAKVAHETM 144

Query: 233 QGMPINGRAVRI 244
               I G  +++
Sbjct: 145 NNYLIMGHLLQV 156

>AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; No
           homolog in Saccharomyces cerevisiae
          Length = 310

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFV  LN       L+  F QF       ++ D  +GRS GYGFV FA +   + A   M
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 233 QGMPINGRAVRINWA 247
            G  I+ R V ++++
Sbjct: 292 DGALIDDRRVHVDFS 306

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 75  QGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKS 133
           + G   ++ VL+V  L+       L   F   G +  V+I+ D+ +  ++ Y F+E+   
Sbjct: 222 RAGIAPAENVLFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATK 281

Query: 134 HDANVALQTLNGIQIEGKTVRINWA 158
               +A   ++G  I+ + V ++++
Sbjct: 282 AACELAYTKMDGALIDDRRVHVDFS 306

>ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa]
           {ON} similar to uniprot|Q04067 YDR429C Saccharomyces
           cerevisiae TIF35 Subunit of the core complex of
           translation initiation factor 3(eIF3)
          Length = 273

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 168 DDTFNLFVGDLNVDVDDETLSHA----FDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           DD   L +  LN++ D+ TL       F   P  V   V+ + +TGRSRG  FV+FA +E
Sbjct: 187 DDMSTLKITQLNLNADENTLREELLFPFAPIPKVV---VVRNRETGRSRGLSFVTFASEE 243

Query: 224 QAQEAMNVMQGMPINGRAVRINWA 247
            A++A++ + G       + + W+
Sbjct: 244 IAEQALHFLNGRGFMNLILHVEWS 267

>CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q04067 Saccharomyces
           cerevisiae YDR429c TIF35
          Length = 274

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 168 DDTFNLFVGDLNVDVDDETLSHAFD-QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           DD+  L +  LN + D+ TL +     F    +  V+ + +TGRSRG  FV+F +++ A+
Sbjct: 186 DDSCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAE 245

Query: 227 EAMNVMQGMPINGRAVRINWA 247
           +A++ + G       +R++W+
Sbjct: 246 KALHFLDGRGFMNLILRVDWS 266

>NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66
          Length = 315

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +++G +  D  +E +    +     V   +M+D QTGRS+GY F+ F D E +  A+  +
Sbjct: 49  VYLGSIPYDQTEEQILDLCNNVGPVVNLKMMFDQQTGRSKGYAFIEFKDLETSASAIRNL 108

Query: 233 QGMPINGRAVRINWATKRE 251
            G  +  R +R  +++  +
Sbjct: 109 NGYQLGSRFLRCGYSSNND 127

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 8/80 (10%)

Query: 321 PPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHY------PEKGCCFIKYDTHEQAA 374
           P R+   Y+G+IP+  TE  ++ L  N G +++            KG  FI++   E +A
Sbjct: 45  PSRIV--YLGSIPYDQTEEQILDLCNNVGPVVNLKMMFDQQTGRSKGYAFIEFKDLETSA 102

Query: 375 VCIVALANFPFQGRNLRTGW 394
             I  L  +    R LR G+
Sbjct: 103 SAIRNLNGYQLGSRFLRCGY 122

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 63/133 (47%), Gaps = 13/133 (9%)

Query: 63  NQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-N 121
           N + +V  +S +Q   + S R++Y+G++     E+ +       G + ++K+M D++   
Sbjct: 28  NPDGNVGGSSGSQHYNQPS-RIVYLGSIPYDQTEEQILDLCNNVGPVVNLKMMFDQQTGR 86

Query: 122 NVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQS-----------QQTTNSDDT 170
           +  YAFIE+     +  A++ LNG Q+  + +R  ++  +           Q   N DD 
Sbjct: 87  SKGYAFIEFKDLETSASAIRNLNGYQLGSRFLRCGYSSNNDISSTGISSNDQSMGNVDDG 146

Query: 171 FNLFVGDLNVDVD 183
            N+   DL   +D
Sbjct: 147 SNVLFSDLPSGID 159

>AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL110C (NOP15)
          Length = 206

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 54  PAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVK 113
           PAA   +   Q+ +    +  Q  R     ++Y+  L    +E  L  YF   G +  V+
Sbjct: 49  PAAAGHTILPQQPARRSGAKKQAARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVR 108

Query: 114 IMVDKKN-NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRIN 156
           +  +KK  N+ +YAFIE+    DA VA +T++   + G  ++++
Sbjct: 109 LARNKKTGNSRHYAFIEFANPDDAVVAQETMHNYLLMGHLLQVS 152

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%)

Query: 162 QQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFAD 221
           +Q   +D +  +++  L     +  LS  F QF    Q  +  + +TG SR Y F+ FA+
Sbjct: 69  KQAARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFAN 128

Query: 222 QEQAQEAMNVMQGMPINGRAVRIN 245
            + A  A   M    + G  ++++
Sbjct: 129 PDDAVVAQETMHNYLLMGHLLQVS 152

>KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa]
           {ON} similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 166

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%)

Query: 176 GDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGM 235
           G +++++ +  +   F Q+   V   ++ D  TG+S+G+GF+ + DQ     A++ + G 
Sbjct: 39  GGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGA 98

Query: 236 PINGRAVRINWATKR 250
            + GR +R++ A  R
Sbjct: 99  KVCGRLIRVDHAFYR 113

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 97  DLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRI 155
           D+L  + Q G  + D+K++ D+    +  + F++Y       +A+  LNG ++ G+ +R+
Sbjct: 49  DILTIFSQYGCPV-DIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

Query: 156 NWAF 159
           + AF
Sbjct: 108 DHAF 111

>KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} similar
           to uniprot|P40565 YIR005W Saccharomyces cerevisiae IST3
           Component of the U2 snRNP required for the first
           catalytic step of splicing and for spliceosomal assembly
          Length = 134

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 45/77 (58%)

Query: 169 DTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
           D   +++G LN ++ +  +   F Q+   V  +++ D +TG S+G+ ++ F DQ  +  A
Sbjct: 32  DQAYVYIGGLNKELTEGDVLTVFSQYGVPVDINLVRDRETGESKGFCYLKFEDQRSSILA 91

Query: 229 MNVMQGMPINGRAVRIN 245
           ++ + G  + GRA++++
Sbjct: 92  VDNLNGAVVAGRAIKVD 108

>KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFV  LN     + L+  F +F       ++ D +TG S GYGF+ F  +E  + A + M
Sbjct: 249 LFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKESCEMAYSKM 308

Query: 233 QGMPINGRAVRINWA 247
            G+ I+ R + +++ 
Sbjct: 309 DGVLIDDRRIHVDFC 323

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHD 135
           G + S+RVL+V  L+       L   F   G+I  ++I+ DK+  +++ Y FIE+ K   
Sbjct: 241 GIKPSERVLFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKES 300

Query: 136 ANVALQTLNGIQIEGKTVRINWA 158
             +A   ++G+ I+ + + +++ 
Sbjct: 301 CEMAYSKMDGVLIDDRRIHVDFC 323

>SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 221

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 49/88 (55%), Gaps = 4/88 (4%)

Query: 72  SATQGGRETSDR---VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAF 127
           +  +GG E++     ++YV  L +  +E  L +YF   G +  V++  +KK  N+ +YAF
Sbjct: 78  AKVEGGNESNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAF 137

Query: 128 IEYLKSHDANVALQTLNGIQIEGKTVRI 155
           IE++   DA VA  T+N   I G  +++
Sbjct: 138 IEFVNKDDALVAQDTMNNYLILGHLLKV 165

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%)

Query: 165 TNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224
           +N + +  ++V  L     +  LS  F QF    Q  +  + +TG SR Y F+ F +++ 
Sbjct: 86  SNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDD 145

Query: 225 AQEAMNVMQGMPINGRAVRI 244
           A  A + M    I G  +++
Sbjct: 146 ALVAQDTMNNYLILGHLLKV 165

>TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON}
           Anc_5.536 YDR429C
          Length = 293

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 168 DDTFNLFVGDLNVDVDDE----TLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQE 223
           ++TF + +  LN    +E     L +A+D      +  V+ + +TG+SRG+ F++F D++
Sbjct: 209 EETFIIKISQLNTHATEEMIRDELLYAYDNIQ---RVAVIRNRETGKSRGFAFITFTDEK 265

Query: 224 QAQEAMNVMQGMPINGRAVRINWATKRE 251
            A++A+  + G       +R+ W+  R+
Sbjct: 266 SAEDALYGLDGKGFMNLILRVEWSVPRD 293

>KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 223

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 4/88 (4%)

Query: 61  AENQESSVVPASATQGGRETSDR---VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD 117
           A+ +ES       ++ GR  ++    ++YV  L K  +E  L +YF   G + +V++  +
Sbjct: 69  AKKRESQQEGGKGSKKGRSKAEELSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARN 128

Query: 118 KKN-NNVNYAFIEYLKSHDANVALQTLN 144
           KK  N+ +Y F+E++   DA VA +T++
Sbjct: 129 KKTGNSRHYGFVEFVNKEDALVAQETMH 156

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           ++V  L     +  L+  F QF    +  +  + +TG SR YGFV F ++E A  A   M
Sbjct: 96  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDALVAQETM 155

>KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {ON}
           Anc_4.33 YHL024W
          Length = 743

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 49/87 (56%), Gaps = 6/87 (6%)

Query: 76  GGRETSDRVLYVGNLDKSINEDLL----KQYFQVGGQITDVKIMVDKKNNNVNYAFIEYL 131
           G R      ++V +L  ++++D L     + F+  G++  VK++ D++N    YAF++Y 
Sbjct: 102 GPRGLPSSCVFVASLAATLSDDKLCISVAEKFKQYGKLNGVKVLRDQENRP--YAFVQYA 159

Query: 132 KSHDANVALQTLNGIQIEGKTVRINWA 158
             HDAN+AL+  +G  + G+ +R   A
Sbjct: 160 NDHDANLALKEAHGSTLNGRIIRCERA 186

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           R ++VG L    N D LK +FQ+ G+I+D+ ++   K  NV +AFIEY   + A  AL+ 
Sbjct: 337 RSIFVGQLPDETNYDNLKNHFQLHGEISDINLI--HKQTNV-FAFIEYETENAAASALEK 393

Query: 143 LNGIQIEGKTVRINW 157
            N      KT+ + +
Sbjct: 394 ENHSIFLNKTIHVQY 408

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 173 LFVGDLNVDVDDETLSHAF-DQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           +FV  L   + D+ L  +  ++F  Y + + +  ++   +R Y FV +A+   A  A+  
Sbjct: 111 VFVASLAATLSDDKLCISVAEKFKQYGKLNGVKVLRDQENRPYAFVQYANDHDANLALKE 170

Query: 232 MQGMPINGRAVRINWA 247
             G  +NGR +R   A
Sbjct: 171 AHGSTLNGRIIRCERA 186

>ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 198

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 160 QSQQTTNSDDTFN--LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFV 217
           Q QQ  +S D ++  +FV  L     ++ LS  F QF     A +  + +TG +R YGF+
Sbjct: 56  QKQQQNSSQDEYSGIVFVSRLPHGFQEKELSKYFSQFGDLKDARLARNKKTGNTRHYGFI 115

Query: 218 SFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
            F +++ A+ A   M    + G  +++    K
Sbjct: 116 EFVNKDDAKVAQETMNNYLLMGHLIQVRLLPK 147

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 55  AAGEQSAENQESSVVPASATQ--GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDV 112
           A  ++S + ++ S  PA   Q    ++    +++V  L     E  L +YF   G + D 
Sbjct: 39  AEDDRSHKVKKLSKKPAQKQQQNSSQDEYSGIVFVSRLPHGFQEKELSKYFSQFGDLKDA 98

Query: 113 KIMVDKKNNNV-NYAFIEYLKSHDANVALQTLNGIQIEGKTVRI 155
           ++  +KK  N  +Y FIE++   DA VA +T+N   + G  +++
Sbjct: 99  RLARNKKTGNTRHYGFIEFVNKDDAKVAQETMNNYLLMGHLIQV 142

>CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} similar
           to uniprot|Q00916 Saccharomyces cerevisiae YIL061c SNP1
           U1 small nuclear ribonucleoprotein
          Length = 299

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 126 AFIEYLKSHDANVALQTLNGIQIEGKTVRINW-AFQSQQTTNSDDTFNLFVGDLNVDVDD 184
           A + +L+  DA       N  ++E +   + W         ++D    +FVG L  D D+
Sbjct: 71  ATLRHLERMDAVAKRVRDNQREVEQQL--LQWDPLSDNHMRDTDPYKTVFVGRLPYDTDE 128

Query: 185 ETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ---EAMNVMQGMPINGR 240
             L   F ++   V+  V+ D Q  +SRGY FV F + + A+     + V +G+ INGR
Sbjct: 129 VQLQKVFAKYGEIVRVRVVRDKQ-NKSRGYAFVLFKETDSARVCTRDIGVHRGIQINGR 186

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQT 142
           + ++VG L    +E  L++ F   G+I  V+++ DK+N +  YAF+ + ++  A V  + 
Sbjct: 115 KTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRD 174

Query: 143 L---NGIQIEGK 151
           +    GIQI G+
Sbjct: 175 IGVHRGIQINGR 186

>CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} similar
           to uniprot|P53927 Saccharomyces cerevisiae YNL110c
          Length = 255

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 84  VLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKN-NNVNYAFIEYLKSHDANVALQT 142
           ++YVG L K  +E  L +YF   G + +V++  +KK  N+ +Y F++++ + D+ VA  T
Sbjct: 126 IIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDT 185

Query: 143 LNGIQIEGKTVRIN 156
           +N   + G  +++ 
Sbjct: 186 MNNYLLMGHLLQVR 199

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 160 QSQQTTNSDDTFN-----LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGY 214
           + Q+ T  DD  +     ++VG L     +  LS  F QF    +  +  + +TG SR Y
Sbjct: 109 KKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHY 168

Query: 215 GFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249
           GFV F + + ++ A + M    + G  +++    K
Sbjct: 169 GFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRLLPK 203

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 77/173 (44%), Gaps = 14/173 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144
           ++VGNL      + LK+YF   G++    I+   + ++     +E+  + D + A++  +
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGHHRGMGTVEFTNADDVDEAIRRFD 222

Query: 145 GIQIEGKTVRIN------------WAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
           G  +  + + +                +  +   S   + +F+ +L   V+ + L   F 
Sbjct: 223 GSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQALKDMFK 282

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRIN 245
           +    ++A V  D + G SRGYG V +  +E+ Q A+    G  + GR + ++
Sbjct: 283 ECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 325 TTAYIGNIPHFATEADLIPLLQNFGFI----LDFSHYPE-KGCCFIKYDTHEQAAVCIVA 379
           +T ++ N+P    ++DL  L +  G +    L F++  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 380 LANFPFQGRNLRTGW 394
           L ++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 162 QQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFAD 221
           ++  N + + ++FVG+L  D   E L   F Q    V+A ++     G  RG G V F +
Sbjct: 153 EEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADII--TSRGHHRGMGTVEFTN 210

Query: 222 QEQAQEAMNVMQGMPINGRAVRI 244
            +   EA+    G  +  R + +
Sbjct: 211 ADDVDEAIRRFDGSTLLDREIFV 233

>KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {ON}
           Anc_7.159 YIR005W
          Length = 154

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +F+G LN D+ +  +   F Q+   V  ++  D  +G S+G+ F+ + DQ     A++ +
Sbjct: 36  VFIGGLNKDLTEGDILTIFSQYGVPVDIYLARDKYSGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 233 QGMPINGRAVRINWA 247
            G  I GR ++++ A
Sbjct: 96  NGSKIAGRIIQVDHA 110

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 85  LYVGNLDKSINE-DLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQT 142
           +++G L+K + E D+L  + Q G  + D+ +  DK    +  +AF++Y       +A+  
Sbjct: 36  VFIGGLNKDLTEGDILTIFSQYGVPV-DIYLARDKYSGESKGFAFLKYEDQRSTVLAIDN 94

Query: 143 LNGIQIEGKTVRINWAF 159
           LNG +I G+ ++++ AF
Sbjct: 95  LNGSKIAGRIIQVDHAF 111

>KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa]
           {ON} some similarities with uniprot|P40561 Saccharomyces
           cerevisiae YIR001C SGN1 Cytoplasmic RNA- binding protein
           contains an RNA recognition motif (RRM) may have a role
           in mRNA translation as suggested by genetic interactions
           with genes encoding proteins involved in translational
           initiation
          Length = 145

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 55  AAGEQSAENQESSVVPASATQ--GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDV 112
           A+     ++Q   VV  S  +    R+T  R +++ N+   I+ +LL+ +F++ G I  V
Sbjct: 25  ASTPHKVKSQSCKVVSKSENEISEQRKTDARSIFLRNIPVDISINLLEDHFKLYGTINRV 84

Query: 113 KIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRI 155
            I  ++K  N+ YA+IE+ +   A+ AL  LN  ++ G  + +
Sbjct: 85  TIFTNRKTFNLGYAYIEFEEDCSADQALD-LNNSELCGHKIEV 126

>Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 87/226 (38%), Gaps = 61/226 (26%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQTL 143
           ++VG + K ++   L   F   G ++ +K++ DK   + N Y F  Y     A+V ++ L
Sbjct: 196 IFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKEL 255

Query: 144 NGIQIEGKTVRINWAFQSQQ----------TTNSDDTFN-LFVGDLN------------- 179
           NG  + G T+ IN+  + ++            N+DD F  LF+G+L              
Sbjct: 256 NGSTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPDKEEALITP 315

Query: 180 ---VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRS------------------------- 211
              +DV  + LS  F  F   + ++        RS                         
Sbjct: 316 KEVIDVIKKELSRNFPDFD--IISYYFPKRSNTRSSSSVSFNDEGSIDSSKFSLNANGPA 373

Query: 212 ------RGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
                 +GYGF+   + EQA  A+    G   +G  + +N A + +
Sbjct: 374 QDEDMLKGYGFIKLINHEQALAAIETFNGYMWHGNRLVVNKAVQHK 419

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231
           N+FVG +   +    LS  F ++       +++D   G + GYGF S+    QA   +  
Sbjct: 195 NIFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKE 254

Query: 232 MQGMPINGRAVRINWATKRE 251
           + G  +NG  + IN+  +R+
Sbjct: 255 LNGSTVNGSTLFINYHVERK 274

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 205 DMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPI-NGRAVRINWATKR 250
           D+  G SRGYGFVSF     A +A+    G  +   + + +++A KR
Sbjct: 592 DLPVGSSRGYGFVSFESPLDAAKAILNTDGYQVGKDQVLSVSFAQKR 638

>KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|P40561 Saccharomyces
           cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein
          Length = 204

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 58  EQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVG-GQITDVKIMV 116
           ++ AEN   +  P  +    +    R +YVGNLD SIN + L+++F+    ++  V+I +
Sbjct: 45  KRMAENAHGAGCPGFSRFNDQSADARSVYVGNLDPSINAETLQEFFKGSVSRVNRVEIQI 104

Query: 117 DKKNNNVN-YAFIEYLKSHDANVALQTLNGIQIEGKTVRI 155
           +K       +AF+E+ +  D   A++ L+  ++ GK ++I
Sbjct: 105 NKLTGFAKGFAFVEFAQPRDVMDAIK-LSNTKLGGKPLKI 143

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYV-QAHVMWDMQTGRSRGYGFVSFADQEQA 225
           S D  +++VG+L+  ++ ETL   F    S V +  +  +  TG ++G+ FV FA     
Sbjct: 66  SADARSVYVGNLDPSINAETLQEFFKGSVSRVNRVEIQINKLTGFAKGFAFVEFAQPRDV 125

Query: 226 QEAMNVMQGMPINGRAVRI 244
            +A+  +    + G+ ++I
Sbjct: 126 MDAIK-LSNTKLGGKPLKI 143

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 88/189 (46%), Gaps = 27/189 (14%)

Query: 76  GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHD 135
           G     +R +Y+GNL K +  + +    + GG + ++K++ D+        FI ++    
Sbjct: 349 GPNNLGNRTIYLGNLPKGVKIEEICNVVR-GGLLQNIKLLSDRF-----ACFITFIDPTA 402

Query: 136 AN--VALQTLNGIQIEGKTVRINWAFQSQQTTNS-------DDTFNLFVGDLNVD----- 181
           A    A+ +L+G+ I+    ++ W   S   +N+         + N+++G+++ +     
Sbjct: 403 AAQFYAMSSLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEY 462

Query: 182 VDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRA 241
            ++E L   F++F    Q + +      R +G  FV+F +   A  A++ ++ +P     
Sbjct: 463 FNEEHLREIFEEFGEVEQINFL------REKGCCFVNFTNINHAILALDKIKSLP-EFED 515

Query: 242 VRINWATKR 250
           ++IN+   R
Sbjct: 516 LKINFGKDR 524

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 7/80 (8%)

Query: 320 APPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCI-- 377
           AP R  T Y+GNIP   T  +L+  +++ G +      P K C FI +   E+ A+    
Sbjct: 125 APSR--TVYLGNIPQGLTIKELLDHVRS-GVVESVKILPTKLCAFISF-IDERGALLFHS 180

Query: 378 -VALANFPFQGRNLRTGWGK 396
              L     +G++++ GWGK
Sbjct: 181 DAILKRLNIRGKDIKIGWGK 200

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 328 YIGNIP-----HFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALAN 382
           YIGN+       +  E  L  + + FG +   +   EKGCCF+ +     A + +  + +
Sbjct: 450 YIGNVDFEKKNEYFNEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKS 509

Query: 383 FPFQGRNLRTGWGKER 398
            P +  +L+  +GK+R
Sbjct: 510 LP-EFEDLKINFGKDR 524

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 24/118 (20%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDA-----N 137
           R +Y+GN+ + +    L  + +  G +  VKI+  K       AFI ++    A     +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVR-SGVVESVKILPTKL-----CAFISFIDERGALLFHSD 181

Query: 138 VALQTLNGIQIEGKTVRINW-------AFQSQQTTNSDDTFNLFVGDLNVDVDDETLS 188
             L+ LN   I GK ++I W       +  + + TN   T N+++G LN   DD T++
Sbjct: 182 AILKRLN---IRGKDIKIGWGKSNHIDSIVAARITNDGATRNVYIGQLN---DDPTIT 233

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 327 AYIGNI---PHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANF 383
            YIG +   P   TE +L   +Q FG I        KG  F+ + +   A   +  L+  
Sbjct: 221 VYIGQLNDDPTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKL 280

Query: 384 PFQGRNLRTGWGKERNTFI 402
             + +N R  +GK+R  FI
Sbjct: 281 NEKYKNKRIFYGKDRCAFI 299

>NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON}
           Anc_3.432
          Length = 843

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 79/175 (45%), Gaps = 13/175 (7%)

Query: 85  LYVGNLDKSINEDLLKQYFQV--GGQITDVKIMVDKKNNN----VNYAFIEYLKSHDANV 138
           +++ NL+ S +   L   F+V  G  +  VK   D K+ N    + + F E+     AN 
Sbjct: 645 IFIKNLNFSTSSSDLTSRFKVFNGFVVAQVKTKPDPKHPNKTLSMGFGFAEFRTKEQANA 704

Query: 139 ALQTLNGIQIEGKTVRINWAFQ------SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192
            +  ++G  I+G  +++  + +      +  + N   +  + V +L  +   + +   F+
Sbjct: 705 VIAAMDGTVIDGHKIQLKLSHRQGTKGNNTSSKNKTKSAKIIVKNLPFEATRKDVFELFN 764

Query: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247
            F       V        +RG+ F+ F   ++A+ AM+ +QG+ + GR + + +A
Sbjct: 765 SFGQLKSVRVPKKFDKS-ARGFAFIEFLLPKEAENAMDQLQGVHLLGRRLVMQYA 818

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%)

Query: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229
           T  LF+ ++     +E     F  F    + H+  D +TG+S+G+ ++ F D + A +A 
Sbjct: 328 TGRLFLRNILYSSTEEDFRKLFSPFGELEEVHIALDTRTGQSKGFAYILFKDPKDALQAY 387

Query: 230 NVMQGMPINGRAVRINWATKRE 251
             +      GR + I  A +R+
Sbjct: 388 IELDKQIFQGRLLHILPADERK 409

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 109 ITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158
           ITDVK++ D+   +  +AFI Y    DA  A+   NG  I    + ++ A
Sbjct: 38  ITDVKVLRDRNGESRRFAFIGYRNEEDAFDAVNYFNGSYINTAKIEVSMA 87

>CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} similar
           to uniprot|P25555 Saccharomyces cerevisiae YCL011c GBP2
           or uniprot|P38922 Saccharomyces cerevisiae YNL004w HRB1
          Length = 419

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/179 (18%), Positives = 73/179 (40%), Gaps = 18/179 (10%)

Query: 82  DRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQ 141
           D  +++GNL      + L  +F   G++    I+   +  +     +E+      + A++
Sbjct: 118 DNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-SRGRHRGMGTVEFTSPEGVDNAIR 176

Query: 142 TLNGIQIEGKTVRINW----------------AFQSQQTTNSDDTFNLFVGDLNVDVDDE 185
             NG++  G+ + +                   F           F +F+ +L   +  +
Sbjct: 177 DFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQ 236

Query: 186 TLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244
           TL   F +    ++A +  D + G SRG+G V +  QE+   A+    G  ++GR +++
Sbjct: 237 TLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQV 294

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 76  GGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHD 135
           GG E S  ++Y  NL  +     L   F+  G++   ++  D+       A IEY    D
Sbjct: 335 GGGERS-TLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVED 393

Query: 136 ANVALQTLNGIQIEGKTVRINWA 158
           A+  +Q LN     G  + I++A
Sbjct: 394 ADFCIQRLNNYNYGGCDLDISYA 416

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 323 RVTTAYIGNIPHFATEADLIPLLQNFGFI------LDFSHYPEKGCCFIKYDTHEQAAVC 376
           R T  Y  N+P      DL  L +  G +       D S  P  G   I+Y+  E A  C
Sbjct: 339 RSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAP-TGIAVIEYENVEDADFC 397

Query: 377 IVALANFPFQGRNLRTGWGK 396
           I  L N+ + G +L   + K
Sbjct: 398 IQRLNNYNYGGCDLDISYAK 417

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 44/78 (56%)

Query: 167 SDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQ 226
           SD   +LF+G+L+ +V +E L   F  +P ++ A + ++  T +S G+G+++F+++  A 
Sbjct: 88  SDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAI 147

Query: 227 EAMNVMQGMPINGRAVRI 244
            A   +    I    +R+
Sbjct: 148 RATKDLNYCNILSSEIRL 165

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143
           L++GNL K++ E+LL+  F V       KI  +     ++ + ++ +    DA  A + L
Sbjct: 94  LFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAIRATKDL 153

Query: 144 NGIQIEGKTVRI-----NWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYV 198
           N   I    +R+     N A++ Q  T      N+F+ +L +D+   T    +  F  + 
Sbjct: 154 NYCNILSSEIRLMPSMRNAAYRKQIGT------NVFMSNLPLDIPFLTTRFFYVYFSGFG 207

Query: 199 QAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKRE 251
           +   +   +    +G GF+ F     A   +N+  G  + G+ V  +    +E
Sbjct: 208 E---VLSCKLVEEKGIGFIYFESNTVANYVVNLFNGSLLYGKQVFCSIHKSKE 257

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFVG+L+ D  DE L   F      ++  +     +G+ +G+ FV F ++E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 233 QGMPINGRAVRINWATKR 250
               I GR +R+ +   R
Sbjct: 300 TCRKIAGRPLRMEFGEDR 317

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL     ++LL+++FQ  G+I  +++   + +     +AF+++     A  AL+
Sbjct: 238 RILFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALK 297

Query: 142 TLNGIQIEGKTVRINWA 158
                +I G+ +R+ + 
Sbjct: 298 DKTCRKIAGRPLRMEFG 314

>NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {ON}
           Anc_2.80
          Length = 404

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 64/142 (45%), Gaps = 10/142 (7%)

Query: 118 KKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNL---- 173
           KK  N  + ++++ K+++   ++  L+  Q+ G+ + I  +   +   + +D  +L    
Sbjct: 177 KKIKNKGFCYMDF-KTNEQMESIIKLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNP 235

Query: 174 -----FVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEA 228
                FVG+L+ D  DE L   F      V+  +     +G+ +G+ F+ F  +E A  A
Sbjct: 236 PSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNA 295

Query: 229 MNVMQGMPINGRAVRINWATKR 250
           +       I  R +R+ +   R
Sbjct: 296 LKDKTCRKIAARPIRMEYGEDR 317

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN-YAFIEYLKSHDANVALQ 141
           R+L+VGNL     ++LLK++FQ  G+I  +++   + +     +AFI++     A  AL+
Sbjct: 238 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALK 297

Query: 142 TLNGIQIEGKTVRINWA 158
                +I  + +R+ + 
Sbjct: 298 DKTCRKIAARPIRMEYG 314

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LFVG+L+ D  DE L   F      V+  +     TG+ +G+ FV F ++E    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDK 296

Query: 233 QGMPINGRAVRINWATKR 250
               I GR +R+ +   R
Sbjct: 297 TCRRIAGRPLRMEFGEDR 314

>Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {ON}
           [contig 116] FULL
          Length = 330

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           LF+  LN     + L+  F +F +  +  ++ D +TG S  YGF+ F ++   + A + M
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 233 QGMPINGRAVRINW--ATKR 250
           +G+ I+ R + +++  +T+R
Sbjct: 309 EGVLIDDRRIHVDFCQSTRR 328

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 77  GRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNN-NVNYAFIEYLKSHD 135
           G + S++VL++  L+       L   F   G I  V+I+ DK+   +++Y FIE+     
Sbjct: 241 GIKPSEKVLFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSS 300

Query: 136 ANVALQTLNGIQIEGKTVRINWA 158
              A   + G+ I+ + + +++ 
Sbjct: 301 CEAAYSKMEGVLIDDRRIHVDFC 323

>TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.66
           YGL044C
          Length = 289

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%)

Query: 173 LFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVM 232
           +++G +  D  +E +          V   +M+D QTGRS+GY FV + D E +  A+  +
Sbjct: 18  IYIGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGRSKGYAFVEYKDLETSASAVRNL 77

Query: 233 QGMPINGRAVRINWATKRE 251
            G  +  R ++  +++  +
Sbjct: 78  NGYQVGSRLLKCGYSSNSD 96

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 56/111 (50%), Gaps = 3/111 (2%)

Query: 83  RVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFIEYLKSHDANVALQ 141
           RV+Y+G++     E+ +       G + ++K+M D +   +  YAF+EY     +  A++
Sbjct: 16  RVIYIGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGRSKGYAFVEYKDLETSASAVR 75

Query: 142 TLNGIQIEGKTVRINWAFQS--QQTTNSDDTFNLFVGDLNVDVDDETLSHA 190
            LNG Q+  + ++  ++  S    +  +D+  N  + D+N ++ +  + H 
Sbjct: 76  NLNGYQVGSRLLKCGYSSNSDISGSAGNDNNDNSNIHDINGNLSNGMMKHG 126

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 321 PPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHY--PE----KGCCFIKYDTHEQAA 374
           P RV   YIG+IP+  TE  ++ L  N G +++      P+    KG  F++Y   E +A
Sbjct: 14  PSRVI--YIGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGRSKGYAFVEYKDLETSA 71

Query: 375 VCIVALANFPFQGRNLRTGW 394
             +  L  +    R L+ G+
Sbjct: 72  SAVRNLNGYQVGSRLLKCGY 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,227,387
Number of extensions: 1400811
Number of successful extensions: 6891
Number of sequences better than 10.0: 604
Number of HSP's gapped: 6428
Number of HSP's successfully gapped: 1404
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)