Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050408.266ON27327314700.0
NDAI0B020108.266ON2812756011e-76
SAKL0H16940g8.266ON3033043654e-41
Kwal_56.237778.266ON2672593461e-38
TDEL0F039308.266ON2802773443e-38
KLTH0G13596g8.266ON2672272893e-30
ZYRO0C01562g8.266ON2772762842e-29
YLR091W (GEP5)8.266ON2932972721e-27
Smik_12.1508.266ON2922902545e-25
Suva_10.1758.266ON2992872538e-25
Skud_12.1598.266ON2942802512e-24
Kpol_392.48.266ON2812812492e-24
KAFR0B027408.266ON2562592376e-23
KNAG0G020608.266ON2862902082e-18
KLLA0F19228g8.266ON3052351853e-15
AGR082C8.266ON2662631763e-14
Ecym_43048.266ON2892411702e-13
TPHA0J007608.266ON2492381437e-10
NDAI0G008301.394ON465100810.11
SAKL0H13376g8.411ON32964702.2
TDEL0F053508.411ON33264693.0
Kpol_1064.598.411ON34164666.0
YDR204W (COQ4)8.411ON335137658.5
NOTE: 1 genes in the same pillar as NCAS0B05040 were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05040
         (273 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   570   0.0  
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   236   1e-76
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   145   4e-41
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   137   1e-38
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   137   3e-38
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   115   3e-30
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   114   2e-29
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   109   1e-27
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   102   5e-25
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   102   8e-25
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...   101   2e-24
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   100   2e-24
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    96   6e-23
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    85   2e-18
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    76   3e-15
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    72   3e-14
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    70   2e-13
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    60   7e-10
NDAI0G00830 Chr7 complement(175022..176419) [1398 bp, 465 aa] {O...    36   0.11 
SAKL0H13376g Chr8 complement(1150090..1151079) [990 bp, 329 aa] ...    32   2.2  
TDEL0F05350 Chr6 (995017..996015) [999 bp, 332 aa] {ON} Anc_8.41...    31   3.0  
Kpol_1064.59 s1064 (104098..105123) [1026 bp, 341 aa] {ON} (1040...    30   6.0  
YDR204W Chr4 (858137..859144) [1008 bp, 335 aa] {ON}  COQ4Protei...    30   8.5  

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/273 (100%), Positives = 273/273 (100%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60
           MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60

Query: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120
           DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ
Sbjct: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120

Query: 121 WAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTLNARITSNAKRLQPPLVGV 180
           WAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTLNARITSNAKRLQPPLVGV
Sbjct: 121 WAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTLNARITSNAKRLQPPLVGV 180

Query: 181 PMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYENTSRSLR 240
           PMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYENTSRSLR
Sbjct: 181 PMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYENTSRSLR 240

Query: 241 RLYQRASKNAHVIAGESPESIQFAIAKDLHRML 273
           RLYQRASKNAHVIAGESPESIQFAIAKDLHRML
Sbjct: 241 RLYQRASKNAHVIAGESPESIQFAIAKDLHRML 273

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  236 bits (601), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 173/275 (62%), Gaps = 6/275 (2%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60
           +   +T TLL SL N+PLH  TL  LERK  T N K+T+ SFK+PLL L+  YE+     
Sbjct: 4   LNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATK-SFKIPLLTLINSYEKAQASG 62

Query: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120
             +   K LESI Y+TYF W N + SHL+ FQ+    L  +WP +YH  +D+K++SII+ 
Sbjct: 63  QSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILT 122

Query: 121 WAKSNNGDALLKGTMNHIQPGAS-----AEELLMFKKIFQHYIFLTLNARITSNAKRLQP 175
           W KS+N   +L+  ++H+    S      +  ++FKKI+QHYIFL+LN  + SN KRL  
Sbjct: 123 WNKSSNSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRLPS 182

Query: 176 PLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYENT 235
           P+V +PMN+MG  IP+ R+ NL R K++ T N L   NP+LN+EN   LDEIIN      
Sbjct: 183 PIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIK 242

Query: 236 SRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLH 270
           SR LR+LY+RA  N++VI  E   +I+F  +K L+
Sbjct: 243 SRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKLN 277

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  145 bits (365), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 155/304 (50%), Gaps = 56/304 (18%)

Query: 8   TLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEK 67
           TLL  L  +PL  +TLDLLE  ++  +           LL  L + + ++ Q ++    K
Sbjct: 6   TLLNFLECLPLDTRTLDLLEGTVKLCSSA---------LLDTL-EQKLFDYQANENS--K 53

Query: 68  VLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDT----KRDSIIVQWAK 123
            LE I YNTYF WNN  P H+Q F++N   LR +WP   HR + +    +R SI   W  
Sbjct: 54  SLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWND 113

Query: 124 SN--------------------------NGDALL----------KGTMNHIQPGASAEEL 147
           +N                          N + +L          +G+M    P  S  EL
Sbjct: 114 NNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLEL 173

Query: 148 -LMFKKIFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTA 206
            L+F +IFQHY+FL  N ++    K+L  P+V +PM  +G+ IP VR++NLF++K + T 
Sbjct: 174 TLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATW 233

Query: 207 NALCALNPVLNVENHGFLDEIINADYENTS---RSLRRLYQRASKNAHVIAGESPESIQF 263
             L   NPVL++EN   L +II + + +TS   R ++RLYQRA K+++VI  +    + F
Sbjct: 234 KLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDF 293

Query: 264 AIAK 267
            I+K
Sbjct: 294 QISK 297

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  137 bits (346), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 137/259 (52%), Gaps = 30/259 (11%)

Query: 10  LRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKVL 69
           ++ L  +PL  +TL L+E++++ A             L+ L    +Y  ++D     K L
Sbjct: 5   IQVLEKLPLDVRTLKLIEKRLERAES-----------LRFLELARQYEAKKDY----KTL 49

Query: 70  ESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHR---GMDT-KRDSIIVQWAKSN 125
           E+I ++TYF W N +P H++ F+++   LR +WP   HR   GM + K  SI   W+  N
Sbjct: 50  ENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGN 109

Query: 126 NG--DALLKGTMNHIQPGASA-----EELLMFKKIFQHYIFLTLNARITSNAKRLQPPLV 178
                A+  G+    + G        E  L F +IFQH++FL    ++  N K L  P+V
Sbjct: 110 PRVLAAMRYGSYGWNREGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIV 169

Query: 179 GVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINA----DYEN 234
            +PM  +G+ I  VR+KNLF++KV++    L   NP L+ EN   L +II +      + 
Sbjct: 170 EIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQT 229

Query: 235 TSRSLRRLYQRASKNAHVI 253
           +SR L+RLYQRA + A+VI
Sbjct: 230 SSRMLKRLYQRACRGAYVI 248

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  137 bits (344), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 142/277 (51%), Gaps = 34/277 (12%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60
           M + +   LL++L  +PLH KTLDLL  K++    K+      +PL +L+   E    + 
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTV----IIPLAKLVSNLESSRAET 56

Query: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRG---MDTKRD-S 116
            +    K LESI Y+T+F+W +P+P HL++FQ +   +  +WP   HR    M+  R  S
Sbjct: 57  QRI---KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTS 113

Query: 117 IIVQWAKSNNG--------------DALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTL 162
           +  +W  S+                D +L   +  IQ        L+F  +F HY+FL  
Sbjct: 114 LRYRWEDSSKTVLSMAEYSKNPWIEDNILSKKLTIIQRD------LLFHSVFSHYLFLKA 167

Query: 163 NARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHG 222
           N R+ +N + L  P+V +PM  +G  I   R+KNLF+ KV+ T   L   NPVL+  +  
Sbjct: 168 NPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSEN 227

Query: 223 FLDEIINADYENTSRSLRRLYQRASKNAHVIAGESPE 259
            L EII+   + +SR  RRLYQ + K A+V+  +  E
Sbjct: 228 ILSEIIS---DASSRKQRRLYQASCKRAYVMEYDDGE 261

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  115 bits (289), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 121/227 (53%), Gaps = 21/227 (9%)

Query: 64  GIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRG---MDT-KRDSIIV 119
           G  K LESI + TYF W N    H++ F+++   LR +WP  +HR    MDT K  SI  
Sbjct: 44  GSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRF 103

Query: 120 QWAKSNNGDALLKGTMNHIQPGASAEE----------LLMFKKIFQHYIFLTLNARITSN 169
            W+ SN+   L K  M++ +     EE           + F ++FQH++FL     +   
Sbjct: 104 LWS-SNSPKVLSK--MSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKT 160

Query: 170 AKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIIN 229
            K L  P+V +PM  +G+ IP+VRV+NLF++K+++    L   +P L+ +N   L +II+
Sbjct: 161 RKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIID 220

Query: 230 A----DYENTSRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLHRM 272
           +    +  ++ R L+RLYQRA + A+ I       ++   +K L R+
Sbjct: 221 SPQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL 267

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  114 bits (284), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 140/276 (50%), Gaps = 35/276 (12%)

Query: 3   KSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDK 62
           + +   L RS+  +PLH +T  +LE   + ++ KS      + + Q + ++E++N     
Sbjct: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKS------LLVAQDISEFEKHNDH--- 57

Query: 63  RGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGM----DTKRDSII 118
               K LE++   T+F+W+NP+P  L+ FQ  ++ L  +WP  Y R +    + +++S  
Sbjct: 58  ----KYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQG 113

Query: 119 VQWAKSNNGDALLKGTM----------NHIQPGASAEELLMFKKIFQHYIFLTLNARITS 168
             W    +G  L    +          N I+  +  +   +   IF  Y FL  +AR+  
Sbjct: 114 YLW---RDGKELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCY 170

Query: 169 NAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEII 228
           N +++  P+V +P+  MG  +   R++NLF++K +   N L   N  L+  N   L EII
Sbjct: 171 NNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEII 230

Query: 229 NADYENTSRSLRRLYQRASKNAHVIA--GESPESIQ 262
               ++ +RS+RRLYQRAS+ A+V+   G+ P  +Q
Sbjct: 231 T---KSETRSMRRLYQRASRRAYVVTNEGKDPNGLQ 263

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  109 bits (272), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 131/297 (44%), Gaps = 46/297 (15%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFK---VPLLQLLCKYERYN 57
           M   V   LL  + + PLH+ T   L     T   K + + FK   VPL + L  YE+  
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVAL---TTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQ 57

Query: 58  IQEDKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSI 117
            ++D R   K LESI Y T+F WNNP+P H  +FQK+   L  +WP   HR +    DSI
Sbjct: 58  RRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDL---VDSI 114

Query: 118 IVQ---------------------------WAKSNNGDALLKGT-MNHIQPGASAEELLM 149
            V                            W ++      L GT ++   P    E + +
Sbjct: 115 AVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTP----ERIFL 170

Query: 150 FKKIFQHYIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANA 208
              +  HY FL  N+ ++ N K+   P V +P+ N++GE  P  ++  LF +++S    +
Sbjct: 171 INSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKS 230

Query: 209 LCALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVI--AGESPESIQF 263
           L   NP L+ EN   L  +     E   R LRRLY RA   A+    A  + E + F
Sbjct: 231 LFIENPPLSPENELALTAVFYD--ETVERRLRRLYMRACARAYTTTNADSTTEPLMF 285

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  102 bits (254), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 132/290 (45%), Gaps = 32/290 (11%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFK---VPLLQLLCKYERYN 57
           M   V   LL  + ++PLH+ T + L   + T  D  + + FK   VPL +LL  +E+  
Sbjct: 1   MASRVNDLLLPVIQSIPLHQITKNAL---VTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQ 57

Query: 58  IQEDKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHR-------GM 110
            ++D R   K LESI Y T+F WNNP P H  +FQK+   L  +WP   HR         
Sbjct: 58  RRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAH 117

Query: 111 DTKRDSIIVQ--WAKSNNGDAL-LKGTMNHIQP-----------GASAEELLMFKKIFQH 156
             K +SI  +  W K++      +K       P             + E   +   +   
Sbjct: 118 KGKLNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQ 177

Query: 157 YIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANALCALNPV 215
           Y FL  N+ ++ N K+   P V +P+ N++GE  P  ++  LF +++++   +L   NP 
Sbjct: 178 YKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPP 237

Query: 216 LNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVI--AGESPESIQF 263
           L+  N   L  I N   +   R  +RLY RA   A+ I  A  + E + F
Sbjct: 238 LSPANDIALMAIFND--KTMDRRFKRLYMRACARAYTITNADSTIEPLTF 285

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  102 bits (253), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 122/287 (42%), Gaps = 37/287 (12%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60
           M     + LL  + ++PLH+ T   L  ++   +         VPL + L  YE+    +
Sbjct: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120
           D R   K LESI Y T+F WNNP P H  +FQK+   L  +WP   HR +    DSI  Q
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSL---VDSIPAQ 117

Query: 121 WAK----SNNGDALLKGTMNHIQ---------------------------PGASAEELLM 149
             K    ++ G+ L        Q                              +AE   +
Sbjct: 118 NGKLISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFL 177

Query: 150 FKKIFQHYIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANA 208
            K +  HY FL  N+ ++ N K+   P+V +P+ N++GE  P  ++  LF ++++    +
Sbjct: 178 VKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTS 237

Query: 209 LCALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAG 255
           L   NP L+  N   L  +   D     R   RLY RA   A+ IA 
Sbjct: 238 LFVENPPLSTANELALMTVF--DDGTLERRHTRLYMRACARAYTIAN 282

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score =  101 bits (251), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 124/280 (44%), Gaps = 33/280 (11%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60
           M   +   LL  + ++PLHR T   L   +             VPL + L  YE+   ++
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120
           D R   K LESI + T+F WNNP P H  +FQK++  L  +WP   HR +    DSI   
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSL---VDSICAH 117

Query: 121 WAKSNN----GDAL---------LKGTMNHIQPGASA--------------EELLMFKKI 153
             K N+    G  L         +K T     P +++              E   +   +
Sbjct: 118 NGKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSL 177

Query: 154 FQHYIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANALCAL 212
             HY FL  N+ ++ N K+  PP V +P+ N++GE     ++  LF ++++    +L   
Sbjct: 178 GNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVE 237

Query: 213 NPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHV 252
           NP L+ +N   L  + + D  +  R  +RLY RA   A+ 
Sbjct: 238 NPPLSADNELALMAVFHDD--SLDRRHKRLYMRACARAYT 275

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 131/281 (46%), Gaps = 25/281 (8%)

Query: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60
           + K +   LL SL  +PLH+ TLD+LER+I  A+       F    + +L +YE   I  
Sbjct: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHVAD-----LPFMEEYVGILNEYEISKINS 61

Query: 61  DKRGIEKVLESIAYNTYFIWNNP-VPSHLQVFQKNNEMLRRYWPCVYHRG-MDTKR---D 115
                 + LE I   T+ +WNN   P+HL+ F+ +   L  +WP  +H   ++  R    
Sbjct: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121

Query: 116 SIIVQWAKSNNGDALLKGTMNHIQPG----------ASAEELLMFKKIFQHYIFLTLNAR 165
           S+I  +   NN D       + I                + + ++  IF+   FL  +  
Sbjct: 122 SLI--YLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTT 179

Query: 166 ITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLD 225
           I+   K +  P+V VP+  +G  IP  R+KNLF KKV +    L   +P +++ +   + 
Sbjct: 180 ISEVNKNMV-PIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIM 238

Query: 226 EIINADYENTSRSLRRLYQRASKNAHVIAGESPESIQFAIA 266
            I+    +N  R + RLY+R+ KN++V    +P  I +  A
Sbjct: 239 NILEDTKDN--RRINRLYRRSLKNSYVFDDTNPIEITYRYA 277

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 95.9 bits (237), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 126/259 (48%), Gaps = 35/259 (13%)

Query: 3   KSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDK 62
           K V   +  ++  +PLH+KTL  L+  ++  ND     +  +PLL+ +  YE        
Sbjct: 14  KEVRDKITNAIEGLPLHQKTLLQLQDTLK-RND-----ALAIPLLRDVVSYE-------T 60

Query: 63  RGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYH---RGMDTKRDSIIV 119
            G  K LESI Y  YF W N VPSHL+      E L+  WP   H   +  + +  S+  
Sbjct: 61  TGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEPEAISLRN 120

Query: 120 QWAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTLNA-RITSNAKRLQPPLV 178
            W ++      L  +   I+P            I  H+ +L +N  R+    K++  P++
Sbjct: 121 AWMRNKATAVDLSTSDGVIKP------------ILNHFRYLRVNEDRLCK--KKVGLPIL 166

Query: 179 GVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYENTSRS 238
            VP+N  G  IP+ RV NL +K+++    +L   NP+L+ +    L  IIN D +NT R+
Sbjct: 167 EVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIIN-DSKNT-RA 224

Query: 239 LRRLYQRASKNAHVIAGES 257
           L+R+Y R+   A+   GES
Sbjct: 225 LKRVYLRSCSRAY--TGES 241

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 4   SVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYER--YNIQED 61
           +V T LLR L ++PLH  TL  L R +  A  KS      +P L+ + +  +  +++   
Sbjct: 3   TVRTGLLRELRSLPLHSLTLARLSRHV--AATKS------IPRLKHVAETLQNFHDVPST 54

Query: 62  KRGIE-KVLESIAYNTYFIWNNP------VPSHLQVFQKNNEMLRRYWPCVYHRGM--DT 112
           K+  + K+L ++    Y  W+N       +P HL  F+++   L R WP   H  +   T
Sbjct: 55  KKHTQYKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQST 114

Query: 113 KRDSIIVQWAKSNNGDAL-LKGTMNHIQPGASAEELL-MFKKIFQHYIFLTLNARITSNA 170
           K  + +     +NN  AL +        P +   EL    ++I  HY  L  N R+    
Sbjct: 115 KGHATLKHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKI 174

Query: 171 KRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVL-NVENHGFLDEIIN 229
           K LQ P+  +P+N  GE IP  R  NL ++KV +    L    P L N E    L  II 
Sbjct: 175 K-LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIA 233

Query: 230 ADYEN------TSRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLHRML 273
            D         + R LRRLY+RA    + +A  + E     +     RML
Sbjct: 234 GDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSFALRML 283

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 103/235 (43%), Gaps = 41/235 (17%)

Query: 67  KVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGM----DTKRDSIIVQWA 122
           K LE + Y+ +F   N  P H+ + ++    L ++WP      +    D    S  + W+
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110

Query: 123 KSNNGDALLKGTMNH---IQPG---ASAEELL---------------------------M 149
           + NN DAL   + N    ++P       EEL+                            
Sbjct: 111 R-NNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKET 169

Query: 150 FKKIFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANAL 209
            ++IF+HY FL  N ++ +  K+LQ P+V + M   G  I  +R+ NLF+KKV   ++ L
Sbjct: 170 LRQIFEHYYFLKTNPKLCA-TKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLL 228

Query: 210 CALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAGESPESIQFA 264
            + NPVL  +    L  I+N    + +R  +RLY+  +  +++      E  + A
Sbjct: 229 YSQNPVLTSDAESILTSIVND--PDLNRRTKRLYKNVASRSYLFKDGKFEISELA 281

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 115/263 (43%), Gaps = 31/263 (11%)

Query: 11  RSLPNVPLHRKTLDLLERKI--QTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKV 68
           R +  +PLHR T +++   +  Q A   + R     PL   L           ++G  + 
Sbjct: 7   RIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFL-----------RKGGHQG 55

Query: 69  LESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGM----DTKRDSI------- 117
           L+ + ++ +F      P HL++ +++ E L+R+WP   H  +    D +  S+       
Sbjct: 56  LQRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDG 115

Query: 118 ---IVQWAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTLNARITSNAKRLQ 174
              ++Q  +      L +G +        A+   +  ++F  Y+FL     + S  +RL 
Sbjct: 116 QEEVLQQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWS-VRRLP 174

Query: 175 PPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYEN 234
            P+V + M  +G  IP VRV  LF+ K       L   +P L       +  II    E 
Sbjct: 175 IPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIA---EC 231

Query: 235 TSRSLRRLYQRASKNAHVIAGES 257
            +R++RR+Y RA + A+V+  ++
Sbjct: 232 PTRAMRRIYLRACRRAYVLDADA 254

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 105/241 (43%), Gaps = 45/241 (18%)

Query: 69  LESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHR----GMDTKRDSIIVQWAKS 124
           L  + ++ YF   NP   H++ F++  + L+ +WP   H     G    +DS    W+++
Sbjct: 58  LRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRN 117

Query: 125 NNG--------------DALLKGTMNHI--QPG----------------ASAEELLMFKK 152
           N                D   K +++ I  +P                    E + + K 
Sbjct: 118 NAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKL 177

Query: 153 IFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCAL 212
           IF HY+F+     +  + K L  P+V V M+ +GE +P VR+ NLFRK+   T   L   
Sbjct: 178 IFSHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHD 236

Query: 213 NPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLHRM 272
            P L+ E    L  II    +   RS+ RLY+ +   A+ +    P++ QF ++  L RM
Sbjct: 237 FPPLSREVESLLHSII----KECDRSMGRLYKWSCNGAYTM---DPKTNQFEVS-SLCRM 288

Query: 273 L 273
           L
Sbjct: 289 L 289

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 102/238 (42%), Gaps = 59/238 (24%)

Query: 9   LLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKV 68
           +L  L  +PLH  TLDLL++++ T   K T++S    L++LL  Y    I + K G  K 
Sbjct: 21  ILDGLNRLPLHPNTLDLLQKQVHT---KLTKNS---ELIELLFDYNNAFINKQKPGQLKC 74

Query: 69  LESIAYNTYFIWNNPVPS--HLQVFQKNNEMLRRYWPCVYHRGM--------DTKRDSII 118
           L+ I + T+ I+NN   +  HL+ F+     L   WP   H  +        +TK    +
Sbjct: 75  LQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYL 134

Query: 119 VQWAKSNN----GDALLKGTMNHIQ-----PGASAEELL--------------------- 148
                S+N    G   +K     IQ      G      L                     
Sbjct: 135 WNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIE 194

Query: 149 --MFKKIFQ--HYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKV 202
             +F ++F+  HYI         +   +LQ P+V +P+N++G  IP+ R+ N F+KK+
Sbjct: 195 INLFGELFKQLHYI---------NTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243

>NDAI0G00830 Chr7 complement(175022..176419) [1398 bp, 465 aa] {ON}
           Anc_1.394 YNL011C
          Length = 465

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 7/100 (7%)

Query: 50  LCKYERYNIQEDKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRG 109
           L K   Y + ED+   +K   +I   T+ IW+N VP+ ++      EM R ++  +    
Sbjct: 71  LVKLLGYRLSEDEITAKKDWNNIVEGTHIIWSN-VPTEVK------EMCRAFFIHIQSEL 123

Query: 110 MDTKRDSIIVQWAKSNNGDALLKGTMNHIQPGASAEELLM 149
           +   R S   Q+AK++ G+  L G    +    +A EL+M
Sbjct: 124 LKKNRSSNNFQFAKASLGNMFLTGARLFLGSLDAAIELMM 163

>SAKL0H13376g Chr8 complement(1150090..1151079) [990 bp, 329 aa]
           {ON} highly similar to uniprot|O13525 Saccharomyces
           cerevisiae YDR204W COQ4 Protein with a role in
           ubiquinone (Coenzyme Q) biosynthesis possibly
           functioning in stabilization of Coq7p located on the
           matrix face of the mitochondrial inner membrane
          Length = 329

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 171 KRLQPPLVGVPMNSMGETIPQVRVKNLFRKK-----VSWTANALCALNPVLNVENHGFLD 225
           K L+   +GVPM ++G     +R+K + R++     + W   +  +  P++NV     LD
Sbjct: 228 KALEAANIGVPMAALGALFAPLRLKPVQRERLYDIYLPWAIKSGLSCKPLINVYWEKILD 287

Query: 226 EIIN 229
           + +N
Sbjct: 288 KDVN 291

>TDEL0F05350 Chr6 (995017..996015) [999 bp, 332 aa] {ON} Anc_8.411
           YDR204W
          Length = 332

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 171 KRLQPPLVGVPMNSMGETIPQVRVKNLFRKK-----VSWTANALCALNPVLNVENHGFLD 225
           K L+   +GVPM  +G  +  +R+K + R++     + W      +  P++NV     LD
Sbjct: 232 KALEAANMGVPMAGLGALLAPLRLKPIQRERLYDIYLPWAVRMGLSCKPLINVYWEEILD 291

Query: 226 EIIN 229
           + IN
Sbjct: 292 KDIN 295

>Kpol_1064.59 s1064 (104098..105123) [1026 bp, 341 aa] {ON}
           (104098..105123) [1026 nt, 342 aa]
          Length = 341

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 171 KRLQPPLVGVPMNSMGETIPQVRVKNLFRKK-----VSWTANALCALNPVLNVENHGFLD 225
           K L+   +G+PM ++G  +  +R+K+  R++     + W      +  P++NV     LD
Sbjct: 240 KALEAANMGIPMAALGTLLAPLRLKSAQRQRLYEIYLPWAIRTGLSCKPLINVYWEELLD 299

Query: 226 EIIN 229
           + +N
Sbjct: 300 KDVN 303

>YDR204W Chr4 (858137..859144) [1008 bp, 335 aa] {ON}  COQ4Protein
           with a role in ubiquinone (Coenzyme Q) biosynthesis,
           possibly functioning in stabilization of Coq7p; located
           on the matrix face of the mitochondrial inner membrane;
           component of a mitochondrial ubiquinone-synthesizing
           complex
          Length = 335

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 56/137 (40%), Gaps = 22/137 (16%)

Query: 117 IIVQWAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIF--------LTLNARITS 168
           +  QW K  N     +  +  I     A    +FK+  Q + F        + +   IT 
Sbjct: 173 VYYQWLKRENVSPDTRAPVKFIDDPMHA---YIFKRYRQCHDFYHAITNMPIIIEGEITI 229

Query: 169 NAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKK-----VSWTANALCALNPVLNVENHGF 223
            A  L+   +GVPM  +G  +  +R+K + RK+     + W      +  P++NV    +
Sbjct: 230 KA--LEGANLGVPMAILGGILAPLRLKKVQRKRLYNIYLPWAVRTGLSCKPLINV----Y 283

Query: 224 LDEIINADYENTSRSLR 240
            +E++  D     + L+
Sbjct: 284 WEEMLEKDVTALRKELK 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,671,224
Number of extensions: 1280348
Number of successful extensions: 3462
Number of sequences better than 10.0: 35
Number of HSP's gapped: 3511
Number of HSP's successfully gapped: 42
Length of query: 273
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 165
Effective length of database: 41,097,471
Effective search space: 6781082715
Effective search space used: 6781082715
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)