Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050508.271ON92392345540.0
NDAI0B020208.271ON90592833200.0
Smik_12.1518.271ON89392830490.0
Skud_12.1608.271ON89392230360.0
YLR092W (SUL2)8.271ON89391730230.0
Suva_10.1768.271ON89392130040.0
KNAG0G020708.271ON89991529500.0
TDEL0F039808.271ON86789428740.0
Smik_2.435na 1ON86382328470.0
YBR294W (SUL1)na 1ON85981828360.0
Skud_2.424na 1ON86385928330.0
Suva_4.554na 1ON85081728150.0
CAGL0L12342g8.271ON89190928080.0
KAFR0B027508.271ON83488827970.0
Kpol_543.438.271ON86684327960.0
SAKL0H16830g8.271ON86289227510.0
TPHA0J008008.271ON91793827390.0
KLLA0F19338g8.271ON89181226120.0
ZYRO0C01452g8.271ON90690926000.0
KLTH0G13486g8.271ON90294725470.0
TPHA0A017608.271ON89383425390.0
Kwal_56.237598.271ON86189424490.0
AGR077C8.271ON84891324070.0
Ecym_42998.271ON87492322200.0
TBLA0F030508.271ON89750513841e-177
NDAI0B022108.99ON7064803013e-27
ZYRO0F04796g8.99ON7354962978e-27
TBLA0C052708.99ON7764522989e-27
KNAG0D023908.99ON7164812951e-26
TPHA0H007208.99ON7875452952e-26
NCAS0B048008.99ON7244652933e-26
Suva_16.3228.99ON7424902933e-26
Skud_16.2868.99ON7455062924e-26
YPR003C8.99ON7545082916e-26
CAGL0L09207g8.99ON7254842826e-25
Kpol_467.118.99ON7445042773e-24
Ecym_7084na 2ON6895122736e-24
KLTH0G16764g8.99ON7104502674e-23
KLLA0E14059g8.99ON7064992532e-21
SAKL0H08800gna 2ON6204522041e-15
SAKL0B03124g8.99ON7441411844e-13
Smik_16.2418.99ON7441911826e-13
Kwal_27.110398.99ON7261761772e-12
TDEL0C012808.99ON7271471745e-12
AGR213Cna 2ON6891891649e-11
NDAI0D029404.45ON171792950.015
KLLA0E04731g3.485ON1060175880.083
TBLA0C044403.485ON1150173791.1
YGR125W3.485ON1036174791.1
YPL085W (SEC16)8.562ON219597744.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05050
         (923 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1758   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1283   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1179   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1174   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1169   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1161   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1140   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1111   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1101   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1097   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1095   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1088   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1086   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1082   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1081   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1064   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1059   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1010   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1006   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   985   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   982   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   947   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   931   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   859   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   537   e-177
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   120   3e-27
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   119   8e-27
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   119   9e-27
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   118   1e-26
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   118   2e-26
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   117   3e-26
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   117   3e-26
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   117   4e-26
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   116   6e-26
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   113   6e-25
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   111   3e-24
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   109   6e-24
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   107   4e-23
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   102   2e-21
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    83   1e-15
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    75   4e-13
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    75   6e-13
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    73   2e-12
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    72   5e-12
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    68   9e-11
NDAI0D02940 Chr4 complement(691155..696308) [5154 bp, 1717 aa] {...    41   0.015
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    39   0.083
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...    35   1.1  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    35   1.1  
YPL085W Chr16 (387067..393654) [6588 bp, 2195 aa] {ON}  SEC16COP...    33   4.1  

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1758 bits (4554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 863/923 (93%), Positives = 863/923 (93%)

Query: 1   MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXX 60
           MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSET   
Sbjct: 1   MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNN 60

Query: 61  XXXXXXXXXXXXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTV 120
                            PELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTV
Sbjct: 61  DDVINNNNNNNNNNNNIPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTV 120

Query: 121 SIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSM 180
           SIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSM
Sbjct: 121 SIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSM 180

Query: 181 SYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDND 240
           SYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDND
Sbjct: 181 SYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDND 240

Query: 241 PTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLM 300
           PTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLM
Sbjct: 241 PTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLM 300

Query: 301 GYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFP 360
           GYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFP
Sbjct: 301 GYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFP 360

Query: 361 KNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKE 420
           KNKNER                  IIIIVFTAISWSITRGKAKADRPISILGTVPKGLKE
Sbjct: 361 KNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKE 420

Query: 421 VGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIG 480
           VGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIG
Sbjct: 421 VGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIG 480

Query: 481 TFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVII 540
           TFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVII
Sbjct: 481 TFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVII 540

Query: 541 QAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCF 600
           QAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCF
Sbjct: 541 QAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCF 600

Query: 601 PAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDA 660
           PAGKFLGRIEVAEVIDGYVDN                      DTKKIQKTSSISFGKDA
Sbjct: 601 PAGKFLGRIEVAEVIDGYVDNSIESATTAEYSSASSPSSDNETDTKKIQKTSSISFGKDA 660

Query: 661 KAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINC 720
           KAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINC
Sbjct: 661 KAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINC 720

Query: 721 SRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESA 780
           SRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESA
Sbjct: 721 SRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESA 780

Query: 781 VDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIV 840
           VDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIV
Sbjct: 781 VDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIV 840

Query: 841 SPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHV 900
           SPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHV
Sbjct: 841 SPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHV 900

Query: 901 FAATGTNLPFFHIDIPDFSKWDL 923
           FAATGTNLPFFHIDIPDFSKWDL
Sbjct: 901 FAATGTNLPFFHIDIPDFSKWDL 923

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1283 bits (3320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/928 (68%), Positives = 731/928 (78%), Gaps = 40/928 (4%)

Query: 8   PFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXX 67
           PF   E+  +   +QYE+P++    P+S  S+QNL DLELEYDQYK SET          
Sbjct: 6   PFQKNENNTNDIENQYELPSF----PNSDTSSQNLADLELEYDQYKASETNNKSNHG--- 58

Query: 68  XXXXXXXXXXPELETQQNLDVQFSNTTNNKENQYRI------VSTVNP--VIIPNYDEKT 119
                     P+LET  NLDVQFSNT N  + +  I      ++T N   VIIP+++E  
Sbjct: 59  ----------PDLETN-NLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHA 107

Query: 120 VSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQS 179
           +S KDYY HS++EN +L  V++Y LSIFPI RWLPHYNL WF+SDLIAGITVGCVLVPQS
Sbjct: 108 ISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQS 167

Query: 180 MSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDN 239
           MSYAQIATLP QYGLYSSFIGAF YSLFATSKDVCIGPVAVMSLET KV+TKVLAKYP+ 
Sbjct: 168 MSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEA 227

Query: 240 DPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGL 299
           DP ITAP++AT L+ LCG++TAG+G LRLGFLVELISLNAVTGFMTGSALNI+WGQ+P L
Sbjct: 228 DPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPAL 287

Query: 300 MGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWF 359
           MGY SKVNTRT+ YKVIIE+LKHLPDTKLDAVFGLIPLF+LYLWKWWC NMGP++ DKWF
Sbjct: 288 MGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWF 347

Query: 360 PKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLK 419
               NE+                  +IIIVFTAI+WSIT+GK K +RPISILG+VPKGLK
Sbjct: 348 A--NNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLK 405

Query: 420 EVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI 479
           EVGVMKLPDGL SK+APELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI
Sbjct: 406 EVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLI 465

Query: 480 GTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVI 539
           GTFFNAYPATGSFSRSALKAKC+VRTPLSG+FTG+CVLLALYCLTG F YIPKATLSAVI
Sbjct: 466 GTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVI 525

Query: 540 IQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVC 599
           I AVSDLIASY  TWNFWKMNPLDC  F+VTVFITVFSSIENGIYFA+CWSCAIL+LKV 
Sbjct: 526 IHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFSSIENGIYFAMCWSCAILVLKVA 585

Query: 600 FPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTK-KIQKTSSISFGK 658
           FPAGKFLGR+E+AEV++G VD+                      + K KI     +   K
Sbjct: 586 FPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNLSLSADTINHNKKLKILHIPLLKTLK 645

Query: 659 DAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYI 718
           D     +S+  +    K+RYYTKW+PFDHAYT+ELNP+V ILPPPPGVIVYRLTDSFTY+
Sbjct: 646 DQLFSDISS--IQGKSKIRYYTKWLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYM 703

Query: 719 NCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQF---LKNLFHRKKKNST 775
           NCS+HYDVIF+E+K+QT+RGQL+RHRKK+DRPWNDPGEWEAP F    K L  R+ KN+ 
Sbjct: 704 NCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNN 763

Query: 776 DEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFH 835
           D E         S RD+RPLLK++CLDFSQVAQ+DA+A+QSLVDLRK+IN+YADRQVEFH
Sbjct: 764 DNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFH 823

Query: 836 FAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSR 895
           FAGIVSPW+K+GLIN GFGTIN+E+SD SIIAGH+SYHL R +P  D +L      T   
Sbjct: 824 FAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLAR-IPGDDLELP-----TMRG 877

Query: 896 SQYHVFAATGTNLPFFHIDIPDFSKWDL 923
             Y V+ ATGTNLPFFHIDIPDF +WD+
Sbjct: 878 GNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/928 (62%), Positives = 695/928 (74%), Gaps = 51/928 (5%)

Query: 11  TRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXX 70
           +RE+  +L  ++ EIP++      + N+  +LDDLELEYDQYK +E              
Sbjct: 2   SRETYPNL--EEVEIPDFQD----TSNTVPDLDDLELEYDQYKNNENNDAFK-------- 47

Query: 71  XXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYD-------EKTVSIK 123
                   + + + N   + +   N K  +   +   NP  +  YD       E TVS+K
Sbjct: 48  --------DNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLK 99

Query: 124 DYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA 183
           +YYDHSIR ++TL G RDY  S+FPI  WLPHYN  WFT+DLIAGIT+GCVLVPQSMSYA
Sbjct: 100 EYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA 159

Query: 184 QIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTI 243
           Q+ATLPAQYGLYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+  V AKYPD DP I
Sbjct: 160 QVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAI 219

Query: 244 TAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYN 303
           T P++AT L+LLCGI++A +G LRLGFLVELISLNAV GFMTGSA NILWGQVP LMGYN
Sbjct: 220 TGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN 279

Query: 304 SKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNK 363
           S VNTR A YKV+IETLKHLPDTKLDAVFGLIPLFLLY+WKWWC   GP L D++   +K
Sbjct: 280 SLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRY--NSK 337

Query: 364 NERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGV 423
           N R                  +II+VFT I W+ITRGK+K++RPISILG+VP GLKEVGV
Sbjct: 338 NPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGV 397

Query: 424 MKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFF 483
             +P GL+SKL P LPAS+IVLLLEHIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFF
Sbjct: 398 FHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFF 457

Query: 484 NAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAV 543
           NAYPATGSFSRSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIPKATLSAVII AV
Sbjct: 458 NAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAV 517

Query: 544 SDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAG 603
           SDL+ASY+ TWNFWKMNPLD +CF+VTV ITVF+SIE+GIYFA+CWSCA+LLLK+ FPAG
Sbjct: 518 SDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAG 577

Query: 604 KFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAV 663
           KFLGR+E+AEV D Y+                        + +K   T  I+        
Sbjct: 578 KFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIET 637

Query: 664 AVSTSPVDC------NPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTY 717
            V T   D        P+++Y+TKWVPFDH YTRELNP + ILPPP GV+VYRL++S+TY
Sbjct: 638 NVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTY 697

Query: 718 INCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDE 777
           +NCSRHY++I ++VK  TRRGQL+RHRKK+DRPWNDPG WEAP FLKNL   KK+ S D 
Sbjct: 698 LNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRES-DS 756

Query: 778 ESAVDVSDNS--SIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFH 835
           E   +  DNS  + RD+RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK IN+YADRQVEFH
Sbjct: 757 EFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFH 816

Query: 836 FAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSR 895
           F GI+SPWVKRGL++RGFGT+N+E+SD SI+AGH+SYH+ R +P S  + +         
Sbjct: 817 FVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVAR-VPQSKENSD--------- 866

Query: 896 SQYHVFAATGTNLPFFHIDIPDFSKWDL 923
            +Y V+ A+GTNLPFFHIDIPDF+KWD+
Sbjct: 867 -KYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/922 (62%), Positives = 697/922 (75%), Gaps = 39/922 (4%)

Query: 11  TRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXX 70
           ++E++ +L  ++ EIP++  N     +S  NLDDLELEYDQYK +E              
Sbjct: 2   SKETQPNL--EEVEIPDFQDNT----DSVPNLDDLELEYDQYKNNENNGVFSDNDLESNS 55

Query: 71  XXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSI 130
                   + +  +   +++ + ++        VS  +  +   ++E  VS+K+YY+HSI
Sbjct: 56  VANRNAVNDAKGVKGSKIEYFDPSD--------VSLYDNSV-SQFEESAVSLKEYYNHSI 106

Query: 131 RENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPA 190
           R ++TL G  DY  S+FPI  WLPHYN  WF +DLIAGIT+GCVLVPQSMSYAQ+ATLPA
Sbjct: 107 RSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPA 166

Query: 191 QYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVAT 250
           QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+ +V AKYPD D TIT P++AT
Sbjct: 167 QYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIAT 226

Query: 251 ALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRT 310
            L+LLCGI++A VG LRLGFLVELISLNAV GFMTGSA NILWGQVP LMGYN  VNTR 
Sbjct: 227 TLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRA 286

Query: 311 ANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXX 370
           A YKV+IETLKHLPDTKLDAVFGLIPLFLLY+WKWWC   GP+L D++   +KN R    
Sbjct: 287 ATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNARLHKI 344

Query: 371 XXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGL 430
                         IIIIVFT I W+ITRGK+ ++RPISILG+VP GLKEVGV  +P GL
Sbjct: 345 VKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGL 404

Query: 431 LSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATG 490
           +SKL P LP+S+IVLLLEHIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATG
Sbjct: 405 MSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATG 464

Query: 491 SFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASY 550
           SFSRSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIPKATLSAVII AVSDL+ASY
Sbjct: 465 SFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASY 524

Query: 551 KITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIE 610
           + TWNFWKMNPLD +CF+VTV ITVF+SIE+GIYFA+CWSCA+LLLKV FPAGKFLGR+E
Sbjct: 525 QTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVE 584

Query: 611 VAEVIDGYVD-NXXXXXXXXXXXXXXXXXXXXXXDTKKI------QKTSSISFGKDAKAV 663
           +AEV D YV  +                      D K+I        +  I      K  
Sbjct: 585 IAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGF 644

Query: 664 AVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRH 723
           A  +S +   P+++Y+TKW+PFDH YTRELNP V+ILPPP  V+VYRL++S+TY+NCSRH
Sbjct: 645 ASPSSSIG-QPRIKYHTKWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRH 703

Query: 724 YDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDV 783
           Y++I DEVKR TRRGQ++RHRKK+DRPWNDPG WEAP FLKNL   KKK S D E   + 
Sbjct: 704 YNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKES-DLEFTQNA 762

Query: 784 SDNS--SIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVS 841
            +NS  + RD RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK+IN+YADRQVEFHF GI+S
Sbjct: 763 PNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIIS 822

Query: 842 PWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVF 901
           PWVKRGLI+RGFGTIN+E+SD SI+AGH+SYH+ R +P          R+  +  +Y V+
Sbjct: 823 PWVKRGLISRGFGTINEEYSDESIVAGHTSYHVAR-VP----------RNKENPDKYSVY 871

Query: 902 AATGTNLPFFHIDIPDFSKWDL 923
            A+GTNLPFFHIDIPDF+KWD+
Sbjct: 872 TASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/917 (62%), Positives = 687/917 (74%), Gaps = 47/917 (5%)

Query: 21  DQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPEL 80
           ++ EIP++      + N+  +LDDLELEYDQYK +E                      + 
Sbjct: 10  EEVEIPDFQE----TNNTVPDLDDLELEYDQYKNNENNDTFN----------------DK 49

Query: 81  ETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYD-------EKTVSIKDYYDHSIREN 133
           + + N   + +   ++K  +   +   NP  +  YD       E TVS+K+YYDHSIR +
Sbjct: 50  DLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSH 109

Query: 134 VTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYG 193
           +T+ G   Y  S+FPI  WLPHYN +WFT+DLIAGIT+GCVLVPQSMSYAQ+ATLPAQYG
Sbjct: 110 LTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYG 169

Query: 194 LYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALS 253
           LYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+  V AKYPD D  IT P++AT L+
Sbjct: 170 LYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLA 229

Query: 254 LLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANY 313
           LLCGI++A VG LRLGFLVELISLNAV GFMTGSA NILWGQVP LMGYNS VNTR A Y
Sbjct: 230 LLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATY 289

Query: 314 KVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXX 373
           KV+IETLKHLPDTKLDAVFGLIPLFLLY+WKWWC   GP+L D++   +KN R       
Sbjct: 290 KVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNPRLHKIIKW 347

Query: 374 XXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSK 433
                      IIIIVFT I W+ITRGK+K++RPISILG+VP GLKEVGV  +P GL+SK
Sbjct: 348 TYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSK 407

Query: 434 LAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFS 493
           L P LPAS+IVLLLEHIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFS
Sbjct: 408 LGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFS 467

Query: 494 RSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKIT 553
           RSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIPKATLSAVII AVSDL+ASY+ T
Sbjct: 468 RSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTT 527

Query: 554 WNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAE 613
           WNFWKMNPLD +CF+VTV ITVF+SIE+GIYFA+CWSCA+L+LKV FPAGKFLGR+EVAE
Sbjct: 528 WNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAE 587

Query: 614 VIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVSTSPVD-- 671
           V D YV                        +  K   T  ++         V T   D  
Sbjct: 588 VTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSP 647

Query: 672 ----CNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVI 727
                 P+++Y+TKW+PFDH YTRELNP V ILPPP GV+VYRL++S+TY+NCSRHY++I
Sbjct: 648 SSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNII 707

Query: 728 FDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNL-FHRKKKNSTDEESAVDVSDN 786
            +EVK+ TRRGQL+RHRKK+DRPWNDPG WEAP FLKNL F +K++N  +       +  
Sbjct: 708 TEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSV 767

Query: 787 SSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKR 846
              RD+RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK+IN+YADRQVEFHF GI+SPWVKR
Sbjct: 768 DVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKR 827

Query: 847 GLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGT 906
           GLI+RGFGT+N+E+SD SI+AGH+SYH+ R +P  + + E          +Y V+ A+GT
Sbjct: 828 GLISRGFGTLNEEYSDESIVAGHTSYHVAR-VPQGEENPE----------KYSVYTASGT 876

Query: 907 NLPFFHIDIPDFSKWDL 923
           NLPFFHIDIPDF+KWD+
Sbjct: 877 NLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/921 (62%), Positives = 690/921 (74%), Gaps = 37/921 (4%)

Query: 11  TRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXX 70
           +RE+ +++  +  EIP++  +      +  +LDDLELEYDQYK +E              
Sbjct: 2   SRETHSNIE-EVVEIPDFQDS-----TTVPDLDDLELEYDQYKNNENNGAFNDNDLESNS 55

Query: 71  XXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSI 130
                   E +  +   V++ NT++        +S  +  +   +DE TVS K+YYDHSI
Sbjct: 56  LTNHNTASEAKGVKGSKVEYFNTSD--------ISLYDNSV-SQFDEPTVSFKEYYDHSI 106

Query: 131 RENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPA 190
           R ++TL    +Y  S+FPI  WLPHYN+ WF +DLIAGIT+GCVLVPQSMSYAQ+ATLPA
Sbjct: 107 RSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPA 166

Query: 191 QYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVAT 250
           QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+  V A+YPD D TIT PI+AT
Sbjct: 167 QYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIAT 226

Query: 251 ALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRT 310
            L+LLCGI++A VG LRLGFLVELISLNAV GFMTGSA NILWGQVP LMGYN  VNTR 
Sbjct: 227 TLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRV 286

Query: 311 ANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXX 370
           A YK++I++LKHLPDT LDA FGLIPLF+LY WKWWC   GP+L D++   +K  R    
Sbjct: 287 ATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRF--NSKKPRLHKI 344

Query: 371 XXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGL 430
                         IIIIVFT I+W+ITRGK+ ADRPISILG+VP GLKEVGV  +P GL
Sbjct: 345 VKWTCFYAQASRNGIIIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGL 404

Query: 431 LSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATG 490
           +SKL P LPAS+IVLLLEHIAI+KSFGR+NDYKVVPDQELIAIGV+NL+GTFFNAYPATG
Sbjct: 405 MSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATG 464

Query: 491 SFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASY 550
           SFSRSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIPKATLSAVII AVSDL+ASY
Sbjct: 465 SFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASY 524

Query: 551 KITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIE 610
           + TWNFWKMNPLD +CF+VTV ITVFSSIENGIYFA+CWSCAI +LKV FPAGKFLGR+E
Sbjct: 525 QTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVE 584

Query: 611 VAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSI--SFGKDAKAVAV--- 665
           +AEV D YV                          +K   T+ I  SF K    V     
Sbjct: 585 IAEVTDAYVRADSDSVSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGF 644

Query: 666 -STSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHY 724
            S S     P+++Y+TKW+PFDH YT+ELNP VNILPPP GV+VYRL++S+TYINCSRHY
Sbjct: 645 ESPSASIGQPRIKYHTKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHY 704

Query: 725 DVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVS 784
           +VI DE+K+ TRRGQL+RHRKK+DRPWNDPG WE P F KNL   KKK  TD ES+ +  
Sbjct: 705 NVITDEIKKVTRRGQLIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKKK-ETDIESSENAV 763

Query: 785 DN--SSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSP 842
           +N   ++RD+RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK+IN+YADRQVEFHF GI+SP
Sbjct: 764 NNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISP 823

Query: 843 WVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFA 902
           WVKRGLI+RGFGT+N+E+SD SI+AGH+SYH+ R   + +           +  +Y V+ 
Sbjct: 824 WVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQNEE-----------TPDKYSVYT 872

Query: 903 ATGTNLPFFHIDIPDFSKWDL 923
           A+GTNLPFFHIDIPDF+KWD+
Sbjct: 873 ASGTNLPFFHIDIPDFAKWDI 893

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/915 (62%), Positives = 676/915 (73%), Gaps = 23/915 (2%)

Query: 9   FNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXX 68
           F   +S+N   N+     N  + +    +ST +LD+LELEYDQYK  E            
Sbjct: 8   FRQEDSDNSFPNEYGAEYNNANEV----SSTPDLDNLELEYDQYKADELHPQRTILSNQA 63

Query: 69  XXXXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDH 128
                      +E Q   D    + +  +E QY    +    +IP+Y E  V+  ++++H
Sbjct: 64  DTDREKIANVFVEEQSVRDSNIPSASI-EELQYFAHESDGAKVIPSYVEGNVTELEFFNH 122

Query: 129 SIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATL 188
           S+R   TL   ++Y LSIFPI  WLPHYN+ WF  DLIAGITVGCVLVPQSMSYAQIATL
Sbjct: 123 SLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATL 182

Query: 189 PAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIV 248
           P QYGLYSSFIGAF YSLFATSKDVCIGPVAVMSLETAK++ +V+ ++P NDP +  PI+
Sbjct: 183 PPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFP-NDPDVQGPII 241

Query: 249 ATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNT 308
           AT  +LLCG + AGVG LRLGFLVELISLNAV GFMTGSALNI+ GQVP LMGY   VNT
Sbjct: 242 ATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNT 301

Query: 309 RTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXX 368
           RTA YKVI+ TLKHLPDTKLDAVFGLIPLF+LY W+WWC+  GPKL D+++PK    R  
Sbjct: 302 RTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKG--SRGN 359

Query: 369 XXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPD 428
                           IIIIVFTAISWSITR     +R ISILGTVPKGLK+VG +K+P 
Sbjct: 360 FLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPP 419

Query: 429 GLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 488
            L +K+APELPA+VIVLLLEHIAI+KSFGRINDYKVVPDQELIAIGVTNLIGTFF+AYP 
Sbjct: 420 ELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPT 479

Query: 489 TGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIA 548
           TGSFSRSALKAKC V+TPLSG+FTG+CVLLALYCLTGAFFYIPKATLSAVII +VSDL+A
Sbjct: 480 TGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVA 539

Query: 549 SYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGR 608
           SY  TWNF+KMNPLD +CFL T+ ITVFSSIENGIYFA+CWSCA+LL KV FPAGKFLGR
Sbjct: 540 SYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGR 599

Query: 609 IEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVSTS 668
           +E+AEV+DG + N                        K   K+  I   KD      S+S
Sbjct: 600 VEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIV--KDKLDSTASSS 657

Query: 669 PVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIF 728
            +  N K++YYTKWVPFDHAYTRELNP V I PPPPGVIVYR++DS+TYIN S HYD+I 
Sbjct: 658 SIAEN-KLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIII 716

Query: 729 DEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSS 788
           DE+KR TRRGQLL+HRKK+DRPWNDPGEW+ P+FL N+ H +K    ++ + V+  +   
Sbjct: 717 DEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGI 776

Query: 789 IRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGL 848
           +RD RP+LK++CLDFSQVAQ+D++++QSLVDLRK++N YADRQVEFHFAGI+SPW+KRGL
Sbjct: 777 VRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGL 836

Query: 849 INRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNL 908
           +  GFGT+N+EFSD SIIAGHSSYHL +   ++  D+E+          Y V  ATGTNL
Sbjct: 837 VKIGFGTVNEEFSDESIIAGHSSYHLVK---NTIGDIENG---------YQVKTATGTNL 884

Query: 909 PFFHIDIPDFSKWDL 923
           PFFHIDIPDF KWD+
Sbjct: 885 PFFHIDIPDFKKWDI 899

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1111 bits (2874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/894 (61%), Positives = 656/894 (73%), Gaps = 43/894 (4%)

Query: 36  GNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPELETQQNLDVQFSNTTN 95
            +S   LDDLE EYD YK +E                      +   ++ +D+       
Sbjct: 11  ADSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSED--------DYGNKKGIDLV------ 56

Query: 96  NKENQYRIVSTVNPVII----PNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITR 151
            KE + R   +  P  I    P ++E TVS+KDYY+  IRE +TL     Y  S+FPI +
Sbjct: 57  -KETEVRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVK 115

Query: 152 WLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSK 211
           W PHYNLTW  +DL+AGITVGCVLVPQSMSYAQIA+LP QYGLYSSFIGAF YSLFATSK
Sbjct: 116 WFPHYNLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSK 175

Query: 212 DVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFL 271
           DVCIGPVAVMSL+TAKV+ +V AKYP+NDP +TAP++ATALSLLCGIV  GVG+LRLGFL
Sbjct: 176 DVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFL 235

Query: 272 VELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAV 331
           VELISLNAV GFMTGSA NILWGQVP LMGY+SKVNTR + YKV+I++LKHLPDTKLDAV
Sbjct: 236 VELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAV 295

Query: 332 FGLIPLFLLYLWKWWCDNMGPKLVDKWFPKN-KNERXXXXXXXXXXXXXXXXXXIIIIVF 390
           FGL+PL LLYLWKWWC   GPKL D+    + K +R                  +IIIVF
Sbjct: 296 FGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQR---ILKRFYFYSNAMRNAVIIIVF 352

Query: 391 TAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHI 450
           TAISW IT+ K K  RPI +LGTVP GL++VGV K+P+GLL+K+AP++PAS+IVLLLEHI
Sbjct: 353 TAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHI 412

Query: 451 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGI 510
           AI+KSFGRINDYKVVPDQELIAIG TNLIGTFFNAYPATGSFSRSALKAKC+VRTP SG+
Sbjct: 413 AISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGV 472

Query: 511 FTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVT 570
           FTG CVL+A+YCLT AFF+IP ATLSAVII AVSDL+ASYK TWNFWKMNPLDC  F+VT
Sbjct: 473 FTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVT 532

Query: 571 VFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXX 630
           V ITVFSSIENGIYFA+CWSCA+LLLK  FPAG+FLGR+EVAEVI+  V           
Sbjct: 533 VLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTV----------- 581

Query: 631 XXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYT 690
                        D  +     S S   D  A++ S+         ++++KWV   +AY 
Sbjct: 582 ---VEDVEAISINDQIEGSVGKSKSLKADKGAISASS-----GSNYKFHSKWVAEQYAYN 633

Query: 691 RELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRP 750
           RELNP V ILPPPPGV+VYR++DSFTYINCSRHYD IFD +K+ TRRGQLL  RKK+DRP
Sbjct: 634 RELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRP 693

Query: 751 WNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQID 810
           WNDPGEWE    +K  F   KKN  D ES  +     + RD RPLLKI+CLDFSQV Q+D
Sbjct: 694 WNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVD 753

Query: 811 ASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHS 870
           ++AIQSLVDLRK++++YADRQVEFHF GI+S WVKR L++ GFGT+N  +SD SIIAGHS
Sbjct: 754 STAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHS 813

Query: 871 SYHLTRTL-PDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
           SYH+ +T  P +D     +   +  +    ++AATGTN+PFFH+DIPDFSKWDL
Sbjct: 814 SYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/823 (65%), Positives = 633/823 (76%), Gaps = 46/823 (5%)

Query: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171
           IP Y+E TV++KDYYDH+I++N+TL     Y  S+FPI +WLPHYN TW  +DL+AGITV
Sbjct: 76  IPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGITV 135

Query: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231
           GCVLVPQSMSYAQIA+L  +YGLYSSFIGAF YSLFATSKDVCIGPVAVMSL+TAKV+ +
Sbjct: 136 GCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 195

Query: 232 VLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNI 291
           VL KYP++   +T PI+AT L LLCG+V  G+GVLRLGFLVELISLNAV GFMTGSA +I
Sbjct: 196 VLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFSI 255

Query: 292 LWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMG 351
           +WGQ+P LMGYN  VNTR A YKV+I TLKHLP+TKLDAVFGLIPL +LYLWKWWC + G
Sbjct: 256 IWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSFG 315

Query: 352 PKLVDKWF---PKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPI 408
            KLVD+ +   PK  N                    ++IIVFTAIS+ ITR K+K  RPI
Sbjct: 316 IKLVDRHYSNQPKTANR-----IKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPI 370

Query: 409 SILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQ 468
           SILGTVP GL EVGVMK+PDGLLS ++ ELPAS+IVL+LEHIAI+KSFGRINDYKV+PDQ
Sbjct: 371 SILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQ 430

Query: 469 ELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFF 528
           ELIAIGVTNLIGTFF++YPATGSFSRSALKAKC VRTP SG+FTGACVLLALYCLT AFF
Sbjct: 431 ELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFF 490

Query: 529 YIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVC 588
           YIPKATLSAVII AVSDL+ASY+ TWNFWKMNPLDC+ F+VTV ITVFSSIENGIYFA+C
Sbjct: 491 YIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMC 550

Query: 589 WSCAILLLKVCFPAGKFLGRIEVAEV----IDGYVDNXXXXXXXXXXXXXXXXXXXXXXD 644
           WSCA+LLLK  FPAGKFLGR+EVAEV    I G++D+                       
Sbjct: 551 WSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSIVS-------------------- 590

Query: 645 TKKIQKTSSISFGKDAKAVAVSTSPVDCNP--KVRYYTKWVPFDHAYTRELNPSVNILPP 702
                  S   F K  K      S VD  P  + ++  KWVPFDHAYTRELN    + PP
Sbjct: 591 ----PNESPNEFSKQVK------SSVDALPSSEYKFSVKWVPFDHAYTRELNSYTRVRPP 640

Query: 703 PPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQF 762
           PPGVIVYR +DSFTY+NCSRHYDVIFD +K +TRRGQL+  RKK+DRPWNDPGEW+ P  
Sbjct: 641 PPGVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNS 700

Query: 763 LKNLFHRKKKNSTDEESAVDVSDNSSIRD-NRPLLKIVCLDFSQVAQIDASAIQSLVDLR 821
            KN+F  K+  +T       V+DN++     +PLLK+VCLDFSQVAQ+D++A+QSLVDLR
Sbjct: 701 FKNIFRVKRGLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLR 760

Query: 822 KSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDS 881
           K++N+YADRQVEFHFAGI+SPW+KR L++  FGTIN+EFSD SII GHSS+H+ + L D 
Sbjct: 761 KAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDE 820

Query: 882 -DFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
            D+  E +       +   + AATGTNLPFFHIDIPDFSKWD+
Sbjct: 821 VDYTDEDSPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/818 (65%), Positives = 632/818 (77%), Gaps = 36/818 (4%)

Query: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171
           IP Y+E TV++K+YYDHSI+ N+T      Y +S+FPI +W PHYN TW  +DL+AGITV
Sbjct: 72  IPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGITV 131

Query: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231
           GCVLVPQSMSYAQIA+L  +YGLYSSFIGAF YSLFATSKDVCIGPVAVMSL+TAKV+ +
Sbjct: 132 GCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 191

Query: 232 VLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNI 291
           VL KYP++   +TAPI+AT L LLCGIV  G+G+LRLGFLVELISLNAV GFMTGSA NI
Sbjct: 192 VLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNI 251

Query: 292 LWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMG 351
           +WGQ+P LMGYNS VNTR A YKV+I TLKHLP+TKLDAVFGLIPL +LY+WKWWC   G
Sbjct: 252 IWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFG 311

Query: 352 PKLVDKWF---PKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPI 408
             L D+++   PK  N                    ++I+VFTAISWSITR K+  DRPI
Sbjct: 312 ITLADRYYRNQPKVANR-----LKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPI 366

Query: 409 SILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQ 468
           SILGTVP GL EVGVMK+PDGLLS ++ E+PAS+IVL+LEHIAI+KSFGRINDYKVVPDQ
Sbjct: 367 SILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQ 426

Query: 469 ELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFF 528
           ELIAIGVTNLIGTFF++YPATGSFSRSALKAKC VRTP SG+FTG CVLLALYCLT AFF
Sbjct: 427 ELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFF 486

Query: 529 YIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVC 588
           +IPKATLSAVII AVSDL+ SYK TW FWK NPLDC+ F+VTVFITVFSSIENGIYFA+C
Sbjct: 487 FIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMC 546

Query: 589 WSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKI 648
           WSCA+LLLK  FPAGKFLGR+EVAEV++  V                        D   +
Sbjct: 547 WSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQE----------------------DIDAV 584

Query: 649 QKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIV 708
              SS     +      ST  V   P+ ++  KWVPFDH Y+RELN +  + PPPPGVIV
Sbjct: 585 --ISSNELPNELNKQVKSTVEVLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIV 642

Query: 709 YRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFH 768
           YRL DSFTY+NCSRHYD+IFD +K +TRRGQL+  RKK+DRPWNDPGEW+ P  LK+LF 
Sbjct: 643 YRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLF- 701

Query: 769 RKKKNSTDEESAVDVSDNSSIRD--NRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINR 826
           + K++S    S + +S+ SS  +   +PLLK+VCLDFSQVAQ+D++A+QSLVDLRK++NR
Sbjct: 702 KFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNR 761

Query: 827 YADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLE 886
           YADRQVEFHFAGI+SPW+KR L++  FGT N+E+SD SIIAGHSS+H+ + L D     +
Sbjct: 762 YADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTD 821

Query: 887 SNFRDTYSRSQYHVF-AATGTNLPFFHIDIPDFSKWDL 923
            + R + S S Y    AATGTNLPFFHIDIPDFSKWD+
Sbjct: 822 EDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/859 (62%), Positives = 641/859 (74%), Gaps = 44/859 (5%)

Query: 79  ELETQQNLDVQFSNTTN-----NKENQYRI----VSTVNPVIIPNYDEKTVSIKDYYDHS 129
           E E  +N D  F N  +     N + +Y +    VS V    IP Y+E TV++K+YYDHS
Sbjct: 35  ESEAAENRD-NFQNGDDQSWKINGKQKYEVTKSEVSDVAYDSIPAYEESTVTLKEYYDHS 93

Query: 130 IRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLP 189
           I+ ++T+    DY  S+FPI +WLPHYN TW  +DL+AGITVGCVLVPQSMSYAQIA+L 
Sbjct: 94  IKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLS 153

Query: 190 AQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVA 249
            +YGLYSSFIGAF YSLFATSKDVCIGPVAVMSL+TAKV+ +VL KYP+    +T PI+A
Sbjct: 154 PEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIA 213

Query: 250 TALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTR 309
           TAL  LCG+V+  +GVLRLGFLVELISLNAV GFMTGSA +I+WGQ+P LMGYNS VNTR
Sbjct: 214 TALCFLCGVVSTALGVLRLGFLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTR 273

Query: 310 TANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWF---PKNKNER 366
            A YKV+I TLKHLP+TKLDAVFGLIPL +LY+WKWWC   G  L D+++   PK  N  
Sbjct: 274 EATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANR- 332

Query: 367 XXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKL 426
                             ++IIVFTAISW ITR K+  +RPISILGTVP GL EVGVMK+
Sbjct: 333 ----LKSFYFYAQAMRNAVVIIVFTAISWRITRNKSSKERPISILGTVPSGLNEVGVMKI 388

Query: 427 PDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAY 486
           P+GLLS ++ ELPAS+IVL+LEHIAI+KSFGRINDYKV+PDQELIAIGVTNLIGTFF++Y
Sbjct: 389 PEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSY 448

Query: 487 PATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDL 546
           PATGSFSRSALKAKC VRTP SGIFTGACVLLALYCLT AFF+IPKATLSAVII AVSDL
Sbjct: 449 PATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYCLTSAFFFIPKATLSAVIIHAVSDL 508

Query: 547 IASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFL 606
           + SYK TW FWK NPLDC+ F+ TVFITVFSSIENGIYFA+CWSCA+LLLK  FPAGKFL
Sbjct: 509 LTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFL 568

Query: 607 GRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVS 666
           GR+EVAEV++  V                               TSS     +      S
Sbjct: 569 GRVEVAEVLNPTVQEGINAV------------------------TSSNELPNELSKQVKS 604

Query: 667 TSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDV 726
           T  V   P+ ++  KW+PFDH Y+RELN    + PPPPGVIVYRL DSFTY+NCSRHYD+
Sbjct: 605 TVDVLPAPEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDI 664

Query: 727 IFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKN-STDEESAVDVSD 785
           IFD +K +TRRGQL+  RKK+DRPWNDPGEW+ P   K LF  K+K+ +TD E  V    
Sbjct: 665 IFDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPVSSGR 724

Query: 786 NSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVK 845
           N+     +PLLK+VCLDFSQVAQ+D++A+QSLVDLRK++N+YADRQVEFHFAGI+SPW+K
Sbjct: 725 NNQESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIK 784

Query: 846 RGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVF-AAT 904
           R L++  FGT N+E+SD SIIAGHSS+H+ + L D     E + R + S S Y    AAT
Sbjct: 785 RSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAAT 844

Query: 905 GTNLPFFHIDIPDFSKWDL 923
           GTNLPFFHIDIPDFSKWD+
Sbjct: 845 GTNLPFFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1088 bits (2815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/817 (64%), Positives = 632/817 (77%), Gaps = 37/817 (4%)

Query: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171
           IP Y+E TV++K+YY HSI+ ++T     +Y  S+FPI +WLPHYN TW  +DL+AGITV
Sbjct: 66  IPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGITV 125

Query: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231
           GCVLVPQSMSYAQIA+L  +YGLYSSF+GAF YSLFATSKDVCIGPVAVMSL+TAKV+ +
Sbjct: 126 GCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 185

Query: 232 VLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNI 291
           VL KYP +   +T PI+ATAL LLCGIVT  +GVLRLGFLVELISLNAV GFMTGSA +I
Sbjct: 186 VLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFSI 245

Query: 292 LWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMG 351
           +WGQVP LMGYN  VNTR + YKV+I TLKHLP+TKLDAVFGLIPL +LY+WKWWC   G
Sbjct: 246 IWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTYG 305

Query: 352 PKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISIL 411
             L ++ +    + +                  ++I+VFTAISWSITR KA  DRPISIL
Sbjct: 306 ITLANRHY--QNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISIL 363

Query: 412 GTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELI 471
           GTVP GL EVGVMK+P+GLLS ++ ELPAS+IVL+LEHIAI+KSFGRINDYKVVPDQELI
Sbjct: 364 GTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELI 423

Query: 472 AIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIP 531
           AIGVTNL+GTFF++YPATGSFSRSALKAKC VRTP SG+FTG CVLLALYCLT AFF+IP
Sbjct: 424 AIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIP 483

Query: 532 KATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSC 591
           KATLSAVII AVSDL+ SY+ TW FWK NPLDC+ F+VTVFITVFSSIENGIYFA+CWSC
Sbjct: 484 KATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSC 543

Query: 592 AILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKT 651
           AILLLK  FPAG+FLGR+EVAE+++  + N                             +
Sbjct: 544 AILLLKQAFPAGRFLGRVEVAEILNPTLQNNV---------------------------S 576

Query: 652 SSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRL 711
           + +S  +  K V  +T  V  + + R+ TKWVPFDH Y+RELN    I PPPPGVIVYRL
Sbjct: 577 AVVSLNESNKQVK-TTVDVLRSSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRL 635

Query: 712 TDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKK 771
           +DSFTY+NCSRHYD+IFD VK +TRRGQL+  RKK+DRPWNDPGEW+ P  LK LF  K+
Sbjct: 636 SDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKR 695

Query: 772 KNSTDEESAVDVSDNSSIRDN--RPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYAD 829
           K+ T+ E    VS+ S+ R +  +PLLK++CLDFSQVAQ+D++AIQSLVDLRK++N+YAD
Sbjct: 696 KSVTENEEP-SVSNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYAD 754

Query: 830 RQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDL---E 886
           RQVEFHFAGI+SPW+KR L +  FGT+N+E+SD S+IAGHSS H+T+   D D D    E
Sbjct: 755 RQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEE 814

Query: 887 SNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
           S+    YS     + AATGTNLPFFHIDIPDFSKWD+
Sbjct: 815 SHISAPYSNYG-TLCAATGTNLPFFHIDIPDFSKWDI 850

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/909 (59%), Positives = 656/909 (72%), Gaps = 44/909 (4%)

Query: 40  QNLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPELETQQNLDVQFSNTTNNKEN 99
           + LD+LELEY+Q+K +E                       L+T++  +   ++ +   + 
Sbjct: 2   EELDNLELEYNQFKNNERPSNTNAGADIEKG---------LDTKKYFERSITDNSTYGKK 52

Query: 100 QYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLT 159
            Y I         P+Y+E T+++KDYYD ++R+  T   V DY  S+FP+  WLP YN  
Sbjct: 53  SYSI---------PSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPK 103

Query: 160 WFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVA 219
           WF SDLIAGITVG VLVPQSMSYAQIATLP +YGLYSSFIGA  YS FATSKDVCIGPVA
Sbjct: 104 WFLSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVA 163

Query: 220 VMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNA 279
           VMSL+TAKV+ +V  K+PD DP+IT PI+AT L+ +CGI+  GVG+LRLGFLVELISLNA
Sbjct: 164 VMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNA 223

Query: 280 VTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFL 339
           V GFMTGSA NI+WGQ+PGLMGY+ KVNTR + Y V+I++LKHLPDTKLDA FGLIPLF 
Sbjct: 224 VAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFT 283

Query: 340 LYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITR 399
           L+ WKWWC++MGPKL D++FP N   R                  IIII+FTA+S+ IT+
Sbjct: 284 LFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITK 343

Query: 400 GKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRI 459
           G AK  R IS+LGTVPKGL+  GVMKLP G+L+ +A E+P+S+IVLLLEHIAI+KSFGR+
Sbjct: 344 GVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRV 403

Query: 460 NDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLA 519
           NDYK+ P+QE+IAIGV+NL+GTFFNAYPATGSFSRSALKAKC V TPLSGIF+ ACVLLA
Sbjct: 404 NDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLA 463

Query: 520 LYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSI 579
           +YCLTGAFFYIPKATLSAVII AV DLIASY  TW+ WKMN  D + F+ TVFITVFSSI
Sbjct: 464 IYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSI 523

Query: 580 ENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYV--DNXXXXXXXXXXXXXXXX 637
           ENGIYFAVCWSCAILL    FPAGKFLGRIE+AEV++  +  D+                
Sbjct: 524 ENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGI 583

Query: 638 XXXXXXDTKKIQKTSS--ISFGKDAKAVAVSTSPVD--CNPKVRYYTKWVPFDHAYTREL 693
                    K+  +S+    F    K  +++   V+   +  +RYYTKWVPFDHAY++EL
Sbjct: 584 YFDNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKEL 643

Query: 694 NPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWND 753
           NPSV I PPPPGVIVYRL+DS+TYINCSRHYD+IFDE+KR TRRGQL++HR K DRPWND
Sbjct: 644 NPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWND 703

Query: 754 PGEWEAPQFLKNLFHRKKKNSTDEESAVDVSD----------------NSSIRDNRPLLK 797
           PGEWEAP  LK  F+ KK  S  +    DV                    + +D RPLL+
Sbjct: 704 PGEWEAPD-LKKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLR 762

Query: 798 IVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTIN 857
           +VCLDFSQVA  DA+A+QSL DLRK++N+YADRQVEFHF GI SPW+KRGL N GFGT N
Sbjct: 763 VVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTN 822

Query: 858 DEFSDASIIAGHSSYHLTR---TLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHID 914
           +E+SD SIIAGHSSYHL+R   +  D   +L+S        S+  V AA+GTNLPFFH+D
Sbjct: 823 EEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVD 882

Query: 915 IPDFSKWDL 923
           IPDFSKWD+
Sbjct: 883 IPDFSKWDI 891

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/888 (61%), Positives = 648/888 (72%), Gaps = 72/888 (8%)

Query: 41  NLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPELETQQNLDV----QFSNTTNN 96
           NLDDLE E++QYK  E                         T+QN +V    Q  +  N 
Sbjct: 14  NLDDLEQEFNQYKKIELTIS--------------------STRQNEEVDSKRQGKSDKNV 53

Query: 97  KENQY-RIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPH 155
           K + +  I S      +P Y+E +++I DYY +S+R   T   + DY  S+FPI  WLPH
Sbjct: 54  KSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPH 113

Query: 156 YNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCI 215
           YNLTWF SDLIAGITVGCVLVPQSMSYAQIATL  Q+GLYSSFIGAF YSLFATSKDVCI
Sbjct: 114 YNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCI 173

Query: 216 GPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELI 275
           GPVAVMSL+TAKV+ +V  K P +D  ITA  +AT L+LLCGI+  GVG+LRLGFLVELI
Sbjct: 174 GPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELI 232

Query: 276 SLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLI 335
           SLNAV GFMTGSALNI+ GQVPGLMGYNS+VNTRT+ YKVII+TLKHLPDTKLDAVFGLI
Sbjct: 233 SLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLI 292

Query: 336 PLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISW 395
           PLFLL+ WKW CD +GP+L ++ F   KN R                  IIIIVFT ISW
Sbjct: 293 PLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISW 352

Query: 396 SITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKS 455
           +ITRGK    RPIS+LG+VPKGLK+V    +P GL++KLAPELPAS+IVLLLEHIAIAKS
Sbjct: 353 AITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKS 412

Query: 456 FGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGAC 515
           FGRINDYK+VPDQE++AIG+TNL+GTFF+AYPATGSFSRSALKAKC VRTPLSG+F+GAC
Sbjct: 413 FGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGAC 472

Query: 516 VLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITV 575
           VLLALYCLTGAFFYIPKATL AVII AVS+LIASYK T NFWKMNPLDC CFLVTV ITV
Sbjct: 473 VLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITV 532

Query: 576 FSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXX 635
           F+SIE+GIYFA+CWS A+LL KV FP GKFLG+IE+ EV+DG +                
Sbjct: 533 FASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVL--------- 583

Query: 636 XXXXXXXXDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNP 695
                    T   + +  +   K   +V V +   + N    YYTKWVPFD +YT+ELNP
Sbjct: 584 ---------TSSDENSEILPTTKAGYSVEVVS---NHNENTNYYTKWVPFDFSYTKELNP 631

Query: 696 SVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPG 755
             +I PPPPGVIVYR+ DSFTY+NCSRH+D++FDE+KR T+RG+L +  +K+DRPWNDPG
Sbjct: 632 DAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPG 691

Query: 756 EWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQ 815
           +WE   F+K    R+      +E  VD+ D   + D+RP LKI+CLDFSQV+QIDA+AIQ
Sbjct: 692 KWEPRVFIKKYLRRENY----DEDNVDIEDR--VIDDRPFLKIICLDFSQVSQIDATAIQ 745

Query: 816 SLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLT 875
            L DLRKS+N+YADRQVEFHF GI+SPW+K+ L N GFGTIN+E+SD SII GHSSYHLT
Sbjct: 746 CLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLT 805

Query: 876 RTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
           +     D D               + AATGTNLPFFHIDIP+F+KWD+
Sbjct: 806 K-----DVD--------------GIKAATGTNLPFFHIDIPNFNKWDI 834

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1081 bits (2796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/843 (62%), Positives = 652/843 (77%), Gaps = 38/843 (4%)

Query: 87  DVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSI 146
           D+ +++ +N    +  + S+ N   +P Y E+TV++K+YY+HSIR  +T     +Y +SI
Sbjct: 56  DLGYTDDSNELTRESFLNSSEN---VPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISI 112

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSL 206
           FPI +WLP YN  W  SDLIAGIT+GCVLVPQSMSYAQIATLP QYGLYSSF+GA+ YSL
Sbjct: 113 FPIIKWLPFYNYKWLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSL 172

Query: 207 FATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPT-ITAPIVATALSLLCGIVTAGVGV 265
           FATSKDVCIGPVAVMSL+TAKV+  V +   +   T ITAP++AT L+LLCGI++AGVG+
Sbjct: 173 FATSKDVCIGPVAVMSLQTAKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGL 232

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325
           LRLGFLVELISLNAVTGFMTGSALNI+ GQVP LMGY S+VNTR A YKVII TLKHLPD
Sbjct: 233 LRLGFLVELISLNAVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPD 292

Query: 326 TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXI 385
           TK+DA+FGLIPL +LY WKWW  +MGPKLVD+++P +K ++                  I
Sbjct: 293 TKIDAIFGLIPLVILYFWKWWFSSMGPKLVDRYYPNSKYKKYIKAFYFYGNAMRSG---I 349

Query: 386 IIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVL 445
           IIIV T+ISWS+TRGK+K++RPISILGTVP GL+EVGV   P+GLL+K+APELP+S+IVL
Sbjct: 350 IIIVMTSISWSVTRGKSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVL 409

Query: 446 LLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRT 505
           LLEHIAIAKSFGR+NDYKVVPDQELIAIG++NLIGTFFN+YP TGSFSRSALKAKC V+T
Sbjct: 410 LLEHIAIAKSFGRVNDYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKT 469

Query: 506 PLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCL 565
           PLSGIFTG+CVLLALYCLTGAFFYIPKATLSAVII AVSDL+ASYK TW+FWKMNPLD +
Sbjct: 470 PLSGIFTGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFI 529

Query: 566 CFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXX 625
           CF+ TVFITVF+SIE+GIYF +CWS AILL KV FPAGKFLG +++AE+++  + +    
Sbjct: 530 CFITTVFITVFASIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVD---- 585

Query: 626 XXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPF 685
                             +  +     S       K      S      +++Y+ KW+P+
Sbjct: 586 -------------SDYLVEKAETSVQYSTVLMNPEKGELSYLSSKSSESQLKYHIKWIPY 632

Query: 686 DHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRK 745
           DHAYT+E+NP+V + PPP GVIVYRLT+SFTYINCSR+Y+ ++D+VK  TR GQL+ H K
Sbjct: 633 DHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIK 692

Query: 746 KADRPWNDPGEWEAPQFLKNLFH-RKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFS 804
           K+DRPWNDPG+W+ P+FLKN+ + RK KN  DE +  D    + + D RP+LKI+CLDFS
Sbjct: 693 KSDRPWNDPGDWKPPKFLKNIINWRKNKNKDDEPTTFD----NKVVDTRPILKIICLDFS 748

Query: 805 QVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDAS 864
           QVAQ D++A+QSL+DLR++IN+YADRQVEFHF+GI+SPWVK+GL+N GFGT+N E+SD S
Sbjct: 749 QVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDES 808

Query: 865 IIAGHSSYHLTRTLPDSDFDLESNFRDTYSR----SQYHVFAATGTNLPFFHIDIPDFSK 920
           II GH+SYH+ +T      DLE+N   T       S Y++ A TGTN PFFHI+IPDFSK
Sbjct: 809 IIIGHTSYHVVKTE-----DLENNPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSK 863

Query: 921 WDL 923
           W++
Sbjct: 864 WNI 866

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/892 (60%), Positives = 643/892 (72%), Gaps = 50/892 (5%)

Query: 34  SSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPELETQQNLDVQFSNT 93
           SS  +  NLDDLE EYD YK +E                         T QN      N 
Sbjct: 19  SSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPT---------THQNDAKGLKND 69

Query: 94  TNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWL 153
                  Y   S+    +IP Y E TV+ KDYYD S+  N++    R+Y +S+FP+ RW+
Sbjct: 70  GQTTVELYGTTSSGG--VIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWI 127

Query: 154 PHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDV 213
           PHYN  W   D++AG+TVGCVLVPQSMSYAQIA+LPAQYGLYSSFIGAF YS FATSKDV
Sbjct: 128 PHYNFAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDV 187

Query: 214 CIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVE 273
           CIGPVAVMSLETAKV+ +V    PD D  IT PI+ATALSLLCG +T G+GVLRLGFLVE
Sbjct: 188 CIGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVE 246

Query: 274 LISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFG 333
           LISLNAV GFMTGSA +I+ GQ+P LMGYN KVNTR   YKV+I TLKHLPDTKLDAVFG
Sbjct: 247 LISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFG 306

Query: 334 LIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAI 393
           LIPL +LYLWK+ C+ +GP  VD+    N +                     +I++FT I
Sbjct: 307 LIPLLILYLWKYGCNTIGPNWVDRRM--NPHSPRAKFWKSFFFYAQALRNAFVIVLFTLI 364

Query: 394 SWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIA 453
           +W ITR K K   PIS+L TVP GLK VGVMK PD L + LAPELPA+ I+LLLEHIAIA
Sbjct: 365 AWGITRHKKK--HPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIA 422

Query: 454 KSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTG 513
           K+FGRINDYKVVPDQELIAIGVTNL+GTFFNAYPATGSFSRSALKAKC VRTPLSG+FTG
Sbjct: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482

Query: 514 ACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFI 573
           ACVLLALYCLT AF+YIPKATLSAVII AVSDLIASY+ TWNFWKMNPLDCLCFLVTVFI
Sbjct: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFI 542

Query: 574 TVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXX 633
           T+FSSIENGIYFA+CWSCAILL K+ FP+GKFLGR+EV+EVI+  V              
Sbjct: 543 TIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVRE------------ 590

Query: 634 XXXXXXXXXXDTKKIQKTSSI--SFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTR 691
                     D++ I   SS     G  A   ++ST P     +VR++TKW+P ++ Y R
Sbjct: 591 --DLGVVEDFDSENINVASSTKPKLGLSADNSSISTGP----SRVRFHTKWIPLENNYGR 644

Query: 692 ELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPW 751
           E N  + + PPPPGVIVYR ++S+TYINCSR YD+IFDEVKR TRRG +L H KK+DRPW
Sbjct: 645 EYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPW 704

Query: 752 NDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDA 811
           NDPG+WE P FLK LF R K+   ++E + ++      RD RP+LKI+ +D+SQV QIDA
Sbjct: 705 NDPGQWEPPLFLKKLFKRGKR--LEQELSPELG-----RDERPVLKILAMDWSQVTQIDA 757

Query: 812 SAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSS 871
           + +Q+LVDLRK+IN+YADRQVEFHF+GI+SPW+KR L+  GFGT+NDEF+D S+I GHSS
Sbjct: 758 TGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSS 817

Query: 872 YHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
           YH+ +T P  +        +   + +Y++ AA+GTN+PFFH+++PDFSKW L
Sbjct: 818 YHIVKTRPQDE-------ENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/938 (57%), Positives = 661/938 (70%), Gaps = 51/938 (5%)

Query: 13  ESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXX--XX 70
           + +ND + D  ++ N   +  S+ N T +L+ LE EYDQYK  E                
Sbjct: 4   DKKNDTTVDNRDLDNIELSSYSNSN-TVDLEALEEEYDQYKKEEEIEYISGNYLNSSPTQ 62

Query: 71  XXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTV---NPVIIPNYDEKTVSIKDYYD 127
                  P+ E  + L         + +  Y  VST       +IP ++E  ++ K+YY+
Sbjct: 63  NINVTSNPKYEEYKKL--------KHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYN 114

Query: 128 HSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIAT 187
           HS++E  T    ++Y LSIFPI  WLP YN  WF SDLIAGIT+GCVLVPQSMSYAQIAT
Sbjct: 115 HSLKEYFTFNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIAT 174

Query: 188 LPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPI 247
           L  QYGLYSSFIGAF Y+LFATSKDVCIGPVAVMSLETAKV+  V + +  NDP +T PI
Sbjct: 175 LDPQYGLYSSFIGAFVYALFATSKDVCIGPVAVMSLETAKVIADVSSHF-QNDPDVTGPI 233

Query: 248 VATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVN 307
           +AT L+LLCG + A VG LRLGFLVELISLNAVTGFMTGSA NILWGQVPGLMGY+  VN
Sbjct: 234 IATTLALLCGGIAAAVGFLRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVN 293

Query: 308 TRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERX 367
           TR A YKV+I+TLKHLPDTKLDAVFGLIPLF+LY+ KWWC N G +L +K F  + NER 
Sbjct: 294 TRQATYKVVIDTLKHLPDTKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQF--SSNERY 351

Query: 368 XXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLP 427
                            ++II+FTAISWSITR K+ ++RPI++LGTVP GLK++GV K  
Sbjct: 352 RFYLKKFYFYTNAMRNAVVIIIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQ 411

Query: 428 DGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYP 487
             ++ K+ P+LPAS+IVLLLEHIAIAKSFGRINDYK+VPDQELIAIG++NL+GTFF+AYP
Sbjct: 412 TKIVQKIGPQLPASIIVLLLEHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYP 471

Query: 488 ATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI 547
           ATGSFSRSAL AKC V+TPLSGIFTG CVLLALYCLTGAFFYIPKATLSAVII AVSDLI
Sbjct: 472 ATGSFSRSALNAKCNVKTPLSGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLI 531

Query: 548 ASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLG 607
           ASY+ T +FW MNPLD LCFLVTV ITVFSSIENGIYFA+C+SCA+ + +  FPAGKFLG
Sbjct: 532 ASYQTTLSFWNMNPLDTLCFLVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLG 591

Query: 608 RIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVST 667
           RIE+AEVI+    +                         K        F    K      
Sbjct: 592 RIEIAEVINATPKDDFQMDNFNGFETSEYNNFPADQSYGK--------FDIANKNTHKYN 643

Query: 668 SPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVI 727
           SP  C+    +YTKWVPFDH YT+ELN  V IL PPPGVIVYRL+DSF Y+NCSRH+D I
Sbjct: 644 SP-HCSK--NFYTKWVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTI 700

Query: 728 FDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFL------KNLFHRKKKNST-----D 776
           FDEVKR+T+RG+ + + KK+ RPWNDPGEWEAP ++      +NLF RK++  +     D
Sbjct: 701 FDEVKRKTKRGKFIGNIKKSQRPWNDPGEWEAPTWMTKKFSIRNLFKRKQEAESNVPNED 760

Query: 777 EESAVDVSDNSSI-RDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFH 835
             + +D+S+N  I  D+RP+L+++CLDFSQV+Q D +A+QSL DLRKS+N YADRQVEFH
Sbjct: 761 ASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFH 820

Query: 836 FAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTR--TLPDSDFDLESNFRDTY 893
           F GI+SPWVKRGLI  GFGT+N+ +SDAS I GH SYH+ +  T  +  F   ++  DT 
Sbjct: 821 FCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTS-EDTI 879

Query: 894 SR--------SQYHVFAATGTNLPFFHIDIPDFSKWDL 923
           S         + Y + AA+GTN PFFHIDIP+FSKWD+
Sbjct: 880 SDMNIEAKDYNNYSIEAASGTNYPFFHIDIPNFSKWDV 917

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/812 (60%), Positives = 604/812 (74%), Gaps = 29/812 (3%)

Query: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171
           +PNY+E  V  K  YD  +R  +T   + +Y  S+FP+ +W+ HYN  W  +DL+AGITV
Sbjct: 109 VPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGITV 168

Query: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231
           GCVLVPQSMSYAQIATLPAQYGLYSSF+GAF YS FATSKDVCIGPVAVMSLETAKV+ +
Sbjct: 169 GCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 228

Query: 232 VLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNI 291
           VL K  +++P ITAPI+AT LSL+CG V  GVG+LRLGFLVE ISLNAV GFMTGSA+NI
Sbjct: 229 VLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTGSAINI 288

Query: 292 LWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMG 351
           + GQVPGLMGY+  VNTR + YKVII TLKHLPDTKLDAVFGLIPLF+LY WK++C  +G
Sbjct: 289 MSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFCGTLG 348

Query: 352 PKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISIL 411
           PKLVD++  ++  +R                  +III FT ISW ITR KAK D PIS+L
Sbjct: 349 PKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIII-FTLISWGITRHKAKEDLPISLL 407

Query: 412 GTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELI 471
           GTVP GLK VGVMKLPDGL+S LA ELP+++I+L+LEHIAI+K+FGR+N YKVVPDQELI
Sbjct: 408 GTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGRVNGYKVVPDQELI 467

Query: 472 AIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIP 531
           AIGVTNLI TFFNAYPATGSFSRSALKAKC V+TPLSGIFTGACVLL+LYCLT AF++IP
Sbjct: 468 AIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVLLSLYCLTDAFYFIP 527

Query: 532 KATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSC 591
           KA LSA+II AVSDL+ASYK TWNFW MNPLD +CF+VTV IT+FSSIENGIYFAVCWSC
Sbjct: 528 KAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFSSIENGIYFAVCWSC 587

Query: 592 AILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKT 651
           A+LLLKV FP G+FLG +E+ +V +  VD                       D++     
Sbjct: 588 ALLLLKVVFPTGQFLGYVEICQVSNAEVDE-------------NIDRIVLSEDSQPKTIE 634

Query: 652 SSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRL 711
            +++    A  V V  +    + +++Y+TKW+P ++ Y RELNP V +  PPPGVIVYR 
Sbjct: 635 DNVTKNNTAVKVGVVANESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQAPPPGVIVYRP 694

Query: 712 TDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKK 771
           ++S+TY+NCSR YD IFD VK  TR G+LL+H  K D+ WNDPGEWE P  +K LF  K 
Sbjct: 695 SESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPFLVKKLF--KL 752

Query: 772 KNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQ 831
            N  D E          + D RP+LKI+ +D+SQV QID++ +Q+LVDLRK+IN+YA+RQ
Sbjct: 753 GNKHDLEGG-------EVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQ 805

Query: 832 VEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRD 891
           VEFHF+GI+SPW+KR LIN GFGT+N+EFSD SII GH+SY L +  PD   D E+   +
Sbjct: 806 VEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQ-DPEAALPE 864

Query: 892 TYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
             +     +  A G NLPFFH+++P+F KW L
Sbjct: 865 PIA-----LHTALGVNLPFFHLEMPEFHKWHL 891

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/909 (56%), Positives = 640/909 (70%), Gaps = 35/909 (3%)

Query: 26  PNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPELETQQN 85
           P + S +  S     NLDDLE EYDQYK +E                      +    + 
Sbjct: 22  PRFESEVELS--EVSNLDDLEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVDY---KE 76

Query: 86  LDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLS 145
            ++++ N+TN   N     +TV     P+Y+E  V   D + H +++ +TL  V+ YF S
Sbjct: 77  TELEYWNSTNGTTNLLAPKATV-----PSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFES 131

Query: 146 IFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYS 205
            FPI +WLP YN  W  +DL+AGITVGCVLVPQSMSYAQIATLP QYGLYSSF+GAF YS
Sbjct: 132 AFPIIKWLPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYS 191

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
            FATSKDVCIGPVAVMSLETAKV+ + L K+P  D  +T P++ATAL+LLCGIV  G GV
Sbjct: 192 FFATSKDVCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGV 251

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325
           LRLGFLVELISLNAV GFMTGS+LNI+ GQVP LMG+   V+TR + YK+II +LK+L  
Sbjct: 252 LRLGFLVELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKH 311

Query: 326 TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXI 385
           T+LDAVFGLIPL LLY WKWWC + GPKL D+ F  N  +R                  +
Sbjct: 312 TQLDAVFGLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKR--DILKTFYFYAQAMRSAV 369

Query: 386 IIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVL 445
           IIIVFTAIS+ IT+G+ K  R IS+LG VPKGLK+V VM++P+GLLSK+   +P+++I+L
Sbjct: 370 IIIVFTAISYGITKGR-KTPR-ISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIIL 427

Query: 446 LLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRT 505
           LLEHI+IAKSFGR+N+YKVVPDQELIAIG TNLIGTFFNAYPATGSFSRSALKAKC VRT
Sbjct: 428 LLEHISIAKSFGRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRT 487

Query: 506 PLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCL 565
           PLSG+F+GACVLLALYCLT  F+YIP ATLSAVII AVSDL ASYK +WNF+KMNP D +
Sbjct: 488 PLSGVFSGACVLLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFI 547

Query: 566 CFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXX 625
            F+VTVFITVFSSI+ GIYFA+CWS A+ LLK  F  G+FLGR+EVAEV++  VD     
Sbjct: 548 AFIVTVFITVFSSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVES 607

Query: 626 XXXXXXXXXXXXXXXXXXDT---------KKIQKTSSISFGKDAKAVAVSTSPVDCNPKV 676
                             ++         K    ++ ++ G D     ++        K+
Sbjct: 608 VSESAGSHLDGFQAQSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINN---QIGQKL 664

Query: 677 RYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTR 736
            Y+TKW+ +D +Y+RE NP V I PPPPGVIVYR  DS+TY+NCSRHYD+I+DEV+R TR
Sbjct: 665 VYHTKWISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTR 724

Query: 737 RGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKK--KNSTDEESAVDVSDNSSIRDNRP 794
           RGQ++   KK DRPWNDPGEWEAP++ K L  +KK  +   + E+    +    ++DNRP
Sbjct: 725 RGQMISAVKKVDRPWNDPGEWEAPRWFKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRP 784

Query: 795 LLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFG 854
           LLKI+CLDFSQ +Q DA+AIQ+L DLRK +NRYADRQVEFH  G+ +PWVKR L+N GFG
Sbjct: 785 LLKIICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFG 844

Query: 855 TINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHID 914
           T+N+E+SD S++AGH SYH+ R  P S   LE       S +QY V+ A+GTNLPFFH++
Sbjct: 845 TVNEEYSDESLLAGHRSYHVARA-PTS---LEDGLG---SPAQYSVYPASGTNLPFFHVE 897

Query: 915 IPDFSKWDL 923
           IPDFSKWDL
Sbjct: 898 IPDFSKWDL 906

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/947 (53%), Positives = 641/947 (67%), Gaps = 73/947 (7%)

Query: 1   MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXX 60
           MS    +P + RES  ++S +             S ++  +LDDL+ EY Q+K +E    
Sbjct: 1   MSNFQSSPGSKRESSFEVSREL------------SNDAPIDLDDLDAEYGQFKNAEHSDA 48

Query: 61  XXXXXXXXXXXXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPN----YD 116
                             +   +   +    + + +   + + V+   P  +P+    + 
Sbjct: 49  TAGRDLTSEYGA------QFAAEFGGEPGSGSGSGSGFPEAKPVAPAAPGNVPSALYEFH 102

Query: 117 EKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLV 176
           E+ V++ ++Y  ++R   TL    +Y  S+ PI RWLPHYN  W   DL+AGITVGCVLV
Sbjct: 103 ERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLV 162

Query: 177 PQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKY 236
           PQSMSYAQIATL  QYGLYSSF+GAF YS FATSKDVCIGPVAVMSL+TAK ++ V++  
Sbjct: 163 PQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSL 222

Query: 237 PDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQV 296
           P+ D  IT+P++ATAL+LLCGI++ G+GVLRLGFLVELIS  AV GFMTGSALNI+ GQV
Sbjct: 223 PE-DTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIAGQV 281

Query: 297 PGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVD 356
           P LMGYN  VNTRT+ YKVII +L+HLPDTKLDAVFGL+PL +LY+WKW C   GP+LV 
Sbjct: 282 PALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQ 341

Query: 357 KWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRG--KAKADRPISILGTV 414
           ++       R                  ++I+VFTAI+W ++    K      IS+LGTV
Sbjct: 342 RY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTV 396

Query: 415 PKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIG 474
           P GLK+VGVMK+P GLLSK+APELPASVIVL+LEHIAI+K+FGR+NDY+VVPDQELIAIG
Sbjct: 397 PSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIG 456

Query: 475 VTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKAT 534
            TNLIGTFFNAYPATGSFSRSALKAKC V TPLSG+F+GACVLLA+YCLT AF +IPKAT
Sbjct: 457 ATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKAT 516

Query: 535 LSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAIL 594
           LSAVII AVSDLIASYK TW+FW+++P D +CFLVTV ITVFSSIENGIYFA+CWS A+L
Sbjct: 517 LSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVL 576

Query: 595 LLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTS-- 652
           L +  FPAGKFLGR+++AE     V N                        ++   T+  
Sbjct: 577 LFRTAFPAGKFLGRVQIAE---ARVTNSGAGAGVGMSSGNSAGTAVNREKERETTFTAVS 633

Query: 653 ----SISFGKDAKAVAVSTSPVDCNPKV-------------RYYTKWVPFDHAYTRELNP 695
               S+S     KA A +++  D   KV             R++TKWVPFD  YTRELNP
Sbjct: 634 VSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNP 692

Query: 696 SVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPG 755
            V + PPPPGVIV+R ++S+TY+NCSR YD IFDEV R TRRG+     K + RPWNDPG
Sbjct: 693 EVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPG 752

Query: 756 EWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQ 815
           EW  P+FL+ LF         + S+ D+ + +  RD RP+L+++ +D+SQVAQ+D++ +Q
Sbjct: 753 EWHPPKFLRKLF---------KSSSEDLENRAVARDERPVLRVIAMDWSQVAQVDSTGLQ 803

Query: 816 SLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLT 875
           +L DLRK++N+YADRQVEFHFAGI+ PWVKRGLIN GFGT+NDEF+D S++ GH S H+ 
Sbjct: 804 TLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIA 863

Query: 876 RTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWD 922
           R+   ++ D ES               ATGTNLPFFH+++PDFS+WD
Sbjct: 864 RSAEPTE-DEESRL----------AHPATGTNLPFFHLELPDFSEWD 899

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/834 (59%), Positives = 612/834 (73%), Gaps = 26/834 (3%)

Query: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171
           IP Y+EK V+IKD+Y   I +  ++  +  Y  S+FP+ +WLPHYNL W   DLIAGITV
Sbjct: 64  IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITV 123

Query: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231
           GCVLVPQSMSYAQIATL  QYGLYSSFIGAF YS FATSKDVCIGPVAVMSL+TAKV+ +
Sbjct: 124 GCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIER 183

Query: 232 VLAKYPDNDPTI-TAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALN 290
           V +    ++ TI TAPI+ATAL+LLCGI++ G+G LRLGFL+E ISLNAV GFMTGSA N
Sbjct: 184 VTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFN 243

Query: 291 ILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNM 350
           I+ GQVP LMGYN KVNTR + Y+V+I TLKHLPDTKLDAVFGLIPL +LYL KW+  ++
Sbjct: 244 IICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSL 303

Query: 351 GPKLVDKWF-PKNKNERXXXXXXXXXXX---XXXXXXXIIIIVFTAISWSITRGKAKADR 406
           GP+ ++K    +N  ER                     ++IIVFTAISW+ITRGK+    
Sbjct: 304 GPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSV 363

Query: 407 PISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVP 466
           PISILGTVPKGLKEV V K+P GL  KLAP+LP+S+I+LLLEHIAI+KSFGR+NDYK+VP
Sbjct: 364 PISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVP 423

Query: 467 DQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGA 526
           DQELIAIGVTNLIGTFF AYPATGSFSRSALKAKC V+TPLSG+F+GACVLLALYCLTGA
Sbjct: 424 DQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGA 483

Query: 527 FFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFA 586
           F+YIPKATLSAVII AVSDL+ASYK T NF+KMNPLD +CF+ TVFITVFSSIE GIYFA
Sbjct: 484 FYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFA 543

Query: 587 VCWSCAILLLKVCFPAGKFLGRIEVAEVI------DGYVDNXXXXXXXXXXXXXXXXXXX 640
           +C+SCA L+ K  FP G FLG I++AEV+      + Y                      
Sbjct: 544 ICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVK 603

Query: 641 XXXDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNIL 700
              D  +  K+S   +  + K+  +S++    N  + YY +WVP  + Y RE+NP + I 
Sbjct: 604 NRLDQNENPKSSEKEYS-EFKSYEMSSNSKTTN--LSYYVRWVPMKNDYHREVNPLIKIT 660

Query: 701 PPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAP 760
           PPPPG+IVYR  DSFTY+NCSRHYD+I+DEVK+ TR+G    +++K DRPWND GEWE P
Sbjct: 661 PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP 720

Query: 761 QFLKNLFHRKKKNS-------TDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASA 813
           + LKNLF++ KK +        D   A++ +  ++  DN+P LKI+C DFSQV Q DA+A
Sbjct: 721 KSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780

Query: 814 IQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYH 873
           IQSL DLRK++NRY+++Q+E+HF+GI+S WVK+ LI  GFGT+ND +SD SII GH SYH
Sbjct: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840

Query: 874 LTRTLPDSDFDLESNFRDTYSRSQ----YHVFAATGTNLPFFHIDIPDFSKWDL 923
           +++     D  LE+   + Y +      YH+   TGTN PFFHIDIPDFS W+L
Sbjct: 841 VSKINNQED-GLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/894 (54%), Positives = 614/894 (68%), Gaps = 48/894 (5%)

Query: 37  NSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXXXXXXXXXPELETQQNLDVQFSNTTNN 96
            ++ +LDDL+ EY  +K +E                      +L   QN D         
Sbjct: 7   QTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGD--------K 58

Query: 97  KENQYRIVSTVNPVIIPN----YDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRW 152
                       P+ + +    Y E  V+ ++YYD +IR ++T   VR Y   + P+  W
Sbjct: 59  SGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINW 118

Query: 153 LPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKD 212
           LPHYN  WF  D++AGITVGCVLVPQSMSYA IATLP Q+GLYSSF+GA  YS FATSKD
Sbjct: 119 LPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKD 178

Query: 213 VCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLV 272
           VCIGPVAVMSL+TAK V+KV+A+ P  D  ITAP+VATAL+ LCG+++ G+GVLRLGFLV
Sbjct: 179 VCIGPVAVMSLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISLGLGVLRLGFLV 237

Query: 273 ELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVF 332
           ELIS  AV GFMTGSALNI+ GQ+P LMGYN  VNTRT+ YKVIIETLKHLPDTKLDAVF
Sbjct: 238 ELISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVF 297

Query: 333 GLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTA 392
           GLIPL +LY WKW C++ GP+LV+++    +  R                  +IIIVFTA
Sbjct: 298 GLIPLVMLYTWKWLCNSGGPRLVERY--TVRGSRKQRIWSATLFYTQALRNAVIIIVFTA 355

Query: 393 ISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAI 452
           I+WSI+  K KA  PIS+LG VP GLK+VGVMKLPDGL +K+APELPASVIVLLLEHIAI
Sbjct: 356 IAWSISHHKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAI 413

Query: 453 AKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFT 512
           AK+FGR+NDY+VVPDQELIAIG TNL+GTFFNAYPATGSFSRSALKAKC V TPLSG+F+
Sbjct: 414 AKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFS 473

Query: 513 GACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVF 572
           GACVLLA+YCLT AF YIPKATLSAVII AVSDLIASYK TW+ W++NPLD +CFL TVF
Sbjct: 474 GACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVF 533

Query: 573 ITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNXXXXXXXXXXX 632
           I VFSSIENGIYFA+CWS A+LL KV FP  +FLGR+E+AE+      +           
Sbjct: 534 IAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKD 593

Query: 633 XXXXXXXXXXXDTKKIQKTSSISFGKDAKAVAVSTSPV---DCNPKVRYYTKWVPFDHAY 689
                       +      SS SF    + +   +  V          ++TKWVPF+  Y
Sbjct: 594 FEKGKGVSYASGS-----VSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PY 647

Query: 690 TRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADR 749
           TRELNP V +  PPPGVIV+R ++S+TY+NC+R Y+ IFDEV R TRRG+ ++   K+ R
Sbjct: 648 TRELNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGR 706

Query: 750 PWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQI 809
           PWNDPGEW  P+FL+  F +K   S ++           + D+RP+L+++ +D+SQVAQ+
Sbjct: 707 PWNDPGEWHPPKFLRKWFGKKYSESLEQ---------GVVSDDRPVLRVIAMDWSQVAQV 757

Query: 810 DASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGH 869
           D++ +Q+L DLRK++++YADRQVEFHF+GI+SPW+KRGL+N GFGT+N+E +D S++ GH
Sbjct: 758 DSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGH 817

Query: 870 SSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923
            +Y + R    +  D E+               ATG N+PFFH ++PDFSKWD 
Sbjct: 818 KTYQVARG--GATGDEEALLPQ----------PATGVNMPFFHAEMPDFSKWDF 859

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/913 (52%), Positives = 606/913 (66%), Gaps = 80/913 (8%)

Query: 12  RESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETXXXXXXXXXXXXXX 71
           R S +D    Q+   N   N         +++ L+ EYDQ K  E               
Sbjct: 9   RSSSDDTGAPQWPSRNSVLN--------DDIEALQAEYDQLKAGEVHSA----------- 49

Query: 72  XXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIR 131
                  +  T  ++  +  + +     QY  ++  +   +P Y+E  VS+KDYY++ +R
Sbjct: 50  -------QGATHGDIGSRQYSGSGKPAAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLR 102

Query: 132 ENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQ 191
             ++L   RDY LS+FP+ RW+ HYN+ W  +D++AGITVGCVLVPQSMSYAQ+A+L  Q
Sbjct: 103 GFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQ 162

Query: 192 YGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATA 251
           YGLYSSF+GAF YS FATSKDVCIGPVAVMSLETAKV+ +V    P+ D  IT PI+ATA
Sbjct: 163 YGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATA 221

Query: 252 LSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTA 311
           L+LLCG +   +G+LRLGFLVE IS+ AVTGFMTGSAL+I+ GQVP LMGY+ KVNTR  
Sbjct: 222 LTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRAT 281

Query: 312 NYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKW--FPKNKNERXXX 369
            YKVIIE+LKHL DT ++A FGL+PL LL+LWKW C ++GP+LVD++  F  ++  R   
Sbjct: 282 TYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNA 341

Query: 370 XXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDG 429
                          +II+VFTAISW I+R K +   PIS+LG VP GLK VG ++LP+G
Sbjct: 342 AFFYLQALRNA----VIIVVFTAISWGISRHKLEKP-PISLLGKVPSGLKNVGPLELPEG 396

Query: 430 LLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPAT 489
           L+ KL PELPA+ I+LLLEHIAIAKSFGRIN+YKVVPDQELIAIGVTNL  TFFNAYPAT
Sbjct: 397 LVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPAT 456

Query: 490 GSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIAS 549
           GSFSRSALKAKC V+TPLSG+FTGACVLLALYCLT AF++IPKATLSAVII AV+DLIAS
Sbjct: 457 GSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIAS 516

Query: 550 YKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRI 609
           YK+TW FW+ NPLD   F+VTV ITVFSSIE+GIYF++ WSCA+LL KV FP GKFLG I
Sbjct: 517 YKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAVLLCKVAFPDGKFLGYI 576

Query: 610 EVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSI-SFGKDAKAVAVSTS 668
           +VAEVI+                           D   I  +++     KD   +    S
Sbjct: 577 DVAEVIE----------------PAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVES 620

Query: 669 PVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIF 728
            V  +P  R++ +W+P DHAY+RELNP   + PPPPGVIVYR TDS+TY+NCSRH+D+I 
Sbjct: 621 -VLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIIL 679

Query: 729 DEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSS 788
           D VK  TR GQL+ H    +R W DPG W  P+  +     K+               S+
Sbjct: 680 DHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRFIADKRT-------------GSA 726

Query: 789 IRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGL 848
           + D RP+L+++ +D+SQV+Q+D++ IQ+LVDLR ++N+YADR VEFHFAGIVSPW+KR L
Sbjct: 727 VADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRAL 786

Query: 849 INRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNL 908
           +N GFG      +D  +I+   SYHL R   D    +            + V  A GTN 
Sbjct: 787 VNTGFG-----IADPPLISSRVSYHLVRLPADPPHIVHG----------HSVVFALGTNT 831

Query: 909 PFFHIDIPDFSKW 921
           PFFH+D+PDF  W
Sbjct: 832 PFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/923 (48%), Positives = 604/923 (65%), Gaps = 58/923 (6%)

Query: 9   FNTRESENDLSNDQYEIPNYTSNIPSSGNS------TQNLDDLELEYDQYKVSETXXXXX 62
           F  RE+ + + +    I + T N+ +  N+      T  LD+LE +Y ++K +E      
Sbjct: 2   FILRENSDGIESQASTISD-TQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYS 60

Query: 63  XXXXXXXXXXXXXXXPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSI 122
                                    +QF+    N    ++          P Y E TV+ 
Sbjct: 61  GAENERSRIDKFDSVGS-------SLQFAKYDGNALPDFKA---------PPYYETTVTF 104

Query: 123 KDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSY 182
            +YYD +IR  V     R YFLS+FPI +W+ HYN  W  SD IAGITVGCVLVPQSMSY
Sbjct: 105 MEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSY 164

Query: 183 AQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPT 242
           AQ+A L  +YGLYSSFIGAF YS FATSKDVCIGPVAVMS++ +KV++ V+ + P+  P 
Sbjct: 165 AQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTP- 223

Query: 243 ITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGY 302
           ITAP+VA+AL+L   I+   +G+LRLGF++ELIS+ AV GFMTGSAL+IL  Q+P L+G 
Sbjct: 224 ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGI 283

Query: 303 NSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWF-PK 361
             K+NTR   Y+V+I TLKHL  + ++A FGLI L LL+ WKW C  +GPKL+ K+  P 
Sbjct: 284 Q-KINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPN 342

Query: 362 NKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEV 421
           +K  R                   ++ + T +SW +  G+ K    IS+LGTVP GLK V
Sbjct: 343 SKKARIWQSFFFYAQALRNA---FVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLKHV 398

Query: 422 GVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGT 481
           GV  +P GL+ KL P+LP +VI+LLLEHI IAKSFGRIN+YK+VPDQELIAIGVTNLIG+
Sbjct: 399 GVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGS 458

Query: 482 FFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQ 541
           FFNAYPATGSFSRSALKAKC V+TPLSG+F+GACVLLALY LT AF+YIPKA LSAVII 
Sbjct: 459 FFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIH 518

Query: 542 AVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFP 601
           AV DLIASYK+++  W  NP D + FL T+ +T+FSSIENGIYFAV +S A LL+K  FP
Sbjct: 519 AVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFP 578

Query: 602 AGKFLGRIEVAEVIDGYVDNXXXXXXXXXXXXXXXXXXXXXXDTKKIQKTSSISFGKDAK 661
           +GKFLG +++ EV +  V                          ++I K S ++   D  
Sbjct: 579 SGKFLGYVKITEVSNLNVFEDLDSIGNNDPEL-----------PQEISKDSKLAKDPDVH 627

Query: 662 AVA-VSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINC 720
           A A +  S +D    VR++TKWVP D+ Y+RELNP + +  PPPGVIVYR T+S+ Y+NC
Sbjct: 628 ASANLMASKLD----VRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNC 683

Query: 721 SRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESA 780
           SR +D+I D VK  TR G+L+ H +K+++ W +PG+W  P FL+  F + +  +   E  
Sbjct: 684 SRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVV 743

Query: 781 VDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIV 840
             V       DNRP+LKI+ +D++QV  +D+++IQSL+DLRK+INRYADRQV FHF+GIV
Sbjct: 744 EQV-------DNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIV 796

Query: 841 SPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHV 900
           SPW+KR L++ GFGTIN+ +S+  ++  +S+YH+ + +  +D   E N +++   +   V
Sbjct: 797 SPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSAD---EENQQNSEISASLDV 853

Query: 901 FAATGTNLPFFHIDIPDFSKWDL 923
             A+GTN PFFHID+PDF+KWD+
Sbjct: 854 --ASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  537 bits (1384), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 270/505 (53%), Positives = 356/505 (70%), Gaps = 27/505 (5%)

Query: 115 YDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCV 174
           Y EK V++ + ++H +    T   ++ Y LS+ PIT+W+ HYNL WF SD+IAGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 175 LVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLA 234
           LVPQSMSYAQIATL  QYGLYSS +G F Y++FATSKD+CIGPVA+MSL+TAK +  V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 235 KYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWG 294
           K+PD    I A I+A+ ++++CG +T G+GVLRLGF ++LI + AV GF +GSA NILWG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 295 QVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKL 354
           Q+PGLMGY+  VNTR   YKV+++TLK LP T ++AV GLIPLF L++WK+ CD    + 
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDYALRRG 238

Query: 355 VDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRP-ISILGT 413
             K +PK                       I+II+ +A ++        A  P + +LG 
Sbjct: 239 NLKPWPKR-----------IVFYLLSLRVTIVIIICSAAAYG-------AKNPSLKVLGK 280

Query: 414 VPKGLKEVGVMKL---PDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQEL 470
           +PKG       +L   P  L+S +  E+PASVIVL+LEH++IAKSF R+N+Y+V  DQEL
Sbjct: 281 IPKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQEL 340

Query: 471 IAIGVTNLIGTF-FNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFY 529
            AIGV+N++G     AYP TGSFSR+ALKA+C+VRTPL  IF+G CV++A+  LT A  +
Sbjct: 341 TAIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAW 400

Query: 530 IPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCW 589
           IPKATLSAVII AVS LI+SYK+T   +KM PLDCL FLVT+FITVFS IE G+YFAVCW
Sbjct: 401 IPKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCW 460

Query: 590 SCAILLLKVCFPAGKFLGRIEVAEV 614
           +C +L++++ FP G FLG + V E+
Sbjct: 461 ACFLLMIRIAFPYGAFLGYVRVREI 485

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 136/231 (58%), Gaps = 32/231 (13%)

Query: 682 WVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQL- 740
           W+P+ H +TRELNP V I PPPPGV+VYR +DS TYINCSR+YD I D +K  T+ G++ 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 741 LRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVC 800
           +       +PWN+PG WE P+               E +  +++    + D RP L+I+C
Sbjct: 748 VLSDALYVKPWNNPGPWEKPKL-----------KFWEHADPEIARKKRMADKRPTLRILC 796

Query: 801 LDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEF 860
           LDFSQVAQID++A+Q+L+DLR  +N Y    VE+HF GI+SPWV+R LI  GFG IN EF
Sbjct: 797 LDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEF 856

Query: 861 SDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFF 911
                             P  +   +S+  +  S  +Y+   A G N+PFF
Sbjct: 857 -----------------FPKVN---DSSTVEVISDLEYNGELALGENVPFF 887

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 118/480 (24%), Positives = 198/480 (41%), Gaps = 55/480 (11%)

Query: 131 RENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLP 189
           R  +T   + DY    FP   W+P+Y LT F  DL AG++V    +P ++SYA  +A + 
Sbjct: 44  RSILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVE 103

Query: 190 AQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVA 249
              GLYS  I  F Y++F +   + +GP + +SL    VV + +    ++D  I+   ++
Sbjct: 104 PLSGLYSLAITPFIYAIFGSVPQMIVGPESAISL----VVGQAVEPMVNHDERISTISIS 159

Query: 250 TALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTR 309
             ++ + G     +G+ RLGFL  ++S   + GF+      ++   +   +  +  + T 
Sbjct: 160 IVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATS 219

Query: 310 TANYKVIIETL----------KHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWF 359
             +Y    E +           H P     A+  L    +L L K     +  +   KW 
Sbjct: 220 PEHYHTPFEKILFLIKYGQHNYHAP----TAILSLYSFIILMLMKVMKKRLMKRF--KW- 272

Query: 360 PKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLK 419
                                    I+I++   I +S      K    ISI+G      K
Sbjct: 273 -------------------VIFVPEILIVIVGTIMFSF-HFDIKHKFDISIIGD----FK 308

Query: 420 EVGVMKLPDGLLSK----LAPELPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIA 472
             G   L + L       L P L A ++  +L   E    +K+ G   D  V  ++EL+A
Sbjct: 309 VNGFDSLHNPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVA 368

Query: 473 IGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPK 532
           +G  N++G+ F A PA G + RS + A    +T +SG+  G+  L  +          P 
Sbjct: 369 LGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPT 428

Query: 533 ATLSAVIIQAVSDLI--ASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWS 590
             LS V       L+  A   + + F      + +   +T   T+F S+E GI    C+S
Sbjct: 429 CVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYS 488

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  119 bits (297), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 123/496 (24%), Positives = 209/496 (42%), Gaps = 71/496 (14%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP+YN++    DLIAG+++    +P ++S+A  +A +    GLYS     F Y+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +  +   + +GP + +SL   + V K+++  PD    +    ++  ++ + G      G+
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISHNPD----LHTLQLSAVITFISGGFLFFFGL 205

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETL----- 320
            RLGFL  ++S   + GF++   L ++   +      +  +     +Y    E +     
Sbjct: 206 CRLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVT 265

Query: 321 -----KHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXX 375
                 H P T L     L   F+L + K     + P+   +W                 
Sbjct: 266 YAPNNYHGPTTALS----LSCFFILIMTKIIKKKLMPRC--RWI---------------- 303

Query: 376 XXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTV-PKGLKEVGVMKLPDGLLSKL 434
                    I++++   I  SI + + K +  IS +G    KGL         D LL+ L
Sbjct: 304 ----VFVPDILLLIIGTIFLSI-KYRFKHNYSISTVGDFNTKGL---------DKLLNPL 349

Query: 435 APE--------LPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFF 483
           + E        L A  I  +L   E    +KS G   D  +  ++EL+A+G  NL  +  
Sbjct: 350 SAENRGLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSIL 409

Query: 484 NAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAV 543
            + PA G + RS + A    +T +SG F G  VLL +  L     YIP   LS V     
Sbjct: 410 GSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVG 469

Query: 544 SDLI--ASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFP 601
             L+  A   + ++F      + L F +TV  T+F S+E GI    C  C   ++ +   
Sbjct: 470 ISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGI----CIGCGYSVISIIKH 525

Query: 602 AGKFLGRIEVAEVIDG 617
           + K   RI++   + G
Sbjct: 526 SAK--SRIQILARVQG 539

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 112/452 (24%), Positives = 189/452 (41%), Gaps = 31/452 (6%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP+Y  T    DL+AGIT+    +P ++SYA  IA +    GLY+  +  F Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F ++  + +GP   +SL   + V       PD DP     ++  A++L+ G +    G+
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI----LIVIAVTLISGTILLISGI 225

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325
            RLG+L  +++   + GF+         G V  +M  +S +N       ++ +T +H   
Sbjct: 226 FRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLINELKLG-DILADTPEHYNT 275

Query: 326 TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXI 385
             L  VF         LWK+   N         F                         I
Sbjct: 276 PFLKIVF---------LWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIFI 326

Query: 386 --IIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPD---GLLSKLAPELPA 440
             I+IV T +     +        I ILG        +    L +   GL+  +      
Sbjct: 327 PEILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHNPLSNKNRGLIHVVFNIGII 386

Query: 441 SVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAK 500
           + I    E    +K+ G  ++  V  ++EL+A+G++N++ +   A P+ G + RS + A 
Sbjct: 387 TAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYGRSKINAL 446

Query: 501 CKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNF-WKM 559
              +T LSG+F G   +LA+  L     YIP   LS +       L+       +F W+ 
Sbjct: 447 SGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKEVSFHWRC 506

Query: 560 NPLDCLCFLVTVFIT-VFSSIENGIYFAVCWS 590
              + L  +V  F+T +F S+E  +Y    +S
Sbjct: 507 RGYNELFLIVLTFMTSIFYSVETSMYIGCVYS 538

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 117/481 (24%), Positives = 205/481 (42%), Gaps = 49/481 (10%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   W+P+YN   F  D IAG+++    +P  +S+A  +A +    GLYS  +  F Y+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           LF +   + +GP + +SL    VV + +     +D ++    +AT +S + G+     G+
Sbjct: 132 LFGSVPHMIVGPESAISL----VVGQAVETLTSHDLSLETVDIATMISFMSGLTLLFGGI 187

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETL----- 320
            RLGFL  ++S   + GF++     ++   +   +  N  + T   +Y    E +     
Sbjct: 188 FRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVR 247

Query: 321 -----KHLPDTKLD-AVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXX 374
                 HLP + L  AVF       L   + +   M  ++  KW                
Sbjct: 248 YGPSNYHLPTSFLSLAVFT-----TLMTIRIFKKKMMRRI--KWI--------------- 285

Query: 375 XXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTV-PKGLKEVG--VMKLPDGLL 431
                     + +++F+ +   +   K K D  IS++G     G  +    + K   GL+
Sbjct: 286 ----VFIPEILSVVIFSIVLSYMCDLKKKYD--ISVIGDFNTDGFDDFRNPLSKCNRGLI 339

Query: 432 SKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGS 491
             L      S ++  LE I  +KS G   +     ++EL+A+G+ N IG+ F   PA G 
Sbjct: 340 PALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGG 399

Query: 492 FSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI--AS 549
           + RS + A    +T ++G+F G+  L  +  L     YIP   LS +       L+  A 
Sbjct: 400 YGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAP 459

Query: 550 YKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRI 609
           + I ++       + + F++T   T F SIE GI     +S   ++        + L R+
Sbjct: 460 HDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILARV 519

Query: 610 E 610
           E
Sbjct: 520 E 520

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 137/545 (25%), Positives = 232/545 (42%), Gaps = 61/545 (11%)

Query: 94  TNNKENQYRIVSTVNPVIIPNYDEK-----TVSIKDYYDHSIRENVTLVGVRDYFLSIFP 148
           + NK +   I S  +P  + ++D       T  I+  YD    E +T   +  Y+L   P
Sbjct: 60  SKNKISNKYIDSVFDPNTMDDHDMNQNITITHRIRKTYDDGENE-LTFYQLIQYYL---P 115

Query: 149 ITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYSLF 207
             RWLP YN + F SD I+GI++    +P ++SYA  IA +    GLYS  I    Y + 
Sbjct: 116 CLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYGIL 175

Query: 208 ATSKDVCIGPVAVMSLETAKVVTKVLAKY---PDNDPTITAPIVATALSLLCGIVTAGVG 264
            +   + +GP   +SL   + V K+   Y      D  I+   ++  ++ L G+V    G
Sbjct: 176 GSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFICG 235

Query: 265 VLRLGFLVELIS-------LNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVII 317
           +LRLGFL  ++S       +++V G M   AL I   ++  ++  N + +  TA ++ I+
Sbjct: 236 LLRLGFLGSVLSKPLLRSFISSVGGVMVIDAL-ITEMKLNCILIDNDR-HYHTA-FEKIM 292

Query: 318 ETLKHLPDT--KLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXX 375
             +K+ P+   K   V  ++   +LY  + +C         K+  K+K+           
Sbjct: 293 FIIKYAPNNFHKPTTVLSVVCFSILYFVR-YCK-------KKYIIKHKS----------- 333

Query: 376 XXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLA 435
                    I+I+V +    S +    K +  ISI+G V      +    L + L S   
Sbjct: 334 ---LIFLPEILIVVISTGILSASY-NFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNK 389

Query: 436 PELP-------ASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 488
              P       A   +   E    +KS G   +  +  ++EL+A+GV NL  +     P+
Sbjct: 390 ELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPS 449

Query: 489 TGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVI----IQAVS 544
            G + RS + A    +T +SG+  G   +L +  L     +IP   LS +     +  + 
Sbjct: 450 FGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIE 509

Query: 545 DLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGK 604
           +     K  W     N L  + F +T   T+F S+E GI     +S   ++        +
Sbjct: 510 EAPGEVKFHWRCKGYNEL--IIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQ 567

Query: 605 FLGRI 609
            LGRI
Sbjct: 568 ILGRI 572

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 121/465 (26%), Positives = 197/465 (42%), Gaps = 57/465 (12%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP Y L  F  D+IAGIT+    +P ++SYA  +A +    GLYS  I  F Y 
Sbjct: 81  LPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYC 140

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F +   + +GP + +SL   + V K L  + +   TI   +V T LS   G +    G+
Sbjct: 141 VFGSVPQMIVGPESAISLVVGQAVEK-LVTHNEKVGTINISVVVTFLS---GAILLIFGI 196

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHL-- 323
            RLGFL  ++S   + GF++   L ++   +   +     + T   +Y    E ++ L  
Sbjct: 197 TRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQFLFK 256

Query: 324 --PDT--KLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKW-----FPKNKNERXXXXXXXX 374
             P+   K  A+  L    +L   ++    +  KL+ ++     FP+             
Sbjct: 257 YGPENLHKPTAILSLCSFIILMTLRF----LKKKLMKRYKSVIFFPE------------- 299

Query: 375 XXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLS-- 432
                     I++IV +++  S+     K D  IS+LG         G  KL + L    
Sbjct: 300 ----------ILLIVISSLIISVNF-NLKKDFDISMLG----DFSTSGFDKLNNPLGKDN 344

Query: 433 -KLAPELPA----SVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYP 487
             L  EL +      I+   E    +KS G I D  +  ++EL+A+G  NL+G+ F A P
Sbjct: 345 RSLCHELLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALP 404

Query: 488 ATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI 547
           + G + RS + A    +T +SG   G   L  +  L     Y P   LS +       L+
Sbjct: 405 SFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLL 464

Query: 548 --ASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWS 590
             A   I ++       + + F +    T+  S+E GI     +S
Sbjct: 465 EEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYS 509

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 125/490 (25%), Positives = 207/490 (42%), Gaps = 59/490 (12%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP Y       D+IAGI++    +P ++SY   IA +P   GLYS  I  F Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +  +   + +GP + +SL   + V  +   + DN   I   IV T +S   G +    G+
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESI-TLHKDNVSLIDISIVITFVS---GAILLFSGI 210

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325
            R GFL  ++S   + GF++   L ++   +   +  +  + +   +Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 326 ------TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDK-----WFPKNKNERXXXXXXXX 374
                  K  A+F      +L + +     +  KL+ +     +FP              
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVMRL----LKKKLMKRHKSAVFFPD------------- 313

Query: 375 XXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLP-DGLLSK 433
                     +++IV   IS  ++    K    ISI+G     +     +K P      K
Sbjct: 314 --------ILLVVIVTILISMKLS---LKQRYGISIVGDF--SMDNFDKLKNPLTHSRRK 360

Query: 434 LAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPAT 489
           L P+L  AS+IV +L   E    +KS G   +  V  ++EL+A+G  N+  + F A P+ 
Sbjct: 361 LMPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSF 420

Query: 490 GSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIAS 549
           G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       L+  
Sbjct: 421 GGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEE 480

Query: 550 Y--KITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLG 607
               I ++       +   F VT  +T+F SIE+GI    C  C   +L +   + K   
Sbjct: 481 VPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGI----CIGCVYSILNIIKHSAK--S 534

Query: 608 RIEVAEVIDG 617
           RI++   I G
Sbjct: 535 RIQILARIAG 544

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 124/506 (24%), Positives = 214/506 (42%), Gaps = 54/506 (10%)

Query: 127 DHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSY-AQI 185
           + S+ +N T+     Y+L   P   WLP Y       D+IAGI++    +P ++SY   I
Sbjct: 78  NDSVYDNNTIFETVPYYL---PCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSI 134

Query: 186 ATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITA 245
           A +P   GLYS  I  F Y +  +   + +GP + +SL   + V  +   + DN   I  
Sbjct: 135 AHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESI-TLHKDNVSLIDI 193

Query: 246 PIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSK 305
            +V T +S   G +    G+ R GFL  ++S   + GF++   L ++   +   +  +  
Sbjct: 194 SVVITFVS---GAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKF 250

Query: 306 VNTRTANYKVIIETLKHLPD------TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDK-W 358
           + +   +Y    E +  L D       K  A+F    L +L+  +     +        +
Sbjct: 251 LLSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIF 310

Query: 359 FPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGL 418
           FP                        +I+ +F ++ +S+     K    I+I+G     +
Sbjct: 311 FPD-------------------ILLVVIVAIFISMKFSL-----KHRYGITIIGDF--SM 344

Query: 419 KEVGVMKLP-DGLLSKLAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAI 473
                +K P      KL P+L  AS+IV +L   E    +KS G   +  V  ++EL+A+
Sbjct: 345 DNFDKLKNPFTHSRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVAL 404

Query: 474 GVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKA 533
           G  N++ + F A P+ G + RS + A    ++ +SG+F G   L+ +  L     YIP  
Sbjct: 405 GFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNC 464

Query: 534 TLSAVIIQAVSDLIASY--KITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSC 591
            LS +       L+      I ++       +   F VT  +T+  SIE GI    C  C
Sbjct: 465 VLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGVTILCSIEAGI----CIGC 520

Query: 592 AILLLKVCFPAGKFLGRIEVAEVIDG 617
              +L +   + K   RI++   + G
Sbjct: 521 VYSILNIIKHSAK--SRIQILARVAG 544

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 130/508 (25%), Positives = 215/508 (42%), Gaps = 63/508 (12%)

Query: 129 SIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIAT 187
           S+ EN T+     Y+L   P   WLP Y       D+IAGI+V    +P ++SY   IA 
Sbjct: 91  SVDEN-TVFETLPYYL---PCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAH 146

Query: 188 LPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPI 247
           +P   GLYS  I  F Y +  +   + +GP + +SL   + V  +   + +N   I    
Sbjct: 147 VPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESI-TLHKENVSLID--- 202

Query: 248 VATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVN 307
           ++T ++ + G +    G+ R GFL  ++S   + GF++   L ++   +   +  +  + 
Sbjct: 203 ISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLV 262

Query: 308 TRTANYKVIIETLKHLPD---------TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKW 358
           +   +Y    E +  L D         T + +   LI LFL  L K          +  +
Sbjct: 263 SLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAI--F 320

Query: 359 FPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGL 418
           FP                        I+++V   I  S+ +   K    ISI+G     +
Sbjct: 321 FPD-----------------------ILLVVIVTILISM-KFNLKHRYGISIIGDF--SM 354

Query: 419 KEVGVMKLP-DGLLSKLAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAI 473
                +K P      KL P+L  AS+IV +L   E    +KS G   +  V  ++EL+A+
Sbjct: 355 DNFDELKNPLTRPRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVAL 414

Query: 474 GVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKA 533
           G  N++ + F A PA G + RS + A    ++ +SG+F G   L+ +  L     YIP  
Sbjct: 415 GFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNC 474

Query: 534 TLSAVI----IQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCW 589
            LS +     I  + ++    K        + L    F VT   T+F SIE GI    C 
Sbjct: 475 VLSVITTIIGISLLEEVPGDIKFHLRCGGFSEL--FVFAVTFCTTIFYSIEAGI----CI 528

Query: 590 SCAILLLKVCFPAGKFLGRIEVAEVIDG 617
            C   ++ +   + K   RI++   + G
Sbjct: 529 GCVYSIINIIKHSAK--SRIQILARVAG 554

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  113 bits (282), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 113/484 (23%), Positives = 198/484 (40%), Gaps = 30/484 (6%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   W+PHY+   F  DL+AGI++    +P ++SYA  IA +    GLYS  I    Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F +   + +GP + +SL    VV +   K+  +D  I+   +   ++ + G+V   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325
           +RLGFL  ++S   + GF++   L ++   +   +  N K+     +Y        H P 
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHY--------HTPV 241

Query: 326 TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXI 385
            K+        +FL      +       L    F    + R                  I
Sbjct: 242 GKI--------MFLFRYASEYYHKPTAILSLICFLVLISTRIAKKKLMNRYRFLIFVPEI 293

Query: 386 IIIVFTAISWSITRGKAKADRPISILGTV-PKGLKEVG--VMKLPDGLLSKLAPELPASV 442
           +++V   I  S+ +   K    IS +G     G   +G  +      L S L  E  A  
Sbjct: 294 LLVVSVTILLSL-KYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSSLWNEGLAVA 352

Query: 443 IVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCK 502
           ++   E    +KS G   +     ++ELIA+G  N++G+ F A P+ G + RS +     
Sbjct: 353 MLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSG 412

Query: 503 VRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASY--KITWNFWKMN 560
            +T +SG   G   LL    L     Y P   LS +       L+      I ++     
Sbjct: 413 GKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSG 472

Query: 561 PLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEV---IDG 617
             +   F +T   T+  S+E G+     +S  +++        + L ++E ++    +D 
Sbjct: 473 YSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLEGSDEFVNVDD 532

Query: 618 YVDN 621
           Y+ N
Sbjct: 533 YIKN 536

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 132/504 (26%), Positives = 226/504 (44%), Gaps = 70/504 (13%)

Query: 147 FPITRWLPHYNLTWF--TSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFC 203
            P   W+P Y  TWF   SD +AGI++    +P ++SYA  IA +    GLYS  I  F 
Sbjct: 89  LPCFSWIPQY--TWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFI 146

Query: 204 YSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGV 263
           Y++F +   + +GP + +SL    VV + +     +D  +    ++  L+ + G     +
Sbjct: 147 YAVFGSVPQMIVGPESAISL----VVGQSVELLKSHDSALEIINISVVLTFISGAALLIL 202

Query: 264 GVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNS-----KVNTRTANYKV--I 316
           G+LRLGFL  ++S + + GF++   L ++   +   +  N      KV+  T+  KV  +
Sbjct: 203 GILRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFL 262

Query: 317 IE---TLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXX 373
           I+   T  H P   L A+   + LF + L K            +W  K++          
Sbjct: 263 IKYAPTNYHKPTALLSAI-AFVTLFSIRLLK-----------KRWMAKHR---------- 300

Query: 374 XXXXXXXXXXXIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLS- 432
                      +II ++ + +W       K    I I+G          + KL + +   
Sbjct: 301 WLAFIPEILMVVIISIYLSATWEF-----KKQYGILIVG----DFNTHAIDKLKNPISKE 351

Query: 433 --KLAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAY 486
             K+ P+L    V++ LL   E +  +KS G   D  +  ++EL+A+G  N+I + F A 
Sbjct: 352 NRKIMPQLLNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGAL 411

Query: 487 PATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVI-IQAVSD 545
           P+ G + RS + A    +T +SG+F G+  L+ +  L     YIP   LS +  I  +S 
Sbjct: 412 PSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISL 471

Query: 546 L-IASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGK 604
           L  A  ++ ++F      +   F +TV  T+  S+E GI    C  C   ++ +   + K
Sbjct: 472 LEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGI----CIGCGYSIISIVKHSAK 527

Query: 605 ----FLGRIEVAEV---IDGYVDN 621
                LGR++       ID Y+D+
Sbjct: 528 SRIQILGRVQGTREFANIDEYLDS 551

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 119/512 (23%), Positives = 213/512 (41%), Gaps = 61/512 (11%)

Query: 119 TVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQ 178
           T S++ Y    + + + L   + Y     PI +W P Y+      DL+AGI++    +P 
Sbjct: 21  TPSLRSYRAIKVDQPLKL-NTKSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPF 79

Query: 179 SMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPD 238
           ++S + +A +    GL+S  I    Y++F +   + +GP  V+SL   +        +  
Sbjct: 80  AISLSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEA--WSHKS 137

Query: 239 NDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQV-P 297
            D  +T  ++A       G +   +G+ R+GF+   IS   + GF+   A+ +L  ++ P
Sbjct: 138 VDSLVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLP 193

Query: 298 GLMG---YNSKV---NTRTANYKVIIETLKHLPD------TKLDAVFGLIPLFLLYLWKW 345
            L     Y  +V   N  T  +      LK+ P+       KL  +   I +   Y+ K+
Sbjct: 194 ELQLEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKKY 253

Query: 346 WCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAIS----WSITRGK 401
           + +  G KL  ++FP                        +++  F  +S    WS T G 
Sbjct: 254 FTEKRGSKLC-RFFPD---------------------LLLVVAGFIYLSYYNDWSSTMGT 291

Query: 402 AKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRIN- 460
                   I+G +P         K+P     +       S +V +L     A +F  I  
Sbjct: 292 -------RIIGNLPPNKNH---FKVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGE 341

Query: 461 --DYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLL 518
             D  +  ++EL+++G+ N++ + F+A PA G + RS L   C  +TP++GI      + 
Sbjct: 342 KFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIF 401

Query: 519 ALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNF-WKMNPL-DCLCFLVTVFITVF 576
            +  + GAF Y+P   L+ +I     +L+        F W +    + L F+  V  T+ 
Sbjct: 402 CMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLV 461

Query: 577 SSIENGIYFAVCWSCAILLLKVCFPAGKFLGR 608
            S + G+   V  +   LL        + LGR
Sbjct: 462 WSPQFGVSIGVGLTMIRLLKHTTQSRVQILGR 493

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 108/450 (24%), Positives = 181/450 (40%), Gaps = 27/450 (6%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP Y+ +    D IAG ++    +P +MSY+  +A +P   GL +     F Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F +   + +GP + +SL    VV + + K   +D ++    +   L+ + G +    G+
Sbjct: 130 VFGSVPHMIVGPESAISL----VVGQAIEKQMKHDKSLDVVNLCLILTFISGAILFCFGI 185

Query: 266 LRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPD 325
           +R G+L  ++S   + GF++   L ++   +   +      N    +Y        H P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPF 237

Query: 326 TKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXI 385
            KL  +F   P            +    L+     K +  R                   
Sbjct: 238 QKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVPE--------- 288

Query: 386 IIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVL 445
           I+IV   ++        K    I I+G +  G        L    LS  +    A  +V 
Sbjct: 289 ILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGDTSKFRNPLSKKNLSLFSELFHAGFMVA 348

Query: 446 LL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCK 502
           LL   E    +KS G   +  V  ++EL+A+G  NL+G+ F A P+ G + RS + A   
Sbjct: 349 LLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSG 408

Query: 503 VRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI--ASYKITWNFWKMN 560
             T +SG+F G    +    L  A  +IP   LS +       L   A   + ++F    
Sbjct: 409 AATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRG 468

Query: 561 PLDCLCFLVTVFITVFSSIENGIYFAVCWS 590
             + L F +TV  T F S+E GI     +S
Sbjct: 469 YNELLIFALTVLTTFFYSVEAGITLGCGYS 498

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 124/499 (24%), Positives = 214/499 (42%), Gaps = 52/499 (10%)

Query: 132 ENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPA 190
           E VTL     Y+L   P   W+P Y++     D IAG+++    +P +MSYA  +A +P 
Sbjct: 62  ERVTLKDTIPYYL---PCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPP 118

Query: 191 QYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVAT 250
             GLYS       Y++  +   + +GP + +SL   + +   L++    DP + A  +  
Sbjct: 119 LCGLYSLVFSPAVYTVLGSVPQMIVGPESAISLILGQAIEARLSE----DPKLKAINICL 174

Query: 251 ALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRT 310
            ++ + G+V    G+LRLGFL  ++S   + GF++G  + ++   +   +  N    TR 
Sbjct: 175 VITFISGLVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQ 234

Query: 311 ANY----KVIIETLKHLPDT--KLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKN 364
            +Y    + ++  +K+ P+   K  A+  L+   +L   + +    G K   KW     +
Sbjct: 235 EHYHSPFEKVLFIMKYGPENYHKPTAILSLVAFVILMSLRIFKKRYGKKF--KWLVLLPD 292

Query: 365 ERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSIT-RGKAKADRPISILGTVPKGLKEVGV 423
                                 I+V  A+S  ++ +   K+   I I+  +PK   +   
Sbjct: 293 ----------------------ILVVVALSIFVSYKMHLKSRYGIEIINDIPKDSMKHLK 330

Query: 424 MKLPDGLLSKLAPELPASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIG 480
               +  ++          +V +L   E    +KS G   +  +  ++ELIA+G  N++G
Sbjct: 331 NPFSNVNVATFKDLFSTGFMVAMLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVG 390

Query: 481 TFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVII 540
           + F   PA G + RS + A    +T +SG F G   L  +  L     YIP   LS +  
Sbjct: 391 SMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVITT 450

Query: 541 QAVSDLIASYKITWNF-WKMNPLDCL-CFLVTVFITVFSSIENGIYFAVCWSCAILLLKV 598
                L+        F W+      L  F VT+  T+F S+E GIY      CA  ++ V
Sbjct: 451 VVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIYIG----CACSIINV 506

Query: 599 CFPAGK----FLGRIEVAE 613
              + K     LGR+   E
Sbjct: 507 IKHSAKSRIQILGRVPGTE 525

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 103/452 (22%), Positives = 185/452 (40%), Gaps = 58/452 (12%)

Query: 178 QSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYP 237
            S+S + +A LP   GLYS  I    Y +  T     +GP  V+SL   +        + 
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCE--WWSHR 58

Query: 238 DNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVP 297
             +P  T  ++      + G +   +GV R+GF+   +S   + GF++  AL +L  ++ 
Sbjct: 59  SLEPLSTVAVIGC----VSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELL 114

Query: 298 GL------------MGYNSKVNTRT-ANYKVIIETLKHLPDT---KLDAVFGLIPLFLLY 341
                          GY   + T T   ++ I+E      DT    L     ++ + + Y
Sbjct: 115 PELKLEELYAHYVAQGY---IGTTTWEKFRFILEKAPENSDTFTWNLSLFTFILLMTIRY 171

Query: 342 LWKWWCDNMGPKLVDKWFPKNKNERXXXXXXXXXXXXXXXXXXIIIIVFTAISWSITRGK 401
           L +   +  G K    +FP+                       I+I+V  +I+ S T+ K
Sbjct: 172 LKRHLAEKCGWKKC-IFFPE-----------------------ILIVVVGSITLSNTQ-K 206

Query: 402 AKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLL---EHIAIAKSFGR 458
               + I I+G +P     +   K+P    S+       S ++ +L   E   + KS   
Sbjct: 207 WSELKGIKIIGDIPPNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCS 263

Query: 459 INDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLL 518
            ++     ++EL+++GV NL+ + F+A PA G + RS +   C  +T  SG+F     ++
Sbjct: 264 NSNVDASSNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAII 323

Query: 519 ALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNF-WKMNPL-DCLCFLVTVFITVF 576
            +  L  AF ++P   L+ +I      L+        F W +    +   F++ V  T+ 
Sbjct: 324 CMNFLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLV 383

Query: 577 SSIENGIYFAVCWSCAILLLKVCFPAGKFLGR 608
            S + G+   +C +   LL        + LGR
Sbjct: 384 WSPQFGVTMGMCLTMIRLLKHSTRSRVQILGR 415

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 75/141 (53%), Gaps = 5/141 (3%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP Y+L  F  D IAG+++    +P +MSYA  IA +    GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F +   + +GP + +SL    VV + +     +DP++++  +   ++ + G+V    GV
Sbjct: 157 IFGSVPQMIVGPESAISL----VVGQAIEPMIRHDPSLSSLDLCVIITFISGVVLFTFGV 212

Query: 266 LRLGFLVELISLNAVTGFMTG 286
            R GFL  ++S   + GF++ 
Sbjct: 213 FRFGFLDNVLSRAFLRGFISA 233

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 67/147 (45%), Gaps = 2/147 (1%)

Query: 446 LLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRT 505
             E    +KS G   D  V  ++EL+A+G  NLIG+ F A P+ G + RS + A    +T
Sbjct: 379 FFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQT 438

Query: 506 PLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI--ASYKITWNFWKMNPLD 563
            +SG   G   +  +  L     YIP   LS +       L+  A   + ++       +
Sbjct: 439 VVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNE 498

Query: 564 CLCFLVTVFITVFSSIENGIYFAVCWS 590
            + F++TV  T F S+E GI     +S
Sbjct: 499 LISFIITVLTTFFYSVEAGITVGCGYS 525

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 90/191 (47%), Gaps = 12/191 (6%)

Query: 433 KLAPEL-PASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 488
           KL P+L  AS+IV +L   E    +KS G   +  V  ++EL+A+G  N++ + F A P+
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 489 TGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIA 548
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       L+ 
Sbjct: 420 FGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLE 479

Query: 549 SY--KITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFL 606
                I ++       +   F VT  +T+F SIE GI    C  C   +L +   + K  
Sbjct: 480 EVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGI----CIGCVYSILNIIKHSAK-- 533

Query: 607 GRIEVAEVIDG 617
            RI++   + G
Sbjct: 534 SRIQILARVAG 544

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 71/144 (49%), Gaps = 5/144 (3%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP Y  +    D+IAGI++    +P ++SY   IA +P   GLYS  I  F Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F +   + +GP + +SL   + V  +   + DN   I   IV T +S   G +    G+
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESI-TLHKDNVSLIDISIVITFVS---GAILLFSGI 210

Query: 266 LRLGFLVELISLNAVTGFMTGSAL 289
            R GFL  ++S   + GF++   L
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGL 234

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 82/176 (46%), Gaps = 7/176 (3%)

Query: 440 ASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSA 496
           A  +V LL   E    +KS G   D  +  ++EL+A+G  NL+G+ F A P+ G + RS 
Sbjct: 358 AGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSK 417

Query: 497 LKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI--ASYKITW 554
           + A     T +SG+F G   L+    L  A  +IP   LS +       L   A   + +
Sbjct: 418 INAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKF 477

Query: 555 NFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAG-KFLGRI 609
           +F      + L F +TV  T F S+E GI    C    I  +K    +G + LGRI
Sbjct: 478 HFRCRGYNELLTFAITVLTTFFYSVEAGITLG-CGYSIIRAIKNSTQSGIQILGRI 532

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 5/144 (3%)

Query: 147 FPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSFIGAFCYS 205
            P   WLP Y+ T F  DLIAG ++    +P +MSY+  +A +P   GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 206 LFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGV 265
           +F +   + +GP + +SL    VV + + K   +D ++    +   L+ + G +    G+
Sbjct: 145 VFGSVPHMIVGPESAISL----VVGQAIEKLTKHDASLNVTNLCVVLTFISGSILFSFGL 200

Query: 266 LRLGFLVELISLNAVTGFMTGSAL 289
           +R GFL  ++S   + GF++   L
Sbjct: 201 MRFGFLDSVLSRALLRGFISAVGL 224

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 75/147 (51%), Gaps = 5/147 (3%)

Query: 140 RDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYA-QIATLPAQYGLYSSF 198
           RD      P   W+P Y  + F  DL+AGIT+    +P ++SYA  +A +    GLYS  
Sbjct: 75  RDVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLA 134

Query: 199 IGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGI 258
              F Y++F +   + +GP + +SL   + V K+ A    ++  I+   ++  ++ + G+
Sbjct: 135 FTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRA----HNHEISTMSISVLVTFISGM 190

Query: 259 VTAGVGVLRLGFLVELISLNAVTGFMT 285
                G+ R GFL  ++S   + GF++
Sbjct: 191 FLFVFGICRFGFLGNVLSRALLRGFIS 217

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 86/188 (45%), Gaps = 14/188 (7%)

Query: 433 KLAPELP-ASVIVLLL---EHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 488
           +LAP L  A  IV +L   E    AKS G   ++ +  ++EL+A+G  NL  +   A PA
Sbjct: 347 ELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPA 406

Query: 489 TGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLI- 547
            G + RS + +    +T +SG+  G  VLL +        YIP   LS +       L+ 
Sbjct: 407 FGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLE 466

Query: 548 -ASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGK-- 604
            A   + ++F      + L F VTV  T F S+E G    VC  C   ++ +   + K  
Sbjct: 467 EAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMG----VCIGCGYSVISIIKHSAKSR 522

Query: 605 --FLGRIE 610
              L R+E
Sbjct: 523 IQILARVE 530

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 87/189 (46%), Gaps = 17/189 (8%)

Query: 108 NPVIIPNYDEKTVSIKDY----YDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTS 163
            P ++P     T+S++ Y     D  +R +      + Y     PI RWLP Y+      
Sbjct: 12  RPGVMPA--SSTMSLRSYRAIKVDKPLRHDT-----KSYVSYYLPILRWLPEYSWGKMAK 64

Query: 164 DLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSL 223
           D++AG+T+    +P ++S   +A +    GLY+  I    Y++F +   + +GP  V SL
Sbjct: 65  DMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASL 124

Query: 224 ETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGF 283
              +       K    +P +T  ++      + G++   +G+ RLGF+   IS   + GF
Sbjct: 125 VVGQSCDAWAHK--SLEPLMTVAVIGC----ISGVLVFAMGIFRLGFIDNAISKAFLKGF 178

Query: 284 MTGSALNIL 292
            +  A+ +L
Sbjct: 179 TSALAVVML 187

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 440 ASVIVLLLEHIAIAKSFGRIN---DYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSA 496
           AS +V +L     A +F  I+   D  V  ++EL+++G+ N++G+ F++ PA G + RS 
Sbjct: 320 ASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSK 379

Query: 497 LKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVI 539
           L   C  +TP++GIF     +  +  L G F Y+P   L+ +I
Sbjct: 380 LNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVII 422

>NDAI0D02940 Chr4 complement(691155..696308) [5154 bp, 1717 aa] {ON}
            Anc_4.45 YLR310C
          Length = 1717

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 12/92 (13%)

Query: 748  DRPWNDPGEWEAP-QFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQV 806
            + P+N   E+ A  +F+KNL  R  +  T+    VDVSD          L I C DF  +
Sbjct: 1130 NEPFNRLDEYSAAMKFMKNLIKRDYE--TNGSKFVDVSDE---------LAIACNDFIDI 1178

Query: 807  AQIDASAIQSLVDLRKSINRYADRQVEFHFAG 838
            A +    ++ L++ R++I  Y  R ++ H A 
Sbjct: 1179 AALSCGIVEQLIESRENILNYVARMMQSHIAS 1210

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 74/175 (42%), Gaps = 9/175 (5%)

Query: 451 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGI 510
           A+A S   ++ Y V  D+ELIA G +NLI  F  +      ++ S L  +    +P++GI
Sbjct: 548 ALAMSLN-VDKYDV--DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGI 604

Query: 511 FTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKI-TWNFWKMNPLDCLCFLV 569
                  + +        +IP   + ++I     +LI    I TW   K+ P + L   +
Sbjct: 605 MLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG--KLQPFEYLTIWI 662

Query: 570 TVFITVFSSIENGIYFAVCWSCAILLL---KVCFPAGKFLGRIEVAEVIDGYVDN 621
            V          GI   +  +C   L+   ++    G++ G++  + V   Y+ +
Sbjct: 663 IVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQS 717

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1150

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 451 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGI 510
           A+A S  +++ Y V  D+ELIA G +NLI   F +      ++ S L  +    T  +G+
Sbjct: 616 ALAMSV-QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGL 672

Query: 511 FTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKI-TWNFWKMNPLDCLCFLV 569
                  + L+       +IP   + ++I     +LI    + TW   K+   + +  ++
Sbjct: 673 VLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWG--KVTKFEYITIMI 730

Query: 570 TVFITVFSSIENGIYFAVCWSCAILLL---KVCFPAGKFLGRIEVAEVIDGYV 619
            VF         GI   +  +C   L+   K+    G+F G +  + V   YV
Sbjct: 731 IVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYV 783

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 72/174 (41%), Gaps = 9/174 (5%)

Query: 451 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGI 510
           A+A S  +++ Y V  D+ELIA G +N       +      ++ S L  +    +P +G 
Sbjct: 491 ALAMSL-QMDKYDV--DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGF 547

Query: 511 FTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKI-TWNFWKMNPLDCLCFLV 569
              A  +  +        +IP   + ++I     +L+    + TWN  K+N  + L  ++
Sbjct: 548 LLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWN--KLNRFEYLTVVI 605

Query: 570 TVFITVFSSIENGIYFAVCWSCAILLL---KVCFPAGKFLGRIEVAEVIDGYVD 620
            VF         GI   +  +C   L+   K+    G++ G +  + V   YV 
Sbjct: 606 IVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQ 659

>YPL085W Chr16 (387067..393654) [6588 bp, 2195 aa] {ON}  SEC16COPII
           vesicle coat protein required for ER transport vesicle
           budding; Sec16p is bound to the periphery of ER
           membranes and may act to stabilize initial COPII
           complexes; interacts with Sec23p, Sec24p and Sec31p
          Length = 2195

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 19/97 (19%)

Query: 774 STDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVE 833
           S++EE  V  +DN++   ++P           V +  AS  + +++    +     RQ +
Sbjct: 527 SSEEEDTVPNTDNTTNLTSKP-----------VEEKKASRYKPIIEEEAGM-----RQEQ 570

Query: 834 FHFA---GIVSPWVKRGLINRGFGTINDEFSDASIIA 867
            HF    GIV+P    GL   G GT N + S  +I++
Sbjct: 571 VHFTNTTGIVTPQQFHGLTKTGLGTPNQQVSVPNIVS 607

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 94,698,110
Number of extensions: 4073730
Number of successful extensions: 12982
Number of sequences better than 10.0: 58
Number of HSP's gapped: 13083
Number of HSP's successfully gapped: 91
Length of query: 923
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 804
Effective length of database: 39,836,145
Effective search space: 32028260580
Effective search space used: 32028260580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)