Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050308.264ON43343322490.0
NDAI0B020008.264ON43343914060.0
TDEL0F039108.264ON42941211281e-152
ZYRO0C01606g8.264ON43244211251e-151
TPHA0A017908.264ON4394499871e-130
SAKL0H16984g8.264ON4354509861e-130
Kpol_543.408.264ON4144319721e-128
KLTH0G13640g8.264ON4144469451e-124
Ecym_43068.264ON4344419321e-122
AGR084C8.264ON4274428971e-117
Kwal_56.237828.264ON4144468901e-116
KLLA0F19184g8.264ON5124238671e-111
KNAG0G020508.264ON4324268171e-105
Smik_12.1498.264ON4604468171e-104
Suva_10.1748.264ON4564337991e-102
YLR090W (XDJ1)8.264ON4594497951e-101
Skud_12.1588.264ON4554417861e-100
CAGL0L12276g8.264ON4524686918e-86
CAGL0J09966g2.243ON4074444902e-56
Ecym_32812.243ON4094474884e-56
KLLA0F03333g2.243ON4094404851e-55
KNAG0I019002.243ON4093864841e-55
Kpol_1003.122.243ON4084434813e-55
KAFR0J009402.243ON4113834772e-54
SAKL0E08734g2.243ON4114454762e-54
TPHA0C031102.243ON4074454753e-54
Smik_14.2632.243ON4094074692e-53
YNL064C (YDJ1)2.243ON4094074665e-53
NDAI0D010302.243ON4114214665e-53
ADL257C2.243ON4104474658e-53
Skud_14.2682.243ON4104074622e-52
Suva_14.2772.243ON4094074622e-52
TBLA0E038102.243ON4104454613e-52
Kwal_23.48302.243ON4114444571e-51
ZYRO0A01496g2.243ON4124544535e-51
KLTH0G09394g2.243ON4113834492e-50
TDEL0C046002.243ON4114414412e-49
NCAS0G030002.243ON4103854291e-47
KLTH0G08756g2.218ON4623894172e-45
TDEL0C043502.218ON4624084145e-45
Kwal_23.30612.218ON4584054111e-44
AER427W2.218ON4704134023e-43
SAKL0E09306g2.218ON4613863866e-41
SAKL0H05258g8.730ON3683653534e-37
KNAG0M020202.218ON4603743532e-36
ZYRO0A06226g8.730ON3773703482e-36
Ecym_62368.730ON3743673474e-36
NCAS0G028502.218ON4944223517e-36
Kpol_1002.1222.218ON5034553454e-35
TPHA0G006308.730ON3933763362e-34
TBLA0E036602.218ON4484263382e-34
KAFR0A041608.730ON3783693325e-34
TDEL0B037908.730ON3733653317e-34
CAGL0F03729g8.730ON3613573272e-33
KNAG0G028808.730ON3783733273e-33
KLLA0C07260g8.730ON3683653263e-33
NDAI0E008708.730ON3763653255e-33
YMR214W (SCJ1)8.730ON3773693239e-33
NCAS0B005308.730ON3753653202e-32
Kwal_26.90248.730ON3753703202e-32
CAGL0J10296g2.218ON4794583243e-32
Suva_13.3978.730ON3753713175e-32
Smik_13.4228.730ON3783743151e-31
ZYRO0C15048g2.218ON4912873164e-31
KLTH0D12496g8.730ON3753693115e-31
Skud_13.3838.730ON3753673072e-30
KLLA0E07899g2.218ON4954803076e-30
Kpol_1064.408.730ON3873713028e-30
TBLA0B034908.730ON3843772817e-27
AER346W8.730ON3673602744e-26
Suva_14.2622.218ON5362882752e-25
Ecym_53842.218ON5032742715e-25
Smik_14.2492.218ON5332892699e-25
YNL077W (APJ1)2.218ON5282792681e-24
KNAG0G011308.61ON5004132555e-23
Skud_14.2532.218ON5322572512e-22
NDAI0F024502.218ON5303052381e-20
TPHA0C029802.218ON5543122272e-19
KAFR0C031608.61ON4982792086e-17
TPHA0D005508.61ON4863082068e-17
NDAI0G032808.61ON5523912023e-16
Kpol_1011.98.61ON4953031971e-15
Smik_6.638.61ON5104001971e-15
Suva_6.448.61ON5074041962e-15
ZYRO0F03652g8.61ON4623761952e-15
NCAS0C039508.61ON5193931872e-14
TBLA0C014801.398ON353721852e-14
NDAI0C026101.398ON340721834e-14
KAFR0H031501.398ON359721763e-13
AAL008W1.398ON349721754e-13
TPHA0B037601.398ON355721754e-13
KNAG0I007407.157ON425721731e-12
NDAI0G042501.398ON363721721e-12
KLLA0D04818g1.398ON354721702e-12
TDEL0H022907.217ON387721702e-12
KNAG0J018408.698ON650741713e-12
Kwal_47.179578.61ON4782981703e-12
Ecym_43727.217ON579911703e-12
Ecym_12921.398ON347721673e-12
TPHA0L007907.157ON446721693e-12
YIR004W (DJP1)7.157ON432721694e-12
ZYRO0E04598g1.398ON357721675e-12
CAGL0H03707g1.398ON349721666e-12
Kwal_0.2071.398ON353721666e-12
ABL194C2.15ON552711686e-12
Suva_14.1162.15ON600661687e-12
Skud_14.1102.15ON596661677e-12
Kpol_457.151.398ON357721641e-11
Smik_13.3612.350ON224711601e-11
Ecym_14508.61ON4922841661e-11
TDEL0H032107.157ON411721641e-11
Smik_9.2037.157ON432721641e-11
KLTH0H12100g1.398ON350721622e-11
YNL227C (JJJ1)2.15ON590661642e-11
YNL007C (SIS1)1.398ON352721612e-11
KLTH0B08338g2.15ON590661642e-11
Smik_14.3211.398ON366721622e-11
TDEL0B059601.398ON369721612e-11
SAKL0D08778g1.398ON348721613e-11
ZYRO0G03850g7.157ON418721623e-11
KNAG0H016801.398ON363721613e-11
Skud_14.3201.398ON368721613e-11
TPHA0C012607.217ON380721613e-11
Skud_9.1817.157ON421721613e-11
KLLA0D06402g1.297ON631681633e-11
Suva_14.3411.398ON359721603e-11
Kwal_55.209657.157ON421721613e-11
TBLA0J018707.157ON470721613e-11
Smik_10.1681.297ON649721623e-11
ZYRO0D16390g7.217ON398721603e-11
CAGL0J07370g2.15ON623661624e-11
YMR161W (HLJ1)2.350ON224711554e-11
KLLA0D19602g2.15ON620831624e-11
Smik_15.4378.698ON663741624e-11
TDEL0A064308.698ON666741624e-11
KLTH0A02882g8.61ON4732751614e-11
KNAG0F008602.15ON626661614e-11
KLLA0E04423g7.217ON428911605e-11
Smik_14.1062.15ON593661615e-11
NCAS0E029307.217ON387721595e-11
NDAI0A028207.157ON482721596e-11
AFR507W8.61ON474721596e-11
KLLA0D13464g7.157ON433721596e-11
NCAS0G036101.398ON327721577e-11
KLTH0F13398g7.157ON419721587e-11
KNAG0L013307.217ON396721587e-11
NCAS0A132107.157ON414721588e-11
TBLA0A011007.157ON434721589e-11
Suva_6.1481.297ON642691599e-11
Suva_8.3038.698ON664741599e-11
Skud_13.3232.350ON224711529e-11
Suva_9.2137.157ON431721571e-10
Kwal_23.44202.15ON592681581e-10
SAKL0F04444g7.157ON429721561e-10
KAFR0L007407.217ON364721551e-10
ZYRO0F15400g2.15ON525711561e-10
KAFR0B047807.157ON423721552e-10
CAGL0J01936g7.157ON425691552e-10
YFL016C (MDJ1)8.61ON5113051562e-10
NCAS0C048901.398ON367721542e-10
Ecym_56262.350ON243701502e-10
CAGL0J04224g8.61ON5222251542e-10
CAGL0J02750g7.217ON382721533e-10
TPHA0O019402.15ON598661553e-10
NDAI0F038002.15ON638681543e-10
YJL073W (JEM1)1.297ON645691543e-10
KLLA0D07656g8.61ON4712941543e-10
Kwal_47.181337.217ON393721523e-10
Skud_15.4208.698ON665741534e-10
Suva_13.3402.350ON225711475e-10
Ecym_44697.157ON433721515e-10
KNAG0I008602.350ON219721465e-10
YOR254C (SEC63)8.698ON663741525e-10
NCAS0G013602.15ON616681525e-10
Kpol_529.212.15ON622691526e-10
ADR015W7.157ON436721516e-10
KAFR0A079502.15ON551661517e-10
SAKL0D06226g1.297ON615691517e-10
NDAI0E045607.217ON394721498e-10
Kwal_23.3578singletonOFF85631368e-10
TBLA0G001702.15ON659661518e-10
Kpol_1072.48.698ON661721509e-10
TBLA0E024907.217ON366711481e-09
Skud_10.1691.297ON644691491e-09
KLLA0E01629g2.350ON231711441e-09
CAGL0G07469g8.698ON668741491e-09
KLTH0F09944g2.350ON233701441e-09
Kpol_1070.227.217ON380721472e-09
ADR124C1.297ON6111021482e-09
Skud_6.568.61ON5172881472e-09
KLTH0A03740g7.217ON395721462e-09
AFL190C2.350ON235701422e-09
TDEL0G028002.350ON225701422e-09
TBLA0B037308.698ON693741472e-09
CAGL0L00957g7.217ON373721453e-09
Suva_5.1507.217ON391721453e-09
Skud_5.1587.217ON391721453e-09
Kpol_499.307.157ON408721453e-09
KAFR0A016201.297ON665941454e-09
SAKL0E06050g2.350ON232711395e-09
Smik_5.1737.217ON391721435e-09
NCAS0C012208.698ON669721445e-09
SAKL0E14234g2.15ON678681446e-09
KNAG0B052401.297ON668681446e-09
TBLA0D042407.217ON389711426e-09
YER048C (CAJ1)7.217ON391721426e-09
TPHA0G014808.698ON660721436e-09
TDEL0C008708.61ON4702281437e-09
KLTH0D11770g8.698ON652741437e-09
KLLA0C02981g1.113ON162681348e-09
SAKL0F08052g7.217ON393721401e-08
KLLA0C09823g8.698ON669721411e-08
NCAS0D009602.350ON224701361e-08
TDEL0E005002.15ON581661411e-08
CAGL0H04499g2.350ON232701361e-08
KAFR0H023108.698ON655741402e-08
SAKL0H00858g5.4ON432951392e-08
TBLA0B093802.350ON227701342e-08
TBLA0D026008.61ON5102201382e-08
Kwal_26.88798.698ON656741383e-08
ZYRO0A07502g2.350ON238701343e-08
SAKL0B02068g8.61ON5102221383e-08
ZYRO0D10934g8.698ON663741383e-08
Kwal_14.24521.297ON607681383e-08
TPHA0I011101.297ON666681374e-08
TDEL0C036801.185ON556691364e-08
Kpol_526.62.350ON228711315e-08
SAKL0H05984g8.698ON658741365e-08
YJL162C (JJJ2)1.185ON583691365e-08
TBLA0C027201.297ON715691365e-08
NDAI0H031802.350ON229701315e-08
Ecym_63181.297ON624721349e-08
TPHA0C045902.350ON233701291e-07
Suva_12.1851.113ON168661251e-07
Skud_10.521.185ON559691322e-07
NCAS0A093201.297ON635691322e-07
Kwal_26.94955.4ON428721312e-07
SAKL0C05456g1.185ON583691312e-07
Smik_10.681.185ON560691312e-07
KLTH0H10032g1.297ON607681303e-07
Kpol_1027.131.297ON641681303e-07
TPHA0A028101.185ON492701293e-07
Kpol_1060.35.4ON432951293e-07
ZYRO0G21230g1.297ON584691293e-07
TBLA0A057401.113ON170761224e-07
KLTH0B09570g5.4ON428951284e-07
SAKL0B01276gna 1ON292721264e-07
AAL103W8.698ON669721285e-07
ZYRO0G18436g1.185ON503691275e-07
KAFR0B048902.350ON220701236e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05030
         (433 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    870   0.0  
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    546   0.0  
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   439   e-152
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   437   e-151
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   384   e-130
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   384   e-130
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   379   e-128
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   368   e-124
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   363   e-122
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   350   e-117
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   347   e-116
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   338   e-111
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   319   e-105
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   319   e-104
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   312   e-102
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   310   e-101
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   307   e-100
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   270   8e-86
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   193   2e-56
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   192   4e-56
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   191   1e-55
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   191   1e-55
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   189   3e-55
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   188   2e-54
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   187   2e-54
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   187   3e-54
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   185   2e-53
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   184   5e-53
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   184   5e-53
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   183   8e-53
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   182   2e-52
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   182   2e-52
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   182   3e-52
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   180   1e-51
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   179   5e-51
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   177   2e-50
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   174   2e-49
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   169   1e-47
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   165   2e-45
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   164   5e-45
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   162   1e-44
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   159   3e-43
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   153   6e-41
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   140   4e-37
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   140   2e-36
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   138   2e-36
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   138   4e-36
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    139   7e-36
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   137   4e-35
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   134   2e-34
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   134   2e-34
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   132   5e-34
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   132   7e-34
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   130   2e-33
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   130   3e-33
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   130   3e-33
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   129   5e-33
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   129   9e-33
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      127   2e-32
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   127   2e-32
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   129   3e-32
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   126   5e-32
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   125   1e-31
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   126   4e-31
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   124   5e-31
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   122   2e-30
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   122   6e-30
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   120   8e-30
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   112   7e-27
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   110   4e-26
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...   110   2e-25
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   108   5e-25
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...   108   9e-25
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   107   1e-24
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...   102   5e-23
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   101   2e-22
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    96   1e-20
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    92   2e-19
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    85   6e-17
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    84   8e-17
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    82   3e-16
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    80   1e-15
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    80   1e-15
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    80   2e-15
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    80   2e-15
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    77   2e-14
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    76   2e-14
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               75   4e-14
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    72   3e-13
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    72   4e-13
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    72   4e-13
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    71   1e-12
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    71   1e-12
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    70   2e-12
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    70   2e-12
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    70   3e-12
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    70   3e-12
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    70   3e-12
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    69   3e-12
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    70   3e-12
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    70   4e-12
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    69   5e-12
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    69   6e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    69   6e-12
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    69   6e-12
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    69   7e-12
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    69   7e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    68   1e-11
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    66   1e-11
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    69   1e-11
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    68   1e-11
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    68   1e-11
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    67   2e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    68   2e-11
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    67   2e-11
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    68   2e-11
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    67   2e-11
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    67   2e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    67   3e-11
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    67   3e-11
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    67   3e-11
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    67   3e-11
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    67   3e-11
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    67   3e-11
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    67   3e-11
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    66   3e-11
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    67   3e-11
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    67   3e-11
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    67   3e-11
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    66   3e-11
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    67   4e-11
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    64   4e-11
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    67   4e-11
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    67   4e-11
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    67   4e-11
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    67   4e-11
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    67   4e-11
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    66   5e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    67   5e-11
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     66   5e-11
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    66   6e-11
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    66   6e-11
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    66   6e-11
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      65   7e-11
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    65   7e-11
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    65   7e-11
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    65   8e-11
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    65   9e-11
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    66   9e-11
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    66   9e-11
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    63   9e-11
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    65   1e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    65   1e-10
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    65   1e-10
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    64   1e-10
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    65   1e-10
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               64   2e-10
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    64   2e-10
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    65   2e-10
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     64   2e-10
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    62   2e-10
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    64   2e-10
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    64   3e-10
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    64   3e-10
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      64   3e-10
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    64   3e-10
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    64   3e-10
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    63   3e-10
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    64   4e-10
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    61   5e-10
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    63   5e-10
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    61   5e-10
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    63   5e-10
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    63   5e-10
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    63   6e-10
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    63   6e-10
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    63   7e-10
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    63   7e-10
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             62   8e-10
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    57   8e-10
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    63   8e-10
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    62   9e-10
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    62   1e-09
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    62   1e-09
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    60   1e-09
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    62   1e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    60   1e-09
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    61   2e-09
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    62   2e-09
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    61   2e-09
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    61   2e-09
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    59   2e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    59   2e-09
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    61   2e-09
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    60   3e-09
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    60   3e-09
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    60   3e-09
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    60   3e-09
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    60   4e-09
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    58   5e-09
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    60   5e-09
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     60   5e-09
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    60   6e-09
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    60   6e-09
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    59   6e-09
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    59   6e-09
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    60   6e-09
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    60   7e-09
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    60   7e-09
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    56   8e-09
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    59   1e-08
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    59   1e-08
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    57   1e-08
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    59   1e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    57   1e-08
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    59   2e-08
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    58   2e-08
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    56   2e-08
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    58   2e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    58   3e-08
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    56   3e-08
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    58   3e-08
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    58   3e-08
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    58   3e-08
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    57   4e-08
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    57   4e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    55   5e-08
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    57   5e-08
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    57   5e-08
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    57   5e-08
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      55   5e-08
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    56   9e-08
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    54   1e-07
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    53   1e-07
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    55   2e-07
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    55   2e-07
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    55   2e-07
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    55   2e-07
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    55   2e-07
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    55   3e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    55   3e-07
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    54   3e-07
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    54   3e-07
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    54   3e-07
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    52   4e-07
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    54   4e-07
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    53   4e-07
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    54   5e-07
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    54   5e-07
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    52   6e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    54   7e-07
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    53   8e-07
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    53   8e-07
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    53   1e-06
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    53   1e-06
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    52   2e-06
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    49   2e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    52   2e-06
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    49   2e-06
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    51   3e-06
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    52   3e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    51   3e-06
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    51   4e-06
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    50   4e-06
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    51   4e-06
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    49   4e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    49   4e-06
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    50   5e-06
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    50   6e-06
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    48   6e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    50   6e-06
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    48   7e-06
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    50   8e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    50   9e-06
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    50   9e-06
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    50   9e-06
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    47   9e-06
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    49   1e-05
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    47   1e-05
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    49   1e-05
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    49   2e-05
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    49   2e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    49   2e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    48   2e-05
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    48   2e-05
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    48   3e-05
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    47   4e-05
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    46   4e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    47   4e-05
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    47   5e-05
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    47   5e-05
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    47   5e-05
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    47   6e-05
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    46   7e-05
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    45   7e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    46   8e-05
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    46   1e-04
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    45   1e-04
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    44   1e-04
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    45   2e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       45   2e-04
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    45   2e-04
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    44   2e-04
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    43   3e-04
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    43   3e-04
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    44   3e-04
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    44   4e-04
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    42   5e-04
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    43   6e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    43   8e-04
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    42   0.001
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    42   0.001
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    42   0.002
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    42   0.002
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    42   0.002
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    41   0.004
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    40   0.005
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         40   0.006
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    40   0.008
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    40   0.008
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    39   0.009
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.010
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    40   0.011
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    39   0.011
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    39   0.015
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    38   0.016
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    38   0.017
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    38   0.039
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    38   0.041
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    37   0.064
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    37   0.093
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    36   0.11 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    36   0.11 
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    36   0.18 
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    35   0.19 
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    35   0.24 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    35   0.25 
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    34   0.45 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    34   0.48 
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    35   0.61 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    34   0.75 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    34   0.75 
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    34   0.75 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    33   0.85 
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    33   0.88 
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    33   0.94 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    33   1.5  
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    33   1.5  
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    32   1.7  
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    32   1.8  
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    32   1.8  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    32   2.4  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    32   2.6  
ZYRO0G09988g Chr7 complement(796338..796919) [582 bp, 193 aa] {O...    32   3.0  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    31   3.0  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    31   3.0  
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    32   3.0  
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    31   3.1  
AGR260W Chr7 (1230184..1232379) [2196 bp, 731 aa] {ON} Syntenic ...    32   3.4  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    32   3.5  
TDEL0F02440 Chr6 (455229..455807) [579 bp, 192 aa] {ON} Anc_4.10...    31   3.7  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    31   4.5  
KLTH0E07612g Chr5 complement(696467..697027) [561 bp, 186 aa] {O...    31   4.6  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    31   4.7  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    31   5.8  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    31   6.1  
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    30   6.3  
CAGL0A00297g Chr1 complement(30179..30775) [597 bp, 198 aa] {ON}...    30   7.0  
KAFR0F00230 Chr6 complement(58626..61637) [3012 bp, 1003 aa] {ON...    31   7.0  
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    30   9.1  
TPHA0D01600 Chr4 complement(334057..335109) [1053 bp, 350 aa] {O...    30   9.6  

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/433 (97%), Positives = 423/433 (97%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL
Sbjct: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60

Query: 61  SDEDKRAHYDLYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMT 120
           SDEDKRAHYDLYGS          YDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMT
Sbjct: 61  SDEDKRAHYDLYGSEEEQQRQQRQYDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMT 120

Query: 121 IQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLA 180
           IQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLA
Sbjct: 121 IQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLA 180

Query: 181 PGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTI 240
           PGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTI
Sbjct: 181 PGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTI 240

Query: 241 KVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKF 300
           KVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKF
Sbjct: 241 KVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKF 300

Query: 301 VTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFT 360
           VTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFT
Sbjct: 301 VTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFT 360

Query: 361 EKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAESHG 420
           EKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAESHG
Sbjct: 361 EKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAESHG 420

Query: 421 EYRGEGSPQCAQQ 433
           EYRGEGSPQCAQQ
Sbjct: 421 EYRGEGSPQCAQQ 433

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/439 (61%), Positives = 334/439 (76%), Gaps = 12/439 (2%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           M DLY++LGV S+ATDS+IKKAYRKLALQ+HPDKV++ N  DRE +EIKFKEI++AYEIL
Sbjct: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPN--DREENEIKFKEITSAYEIL 58

Query: 61  SDEDKRAHYDLYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYE-DPKRSPDVKIPLKM 119
           SDE+KRAHYDLYG            +    FFNFE D+     Y  D  +S DVKIPLK+
Sbjct: 59  SDEEKRAHYDLYGDANENEYNNQNAN---DFFNFETDQPDYDSYAFDNDKSKDVKIPLKL 115

Query: 120 TIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRML 179
           +IQELYNGKTFKF+ KRN+IC  CEGLGWRRRKNG VT+P E+ECK C G G+ E+ RML
Sbjct: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175

Query: 180 APGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDT 239
            PGF T +K +C+ C GKG+ YAK NSEKNKCK CHG+GL +E+K L VSVPRGL++ DT
Sbjct: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235

Query: 240 IKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDK 299
           I++ NEADQE+GK KTGD+I  IEED   P DV   RKG++F+  L++SLAEALTGFKDK
Sbjct: 236 IRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKDK 295

Query: 300 FVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWF 359
           F++K+ DGRIL LS+P GKVIRPGNIIKI+QEGWP+N +A+KFGDLY+ + IEFPPDNWF
Sbjct: 296 FLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNWF 355

Query: 360 TEKSDLTQIKNILPRSTS---DKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQG--EN 414
           +EKSD+  ++N+LP   +   +  K+ DDPLNTE +  F++LE LPDTL E  ++   + 
Sbjct: 356 SEKSDIQLLRNVLPSGINGMMNSWKI-DDPLNTETVTTFDILEELPDTLNESNNRSAYDT 414

Query: 415 NAESHGEYRGEGSPQCAQQ 433
             +S   Y  EG PQC+QQ
Sbjct: 415 GDQSDANYDREGPPQCSQQ 433

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  439 bits (1128), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/412 (54%), Positives = 287/412 (69%), Gaps = 16/412 (3%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           M+ LY +LGV  +AT  +IKKAYRK ALQHHPDKV + +   RE SE++FKEI+AAYE+L
Sbjct: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESL--REESEVRFKEIAAAYEVL 58

Query: 61  SDEDKRAHYDLYGSXXXXXXXXXXYDPFE--SFFNF-----EQDEEPSRHYEDPK--RSP 111
            DE+KRA YD YG            + FE  +F NF        +    HY + K  RS 
Sbjct: 59  GDEEKRARYDKYGDADGSDFFNGPNE-FEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSA 117

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           DV++PL +++ + YNGK+FKF+ KR ++CD C G GWRRR N  V  PP+VECK C GQG
Sbjct: 118 DVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGGQG 176

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
           F +++R LAPGFAT E   C  CDGKGK  +K N++KNKCKKC G G+  ESK LTVS+P
Sbjct: 177 FKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLP 236

Query: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
           RG R  D I +  EADQE+GK +TG+L+F+I+E   CP+ V L+R G + +T L +SLAE
Sbjct: 237 RGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAE 296

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           A+TGF  K +TKT DGRIL L IPPGKVIRPGNII+I  EGWP+  + T  GDLY+ V+I
Sbjct: 297 AITGFS-KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYVVVHI 353

Query: 352 EFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPD 403
           EFPPDNWF+E+SDLTQ+KN+LP  T++   + DDP NTE +    ++E +PD
Sbjct: 354 EFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEIPD 405

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  437 bits (1125), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 292/442 (66%), Gaps = 24/442 (5%)

Query: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           LY  LGV+ +AT  +IKKAYRKLALQHHPDKV + +   RE SE++FKEI+AAYE+LSDE
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSV--REESEVRFKEITAAYEVLSDE 60

Query: 64  DKRAHYDLYGSXXXXXXXXXXYDPFESFFNF----------EQDEEPSRHYEDP--KRSP 111
           +KR+ YD YG               ESF NF                      P   RS 
Sbjct: 61  EKRSKYDTYGDTADGPDFED-----ESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSD 115

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           DV++PLK+++ + YNGK FKF+ KR ++C+ CEG GWRRR  G    PP+  CK C+G+G
Sbjct: 116 DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGP---PPQTNCKSCQGRG 172

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
           + E++R +APG   ++   C  C GKGK+ +K  SEKN+CKKC G+G+  E+K LTVS+P
Sbjct: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232

Query: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
           RG R GD I    EADQE+GK KTGDLIF ++E    P+ V+LER+G + +T ++ISLAE
Sbjct: 233 RGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAE 292

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           A+TG  D+ +TKT DGR+L LS P GKVI PG IIK+EQEGWPLN  ATKFGDLY+ V+I
Sbjct: 293 AITGL-DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDI 351

Query: 352 EFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQ 411
            FP DNWF EKSDL +I+NILP S +    +  DP NTE +   ++++ LPD +    DQ
Sbjct: 352 VFPRDNWFAEKSDLLKIRNILP-SEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQ 410

Query: 412 GENNAESHGEYRGEGSPQCAQQ 433
             +   + G +  +G+PQCAQQ
Sbjct: 411 YAHEGHASGAFPDDGTPQCAQQ 432

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  384 bits (987), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/449 (46%), Positives = 284/449 (63%), Gaps = 38/449 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREAS---EIKFKEISAAYEI 59
           DLYA+L V    T  ++KK YRKLAL++HPDKV  ++ D+ +     E+KFKEI +AYEI
Sbjct: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70

Query: 60  LSDEDKRAHYDLYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPLKM 119
           LSDE+KR  YDL  +           D   + F               + S D+ IPLK+
Sbjct: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFG-------------NQTSKDISIPLKV 117

Query: 120 TIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRML 179
           TI++LYNGK  ++  KRNVIC+ C GLGWR RKNG+  VPP  ECK C G G+ +  + +
Sbjct: 118 TIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQI 177

Query: 180 APGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDT 239
           APGF T++   CK CDGKG++Y K  S KN C KC+G+G+   S+ +TV++PRG  D DT
Sbjct: 178 APGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDT 237

Query: 240 IKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGS-NFMTELNISLAEALTGFKD 298
           I + N+ADQELGK KTGDLIF +EE     +   L+R G  + +TEL ISLA+A+TGFK+
Sbjct: 238 IIIDNKADQELGKFKTGDLIFVLEEID--DEQTALKRYGDKDLITELTISLADAITGFKE 295

Query: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNW 358
           K + KT DGR+L LSIP GKVIR G+I+K+E EGWPLN  AT+ GDLYI  NIEFP DNW
Sbjct: 296 KPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNW 355

Query: 359 FTEKSDLTQIKNILPRSTSDKTK-LSDDP--------LNTELLLKFEVLETLPDTLKEGQ 409
            +E +D+ +I+N+LP  +  K   L D P        +N+E +  ++ ++ LPD +    
Sbjct: 356 NSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDII---- 411

Query: 410 DQGENNAESHGEYRGEGS-----PQCAQQ 433
           D   NN   +G + G+ +     P+C+QQ
Sbjct: 412 DTSHNNGAEYG-HNGDSANFTEMPECSQQ 439

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  384 bits (986), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/450 (47%), Positives = 287/450 (63%), Gaps = 32/450 (7%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           MT LY VLGVA +A+ ++IKKAYRKLALQHHPDKV +     RE SE+KFKEI+AAYEIL
Sbjct: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVL--REESEMKFKEITAAYEIL 58

Query: 61  SDEDKRAHYDLYGSXX-XXXXXXXXYDPFESFFNFEQDEEPSRHYEDPK----------- 108
           SDED R  YD+YG                + F NF +       Y++P+           
Sbjct: 59  SDEDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSV 118

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R+ D +IPLK++++ELYNGKTFKF+ KRNV+CD C+G G R++       P  V C+ C+
Sbjct: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP--VVCQSCE 176

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           G G  E+++ +A GF  RE  KC++C+GKG+        ++ CKKCHG+ + +E K LTV
Sbjct: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTV 234

Query: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNIS 288
            +PRG R+GD +K+  EADQE  K  TGDL+F IEE+        LER+G +  T L IS
Sbjct: 235 YIPRGSRNGDIVKLEGEADQEPDK-VTGDLLFVIEENPET--STNLERRGDDLHTRLKIS 291

Query: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYIS 348
           L+EA+TGF +K VT T D RIL L IP GKVIRPGN I++E EGWPL+    KFGD+Y+ 
Sbjct: 292 LSEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQ 350

Query: 349 VNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLET---LPDTL 405
           V+IEFPPDNWF+EKSD+  ++ +LP   + +   + D  NTE ++ + V+++   LPD L
Sbjct: 351 VHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYL 410

Query: 406 --KEGQDQGENNAESHGEYRGEGSPQCAQQ 433
             ++G+ QG+       EY     PQCAQQ
Sbjct: 411 SYEKGEYQGQEQ-----EYGAFEEPQCAQQ 435

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  379 bits (972), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 270/431 (62%), Gaps = 30/431 (6%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGVA +AT  +IKK YRKLALQ+HPDK ++     +  +EIKFK+I+AAY+ LSD
Sbjct: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQ--KLINEIKFKDITAAYQTLSD 69

Query: 63  EDKRAHYDLYGSXXXXXXXXXXYDP-FESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMTI 121
           EDKR  YD              ++P FES F    D   +  Y    RS D+K+ L +  
Sbjct: 70  EDKRNEYD----------NKKNFEPYFESDFANNHDGNYNSRYR--SRSKDIKVELSLKT 117

Query: 122 QELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAP 181
            ELYNGKT KF   RN IC  C GLGWR +K+G+  VPPE+EC+ C GQG+      LAP
Sbjct: 118 SELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAP 177

Query: 182 GFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIK 241
           GF T +   C  C G GK+Y K NS KN CK C+G+ L      + VS+PRG  +GD I 
Sbjct: 178 GFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNII 237

Query: 242 VVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFV 301
           +  EAD+ELGK   GDLIF I E      D  LER G++ +   +ISLAEA+TGF++KF+
Sbjct: 238 LKGEADEELGKKNAGDLIFEINEIIDSNND--LERYGNHLINHTHISLAEAITGFENKFI 295

Query: 302 TKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFTE 361
            KTFD R L LS P GKVIRPG+I++++ EGWP++     FG+LY+ + IEFPPDNW  E
Sbjct: 296 VKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINE 355

Query: 362 KSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAESHGE 421
           K+D+ +I+NILP   + +  +  DP+N+E +  FE++++LP   +EG++Q E++      
Sbjct: 356 KNDIIKIRNILPNEKTKRNNIV-DPINSEYISTFEIVKSLPQ--EEGEEQTEHDT----- 407

Query: 422 YRGEGSPQCAQ 432
                +P CAQ
Sbjct: 408 -----NPSCAQ 413

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  368 bits (945), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 202/446 (45%), Positives = 277/446 (62%), Gaps = 48/446 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGVA +AT  +IKKAYR+LALQHHPDKV  S+   R+ SEIKFKE++AAYE+LS+
Sbjct: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKV--SDESLRDESEIKFKEVAAAYELLSN 59

Query: 63  EDKRAHYDLYGSXXXXXXXXXXYDP--FESFF-----NFEQDEEPSRHYEDPKRSPDVKI 115
           E+KR +YD YG           +    F SFF     N  QDE  ++    P R+ D  +
Sbjct: 60  EEKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP-RTDDAHV 118

Query: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175
           P+++T+QELYNGKT +F+ KRNV+C+ CEG G RRR            C  C+G G  ++
Sbjct: 119 PIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASA------CSQCEGHGVKQR 172

Query: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235
           +R L PGF TRE  +C +C G GK+       ++ CKKCHG+ +  ESK L V +PRG R
Sbjct: 173 LRRLGPGFVTREIVQCDKCKGLGKNL----RSEDMCKKCHGKRVTPESKNLNVYIPRGSR 228

Query: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295
            GD + +  EAD+E GK   GDL+F I E+        LER+GS+   ++ ISL++ALTG
Sbjct: 229 HGDRVVLKGEADEEPGK-IPGDLVFDIAENS---ASSSLERRGSDLYAKITISLSDALTG 284

Query: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355
           F +K V  T DGR+L L +P G+V+RPGN ++I+ EGWPL+ + +KFGD+Y+ ++IEFPP
Sbjct: 285 F-EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPP 343

Query: 356 DNWFTEKSDLTQIKNILPR-----STSDKTKLSDDPLNTELLLKFEVL---ETLPDTLKE 407
           D+WF+E+SD+  ++N+LP+     +TSD    + DP NTE  LKF ++   E LP  L E
Sbjct: 344 DHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSE 403

Query: 408 GQDQGENNAESHGEYRGEGSPQCAQQ 433
             + G               PQCAQQ
Sbjct: 404 ESEPG---------------PQCAQQ 414

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  363 bits (932), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/441 (46%), Positives = 279/441 (63%), Gaps = 40/441 (9%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           DLY+VLG+ SNAT+ ++K+AYR LAL +HPDK+  S+   R  SE KFKEISAAY+ILSD
Sbjct: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI--SDESQRAESEAKFKEISAAYDILSD 61

Query: 63  EDKRAHYDLYGSXXXXXXXXXXYDP--------FESFFNFEQDEEPSRHYEDP-----KR 109
           E KR+ YD YG           +D         F +FF +         YED      ++
Sbjct: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYG--QYEDAEQKTSQK 119

Query: 110 SPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKG 169
           + D  +PLK++ ++LY GKTF+FK KRNV+C  CEGLG R+R      +P  ++C +C G
Sbjct: 120 TKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR--AAHCMP--MKCGICDG 175

Query: 170 QGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229
           +GF E+V  ++PGF +RE+  C +CDGKG   ++  S+   CKKCHG+ +  E+ +LT+ 
Sbjct: 176 RGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLY 233

Query: 230 VPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
           VPRG R  DTI++  +AD E GK +TGDL+F I  D+    D +LERKG++    + ISL
Sbjct: 234 VPRGHRHADTIRIDGQADMEAGK-ETGDLVFEI--DEITDPDAELERKGTDLHCSITISL 290

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
           AEALTGF  + V +TFD R+L ++IP GKV+RPGN +K   EGWP+N   ++FGDLY+ V
Sbjct: 291 AEALTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVKV 348

Query: 350 NIEFPPDNWFTEKSDLTQIKNILP---RSTSDKTKLSDDPLNTELLLKFEVLE---TLPD 403
           NIEFP DNW  EKS+L  IK+ILP    S++      DDP NTE +  + V++    LPD
Sbjct: 349 NIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPD 408

Query: 404 TL-KEGQDQ-----GENNAES 418
            L +EGQ +     GE N  S
Sbjct: 409 YLAQEGQQRSNQQYGERNTAS 429

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/442 (42%), Positives = 272/442 (61%), Gaps = 29/442 (6%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           DLY VLG+AS+A++ ++K+AYR+LAL++HPDK+  S+  +REASE KFKEISAAY +LSD
Sbjct: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREASEAKFKEISAAYAVLSD 61

Query: 63  EDKRAHYDLYGSXXXXXXXXXXY---DPFESFFNFEQDEEPSRH----YEDPKRSPDVKI 115
           E KRA YD +G+              D F +FF +       +H    +E+  R+ D  +
Sbjct: 62  EQKRAEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGRTADSTV 121

Query: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175
           PLK+T ++LY GKTF+FK +R V+C  C G G R+R   +    P + C+ C+GQG+ E+
Sbjct: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAAR----PMIRCEGCEGQGYKER 177

Query: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235
           +  + PG  +RE+  C  C GKGK      +  + CKKC G+ +  E  +++V VPRG +
Sbjct: 178 ISRIGPGLISRERVSCADCGGKGKRIP--TTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235

Query: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295
            GD ++   ++D E GK +TGDL+F I  D++      LERKG++    + ISLAEALTG
Sbjct: 236 HGDRLRYPGQSDMEPGK-ETGDLVFVI--DEQTDVSSSLERKGTDLYCTMKISLAEALTG 292

Query: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355
           F  + VT+TFD R+L ++IP GKV+RPGN +K   EGWP+  +  +FGD+Y+ V IEFP 
Sbjct: 293 FT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIE-DGARFGDMYVQVLIEFPK 350

Query: 356 DNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLET---LPDTL-KEGQDQ 411
           DNWF EK++L  I+NILP      +  ++DP NTE +  + ++     LPD L +E Q  
Sbjct: 351 DNWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGY 410

Query: 412 GENNAESHGEYRGEGSPQCAQQ 433
                ES       G+P+C  Q
Sbjct: 411 SRQQHESTA-----GTPECPMQ 427

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  347 bits (890), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/446 (45%), Positives = 276/446 (61%), Gaps = 48/446 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGVA +AT  +IKKAYR+LALQHHPDKV  S+   RE SEIKFKE++AAYE+LS+
Sbjct: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKV--SDESLREESEIKFKEVAAAYELLSN 59

Query: 63  EDKRAHYDLYGSXXXXXXXXXXYDP--FESFF-NFE----QDEEPSRHYEDPKRSPDVKI 115
           E+KR +YD YG           +    F SFF NF     +DEE  R +  P R+ D  +
Sbjct: 60  EEKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARP-RTDDAHV 118

Query: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175
            L++T+Q+LYNGKT +F+  RNV+C+ CEG G R+R            C  C+G G  ++
Sbjct: 119 SLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASA------CTHCEGHGVKQR 172

Query: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235
           +R L PGF TRE  +C +C G GK+       ++ CKKCHG+ +  E+K L V +PRG R
Sbjct: 173 LRRLGPGFVTRETVQCTKCRGLGKNL----RSEDLCKKCHGKRVTPETKNLNVYIPRGSR 228

Query: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295
             D I +  EAD+E GK  TGDL+F I ED        LER+GS+  T++ ISL++ALTG
Sbjct: 229 HNDRIVLEGEADEEPGK-LTGDLVFDISEDSTTS---NLERRGSDLHTKIIISLSDALTG 284

Query: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355
           F +K V  T DGR L L IP G+VIRPGN I ++ EGWPL+ E  KFG++Y+ +NIEFPP
Sbjct: 285 F-EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPP 343

Query: 356 DNWFTEKSDLTQIKNILPRSTSDKTKLSD-----DPLNTELLLKFEVL---ETLPDTLKE 407
           D+W++E+ ++  ++NI+P+STS     S      DP+NTE +  F++L   E LP+ L +
Sbjct: 344 DHWYSERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTE-MPTFDILKSAEELPNYLPD 402

Query: 408 GQDQGENNAESHGEYRGEGSPQCAQQ 433
             +Q              G PQC+QQ
Sbjct: 403 DAEQ--------------GGPQCSQQ 414

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  338 bits (867), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/423 (44%), Positives = 259/423 (61%), Gaps = 36/423 (8%)

Query: 5   YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
           Y VLGV  +AT+ +I+KAYRKLAL++HPDK+++    +RE SE  FKE++AAYEILSD +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEA--ERETSEAMFKEVTAAYEILSDPE 131

Query: 65  KRAHYDLYGSXXXXX------XXXXXYDPFESFFNFEQDEEPSRH--------YEDP--K 108
            ++ YD+YG                 +D F +FF   Q ++   H        Y +P  K
Sbjct: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESK 191

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R+PD +I  KMT ++LY GKT  F+ KR  +C +C G G R++   +    PE+ C  C 
Sbjct: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQK----PEISCTSCN 247

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           GQGF E++  LA G+  ++   C  C GKG++  K+ S+   CK C G+GL  E K  TV
Sbjct: 248 GQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDT--CKHCSGKGLINEEKSQTV 305

Query: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNIS 288
            +PRG R GD  ++   AD E GK +TGD+I  I+ED        LERK ++  T LNIS
Sbjct: 306 YIPRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDS---SKSHLERKSNDLHTTLNIS 361

Query: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPL-NGEATKFGDLYI 347
           L +ALTGF    V +T+D R L +++P GKVIRPGN  K + EGWPL NG++  FGD+Y+
Sbjct: 362 LVDALTGFS-TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDS--FGDMYV 418

Query: 348 SVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLET---LPDT 404
            +NIEFP DNWF EKS++T ++NILP   S  TK   DPLNTE +L + VL +   LPD 
Sbjct: 419 QINIEFPKDNWFNEKSEITALRNILPGLKSKDTK-DPDPLNTEDVLSYSVLHSHDELPDY 477

Query: 405 LKE 407
           L E
Sbjct: 478 LAE 480

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  319 bits (817), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 261/426 (61%), Gaps = 11/426 (2%)

Query: 5   YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
           Y +LGV  ++TD +I+KAYRKLAL+ HPDKV++   +++ ++E+KFKEI+ AYEILS+ +
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDP--EEKASNEMKFKEITTAYEILSNGE 64

Query: 65  KRAHYDLYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHY---EDPKRSPDVKIPLKMTI 121
                +               D F +FFN  ++  P   +   ED   +   +I +++T+
Sbjct: 65  YVEEMEEEYEGQGYGFNFG--DDFMNFFNEGRNAHPMGGHPQREDESTNEATQIEIEVTL 122

Query: 122 QELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAP 181
           ++LYNGK  KF+  RNVIC  C+G  WRRRKNG +  PP + C  CKG G+ E++   +P
Sbjct: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSP 182

Query: 182 GFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIK 241
            F   ++  C++C GKG++ AK  S+KNKCK CHGEGL  E + L V++PRG  + +TI 
Sbjct: 183 FFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTII 242

Query: 242 VVNEADQELGKPKTGDLIFSI---EEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKD 298
              + D++L   + GD++F +   +E      D+ + ++G++    + I L EA++G + 
Sbjct: 243 FKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQG 302

Query: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNW 358
           +F+TKTFD R+L L++P GKV+RPG+ I I+ EGWP     T+FGD+++ VN+EFPPDNW
Sbjct: 303 RFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNW 362

Query: 359 FTEKSDLTQIKNILPRSTSDKTKL-SDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAE 417
            +E++D+T + N+LP   SD     + D  N E +  +E+L+   +  +    +  +   
Sbjct: 363 ISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASRPP 422

Query: 418 SHGEYR 423
           + G Y+
Sbjct: 423 AQGLYK 428

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  319 bits (817), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/446 (41%), Positives = 267/446 (59%), Gaps = 38/446 (8%)

Query: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           LY VLGV S+A+  +IK AYRKLAL+HHPDK V+ NS  +E +EIKFKEI+AAYEILSD 
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNS--KEVNEIKFKEITAAYEILSDP 67

Query: 64  DKRAHYDLYGSXXXXXXXXXXYDPFESFF------------NFEQDEEPSRH--YEDPK- 108
           +K++HYDLYG            D F                + E ++ P  +  YE+ K 
Sbjct: 68  EKKSHYDLYGDDYGTAGSTGA-DGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKC 126

Query: 109 -RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
             S D+ I + +T+++LY GK  KF+ KR ++C  C G GW+ +K  ++ V  EVEC+ C
Sbjct: 127 KSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKK--KIHVTHEVECESC 184

Query: 168 KGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLT 227
            G+G  E+++   PG    +   C++C GKGK+  +  + KN C  C G GL ++ +++T
Sbjct: 185 GGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIIT 244

Query: 228 VSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQL------ERKGSNF 281
           V+V  G    D I +   AD+EL K   GDL F + E Q   +  Q+      E    + 
Sbjct: 245 VNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDL 304

Query: 282 MTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEAT- 340
            T   ISL+EALTGF +KF+T+TFD R+L LSI PG+VIRPG++IKI  EGWP+  +   
Sbjct: 305 YTSATISLSEALTGF-EKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRG 363

Query: 341 KFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS-----DD--PLNTELLL 393
           + GDLY+ ++IEFPPDNWF EKS+L  IK +LP S+S   + +     DD  P+N E + 
Sbjct: 364 QRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETIS 423

Query: 394 KFEV--LETLPDTLKEGQDQGENNAE 417
            F++  +E LP+ +K    + +N+A 
Sbjct: 424 NFQIINMEELPEGMKIFNSESQNSAH 449

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  312 bits (799), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/433 (43%), Positives = 260/433 (60%), Gaps = 38/433 (8%)

Query: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           LY VLGV   A+  +IK AYRKLAL+HHPDK V+   D +E +E KFKEI+AAYEILSD 
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQ--DSKELNETKFKEITAAYEILSDP 67

Query: 64  DKRAHYDLYGSXXXXXXXXXXYDPFESFFN--------FEQDEEPSRH--YE--DPKRSP 111
           +K++HYDLYG            D     F          E ++ P+ H  YE  +   S 
Sbjct: 68  EKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSK 127

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+ I L  T+++LY GK  KF+ KR +IC  C+G GW+ +K  +V V  E+EC+ C G+G
Sbjct: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKK--KVHVTHEMECESCGGKG 185

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
             E+++   PG    +   C++C GKGK+  +  + KN C  C   GL  + +V+TV+VP
Sbjct: 186 SKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVP 245

Query: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQ----LERK--GSNFM--- 282
            G    D + V   AD+E+ K   GDLIF + E    P+D+Q    L +K  G N     
Sbjct: 246 PGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEK---PEDLQQKQVLMKKFGGGNLQDLY 302

Query: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP-LNGEATK 341
             + +SL+EALTGF +KF+T+TFD R+L LSI PGKVIRPG+IIKI  EGWP L+    +
Sbjct: 303 VSITVSLSEALTGF-EKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQ 361

Query: 342 FGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS------DDPLNTELLLKF 395
            GDLY+ V+IEFPPDNWF EKS+L  IK  LP STS  +  +      + P+N+E +  F
Sbjct: 362 CGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNF 421

Query: 396 EVLET--LPDTLK 406
           +++ +  LP+ +K
Sbjct: 422 QIIHSDDLPEGMK 434

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  310 bits (795), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/449 (41%), Positives = 259/449 (57%), Gaps = 39/449 (8%)

Query: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           LY VLGV  +AT  +IK AYRKLAL+HHPDK V+ +S  +E +EIKFKEI+AAYEILSD 
Sbjct: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDS--KEVNEIKFKEITAAYEILSDP 67

Query: 64  DKRAHYDLYG--SXXXXXXXXXXYDPFESFFNFEQDEEPSRH-----------YE--DPK 108
           +K++HYDLYG  +          +   +    F        H           YE  +  
Sbjct: 68  EKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNST 127

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
            S D+ I + +T+++LY GK  KF  KR VIC  C G GW+ ++  ++ V  +VEC+ C 
Sbjct: 128 SSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKR--KIHVTHDVECESCA 185

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           G+G  E+++   PG    +   C++C+GKGK+  +  + KN C  C G GL ++ +++TV
Sbjct: 186 GKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITV 245

Query: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERK------GSNFM 282
           +V  G    D I V   AD+E+ K   GDL F + E Q   +  Q+  K      G +  
Sbjct: 246 NVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLY 305

Query: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP-LNGEATK 341
           T + ISL+EALTGF +KF+TKTFD R+L LS+ PG+V+RPG+ IKI  EGWP L+    +
Sbjct: 306 TSITISLSEALTGF-EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGR 364

Query: 342 FGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS----DDP--LNTELLLKF 395
            GDLY+ V+IEFPPDNWF EKS+L  IK  LP S+S  +  +    DD    N E +  F
Sbjct: 365 CGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNF 424

Query: 396 EVLET--LPDTLK----EGQDQGENNAES 418
            ++ T  LP+ ++    E QD     A S
Sbjct: 425 RIIHTDDLPEGIRPFKPEAQDSAHQKARS 453

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/441 (42%), Positives = 255/441 (57%), Gaps = 33/441 (7%)

Query: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           LY VLGV  +A   +IK AYRKLAL+HHPDK V+ +S D   +EIKFKEI+AAYEILSD 
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKD--VNEIKFKEITAAYEILSDP 67

Query: 64  DKRAHYDLYGSXXXXXXXXXXYDPFESFF----------------NFEQDEEPSRHYEDP 107
           +K++HYDLYG            D F +                  N   +E       D 
Sbjct: 68  EKKSHYDLYGDDNGTANGGGT-DGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDS 126

Query: 108 KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
             S D+ I + +T+++LY GK  +F  KR V+C  C G GW+ +K  +V V  EVEC+ C
Sbjct: 127 ASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK--RVHVTHEVECESC 184

Query: 168 KGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLT 227
            G+G  E+++   PG    +   C++C GKGK+     + KN C  C G GL ++ +V+T
Sbjct: 185 GGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVIT 244

Query: 228 VSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQR--CPKDVQLERKGSNFM--- 282
           V V  G    D I +   AD+E+GK   GDL F + E Q     K V L+  G   M   
Sbjct: 245 VIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDS 304

Query: 283 -TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEA-T 340
              + ISL+EALTGF +KF+TKTFD R+L LSI PG+VIRPG+++KI  EGWP+  +A  
Sbjct: 305 YVSVTISLSEALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG 363

Query: 341 KFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSD--DPLNTELLLKFEVL 398
           + GDLY+ ++IEFPPDNWF EKS+L  IK  LP S+S      D  D +N E +  F+++
Sbjct: 364 RCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQII 423

Query: 399 ET--LPDTLKEGQDQGENNAE 417
            T  LP+ +K  + + +N A 
Sbjct: 424 HTDDLPEGVKTFKPKPQNPAH 444

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  270 bits (691), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 173/468 (36%), Positives = 257/468 (54%), Gaps = 54/468 (11%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-----NSDDREASEIKFKEISAAY 57
           D Y +LGV  +A+  +IK+AYRKLAL+HHPDK   +     +SDD    ++ FKE++AAY
Sbjct: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDD--LPDVDFKEVTAAY 59

Query: 58  EILSDEDKRAHYDLYGSXXXXXXXXXXYDPFESFFN----------FEQDEEPSRHYEDP 107
           ++LSD   RA YD   +          +  F S FN          F+      R+    
Sbjct: 60  QVLSDASLRAEYDQKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGARRY---- 115

Query: 108 KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVE---- 163
            +S D++I LK+   ELY GK   F  KR   C  C+G GW+   +  +      +    
Sbjct: 116 -KSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWK--SHASIVKKKTAKFFWN 172

Query: 164 -CKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGE---GL 219
            C+ C+GQG  +++R LAPGF T E  +C+QC GKGK      SEKNKC  C      G+
Sbjct: 173 VCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGM 232

Query: 220 FAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGS 279
             E+KV+T+++ +G  DGD I +  EAD++L   + GDL+  I+E +    D+   R G 
Sbjct: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV--RNGY 290

Query: 280 NFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEA 339
           + + +  I LA+A+ GF +K + +T+DGR+L  S   GKVIRP +I++I+ EGWP   +A
Sbjct: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350

Query: 340 T------KFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS---DDPLNTE 390
                  K GDLY+ V+I FPPDNW  E +D   ++NI+P ST +K + S   +  LN E
Sbjct: 351 NDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP-STINKRESSTSGESILNVE 409

Query: 391 LLLKFEVLETLP--DTLKEGQDQGENNAESHGEYRGEG---SPQCAQQ 433
            +   E+++ +P  D L + QD  +N  +     +GE    +P C+QQ
Sbjct: 410 NINVSEIVKEIPNCDELPKFQDTYDNTND-----KGESPFWTPNCSQQ 452

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  193 bits (490), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 149/444 (33%), Positives = 218/444 (49%), Gaps = 53/444 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY  LGV+  A+D++IKKAYRK AL++HPDK     +   EA+E KFKE+S+AYEILS
Sbjct: 5   TKLYDTLGVSPGASDAEIKKAYRKSALKYHPDK-----NPSEEAAE-KFKEVSSAYEILS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY--------DPFESFFNFEQDEEPSRHYEDPKRSPDV 113
           D  KR  YD +G           +        D F  FF       P      P+R  D+
Sbjct: 59  DSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRP----RGPQRGRDI 114

Query: 114 KIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFT 173
           K  +  +++ELY G+T K    + ++C +CEG G    K G V      +C  C GQG  
Sbjct: 115 KHEMAASLEELYKGRTAKLALNKQILCKSCEGRGG---KEGAVK-----KCSSCNGQGIK 166

Query: 174 EKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRG 233
              R + P    R + +C  C G G         K++CK C+G+ +  E K+L V +  G
Sbjct: 167 FVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEPG 221

Query: 234 LRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
           ++DG  I    EADQ    P    GD++F I E          +R G + + E  I L  
Sbjct: 222 MKDGQKIVFKGEADQ---APDVIPGDVVFVISEKPH----KHFQRAGDDLIYEAEIDLLT 274

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           AL G   +F  +   G  L + I PG+VI PG    +E +G P+  +   +G+L I  NI
Sbjct: 275 ALAG--GQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQ-KYGGYGNLLIKFNI 331

Query: 352 EFPPDNWFTEKSDLTQIKNILP--RSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQ 409
           +F P+N FT + +L +++ ILP  R  +   K   D     +L +F+  +      + G 
Sbjct: 332 KF-PENHFTSEENLKKLEEILPPRRQINIPAKAQVDDC---VLSEFDPSKFGQSNGRSGA 387

Query: 410 DQGENNAESHGEYRGEGSPQCAQQ 433
           +   ++ ++HG   GEG  QCA Q
Sbjct: 388 NYDSDDEDAHG---GEGV-QCASQ 407

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  192 bits (488), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 216/447 (48%), Gaps = 57/447 (12%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY +LGV+++A D+ IKKAYRK AL++HPDK  +S + D      KFK+++AAYEILS
Sbjct: 5   TKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD------KFKQMTAAYEILS 58

Query: 62  DEDKRAHYD----------LYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRSP 111
           D  KR  YD            G            D F  FF       P      P++  
Sbjct: 59  DSQKREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRP----RGPQKGR 114

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+K  +  T++ LY G+T K    + V+C +CEG G    K+G V      +C  C G G
Sbjct: 115 DIKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGG---KSGSVK-----KCSSCGGHG 166

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
                R + P    R +  C+ C+G+G         K++C++C G+ +  E K+L V++ 
Sbjct: 167 VKFVTRQMGP-MIQRFQTTCEACNGEG----DVIDPKDRCRECSGKKISNERKILEVNIE 221

Query: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
            G+++G  +    EADQ+ G+   GD++F + E Q  PK V   R G N   E  I L  
Sbjct: 222 PGMKNGQKVVFQGEADQQPGQ-IPGDVVFVVNE-QEHPKFV---RNGDNLHYEAQIDLLT 276

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           A+ G   +F  +   G  L + I PG+VI PG +  IE +G P+    + +G+L I  N+
Sbjct: 277 AVAG--GQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLIKFNV 333

Query: 352 EFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTE----LLLKFEVLETLPDTLK- 406
           +FP  + F   +DL +++ ILP        L   PL  E    +L  FE  +  P T   
Sbjct: 334 KFPKSH-FASDADLKKLEEILPPRV-----LPGIPLKAEVEECVLADFEPSKHDPRTANG 387

Query: 407 EGQDQGENNAESHGEYRGEGSPQCAQQ 433
            GQ    +  E H E       QCA Q
Sbjct: 388 RGQSYDSDEEEGHAE-----GVQCASQ 409

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  191 bits (485), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 147/440 (33%), Positives = 217/440 (49%), Gaps = 43/440 (9%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY +LGV+  A D+ IKKAYRK AL+ HPDK     +   EA+E KFKEI++AYEILS
Sbjct: 5   TKLYDLLGVSPGADDNQIKKAYRKSALKFHPDK-----NPSEEAAE-KFKEITSAYEILS 58

Query: 62  DEDKRAHYDLYG--------SXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRSPDV 113
           D  KR  YD +G        +           D F  FF        S     P++  D+
Sbjct: 59  DSQKREVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFG-----GGSSRPRGPQKGRDI 113

Query: 114 KIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFT 173
           +  +  T+++L+ G+T K    + +IC +CEG G    K G V      +C  C GQGF 
Sbjct: 114 RHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGG---KEGSVK-----KCTACSGQGFK 165

Query: 174 EKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRG 233
              R + P    R + +C+ C G G    +    K +CK C G+ +  E KVL V++  G
Sbjct: 166 FVTRQMGP-MIQRFQVECESCHGAG----EIIDPKGRCKVCSGKKVVNERKVLEVNIEPG 220

Query: 234 LRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEAL 293
           ++DG  I    EADQ  G    GD++F + E    P  V  +R G++   +  I L  A+
Sbjct: 221 MKDGQRIVFQGEADQSPGI-IPGDVVFVVSEQ---PHPV-FKRDGNDLHYDAEIDLLSAI 275

Query: 294 TGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEF 353
            G   +F  K   G  L + I PG+VI PG++  IE +G P+  +   +G+L I  NI+F
Sbjct: 276 AG--GQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIP-KYGGYGNLLIKFNIKF 332

Query: 354 PPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQGE 413
           PP + FT+   L +++ ILP         +D  +   +L  F+  +        G+ Q  
Sbjct: 333 PPAH-FTDDETLKKLEEILPPRNVPSIP-ADAEVEDCVLADFDSSKHGARAGGNGRGQSY 390

Query: 414 NNAESHGEYRGEGSPQCAQQ 433
           ++ +  G +  EG  QCA Q
Sbjct: 391 DSDDEDGHHGAEGV-QCASQ 409

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  191 bits (484), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 195/386 (50%), Gaps = 45/386 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY VLGV+  ATD +IKKAYRK+AL+ HPDK     +   EA+E KFKE S+AYE+LS
Sbjct: 5   TKLYDVLGVSVTATDVEIKKAYRKMALKFHPDK-----NPSEEAAE-KFKEASSAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY---------DPFESFFNFEQDEEPSRHYEDPKRSPD 112
           D DKR  YD +G                     D F  FF     + P      P+R  D
Sbjct: 59  DADKRDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRP----RGPQRGRD 114

Query: 113 VKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGF 172
           +K  + +T++ELY GKT K    + ++C  CEG G ++   G V      +C  C GQG 
Sbjct: 115 IKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQGI 166

Query: 173 TEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPR 232
               R + P    R + +C  C G G         K++CK C+G+ + +E K+L V V  
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGAG----DIVDPKDRCKSCNGKKVASERKILEVHVDP 221

Query: 233 GLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
           G+++G  +    EADQ    P    GD++F I E          +R G N + E  + L 
Sbjct: 222 GMKNGQKVVFKGEADQA---PDVIPGDVVFVINEKPH----KHFQRSGDNLVYEAEVDLL 274

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G   +F  +   G  L ++I PG+VI PG    I+ +G P+  +   +G+L I   
Sbjct: 275 TAIAG--GEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPV-AKYGGYGNLIIKFT 331

Query: 351 IEFPPDNWFTEKSDLTQIKNILPRST 376
           ++F P+  FT + +L +++ ILP+ T
Sbjct: 332 VKF-PEPHFTTEENLKKLEEILPQRT 356

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  189 bits (481), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 147/443 (33%), Positives = 216/443 (48%), Gaps = 50/443 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+ NA++S+IKK YRK AL++HPDK    N  D EA+E KFKE S AYE+LS
Sbjct: 5   TKFYDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTD-EAAE-KFKECSGAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY---------DPFESFFNFEQDEEPSRHYEDPKRSPD 112
           D  KR  YD YG                     D F  FF       P      P+R  D
Sbjct: 59  DSQKREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRP----RGPQRGKD 114

Query: 113 VKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGF 172
           ++  ++ T++ELY G+T K    + ++C  CEG G    K G V      +C  C GQG 
Sbjct: 115 IRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGG---KEGAVK-----KCSSCGGQGV 166

Query: 173 TEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPR 232
               R + P    R + +C  C G G         K++CK+C G  +  E KVL V V  
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGSG----DIIDPKDRCKECKGNKVANERKVLEVHVEP 221

Query: 233 GLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
           G+R+G  +    EADQ    P    GD+IF + E          +R G + + E  + L 
Sbjct: 222 GMREGQKVTFKGEADQ---APDIIPGDVIFVVTEKPH----KHFKRSGDDLLYEAEVDLL 274

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G    F  +   G  L ++I PG+VI PG    I+ +G P+  +   +G+L I+  
Sbjct: 275 TAIAG--GDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQ-KYGGYGNLIITFK 331

Query: 351 IEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQD 410
           I+F P+N F +++ L  +++ILP  T  K       ++  +L +F+ ++   +  + GQ 
Sbjct: 332 IKF-PENHFADEAKLKALEDILPPRTEVKIPPKAH-IDDCVLTEFDPVKYGNNNNRRGQS 389

Query: 411 QGENNAESHGEYRGEGSPQCAQQ 433
              ++ + HG   GEG  QCA Q
Sbjct: 390 YDSDDEDHHG---GEGV-QCASQ 408

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  188 bits (477), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 132/383 (34%), Positives = 193/383 (50%), Gaps = 45/383 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY +LGV+  A+DS+IKKAYRK AL++HPDK     +   EA+E KFKE S+AYE+LS
Sbjct: 5   TKLYDILGVSPTASDSEIKKAYRKQALKYHPDK-----NPSEEAAE-KFKEASSAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY---------DPFESFFNFEQDEEPSRHYEDPKRSPD 112
           D +KR  YD +G                     D F  FF       P      P+R  D
Sbjct: 59  DSEKRDIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRP----RGPQRGRD 114

Query: 113 VKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGF 172
           +K  + ++++ELY GKT K    + ++C  CEG G ++   G V      +C  C GQG 
Sbjct: 115 IKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQGI 166

Query: 173 TEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPR 232
               R + P    R + +C  C G G         K++CK CHG+ +  E K+L V+V  
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDP 221

Query: 233 GLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
           G+++G  +    EADQ    P    GD+IF I E          +R G + + E  I L 
Sbjct: 222 GMKNGQKVVFKGEADQ---APDIIPGDVIFVISEKPH----KHFQRVGDDLIYEAEIDLL 274

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G   +F  +   G  L +SI PG+VI P     +E +G P+  +   +G+L I  +
Sbjct: 275 TAVAG--GEFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQ-KYGGYGNLIIKFS 331

Query: 351 IEFPPDNWFTEKSDLTQIKNILP 373
           I+F P+N F ++  L +++ ILP
Sbjct: 332 IKF-PENHFADEDTLKKLEEILP 353

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  187 bits (476), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 147/445 (33%), Positives = 215/445 (48%), Gaps = 51/445 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY ++GV+  A D+ IKKAYRK AL++HPDK     +   EA+E KFKEIS+AYEILS
Sbjct: 5   TKLYDLIGVSPGADDAQIKKAYRKAALKYHPDK-----NPTEEAAE-KFKEISSAYEILS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSP 111
           D  KR  YD +G                      D F  FF         R    P++  
Sbjct: 59  DSQKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPR---GPQKGR 115

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D++  +  T++ELY G+T K    + ++C +CEG G    K G V      +C  C GQG
Sbjct: 116 DIRHEISATLEELYKGRTAKLALNKQILCKSCEGRGG---KAGAVK-----KCSSCNGQG 167

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
           F    R + P    R + +C  C+G G         K++CK C+G+ +  E K+L V + 
Sbjct: 168 FKFITRQMGP-MIQRFQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIE 222

Query: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
            G++DG  I    EADQ    P            +R P + +  RKG +   E  + L  
Sbjct: 223 PGMKDGQKIVFQGEADQ---APDVVPGDVVFVVSER-PHE-RFNRKGDDLYYEAEVDLLT 277

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   FG+L +   I
Sbjct: 278 AIAG--GEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQ-KYGGFGNLIVKFKI 334

Query: 352 EFPPDNWFTEKSDLTQIKNILP---RSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEG 408
           +FPP N F +++ L Q++NILP   + T  K    +D     +L  F++ +    + K  
Sbjct: 335 KFPP-NHFADEASLKQLENILPPRVKPTIPKGAQIEDC----VLADFDLSK---HSGKSS 386

Query: 409 QDQGENNAESHGEYRGEGSPQCAQQ 433
           Q +G+N      E++G    QCA Q
Sbjct: 387 QSKGQNYDSDDEEHQGAEGVQCASQ 411

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  187 bits (475), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 151/445 (33%), Positives = 213/445 (47%), Gaps = 55/445 (12%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+ NA++++IKK YRK AL++HPDK     +   EA+E KFKE SAAYE+LS
Sbjct: 5   TKFYDLLGVSPNASETEIKKGYRKQALKYHPDK-----NPSEEAAE-KFKECSAAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY---------DPFESFFNFEQDEEPSRHYEDPKRSPD 112
           D  KR  YD YG           +         D F  FF     + PS     P+R  D
Sbjct: 59  DSQKREVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPS----GPQRGRD 114

Query: 113 VKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGF 172
           +K  ++ T++ELY G+T K    + ++C  CEG G    K G V      +C  C GQG 
Sbjct: 115 IKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGG---KAGAVK-----KCTSCNGQGI 166

Query: 173 TEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPR 232
               R + P    R + +C  C G G         K++CK C G+ +  E KVL V V  
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEP 221

Query: 233 GLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
           G+R+G  I    EADQ    P    GD+IF + E          +R G + + E  I L 
Sbjct: 222 GMREGQKIVFKGEADQ---APDVIPGDVIFVVVEKPH----KHFKRAGDDLLYEAEIDLL 274

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G   +F  +   G  L +S  PG+VI  G    IE +G P+  +   +G+L ++  
Sbjct: 275 TAIAG--GEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVP-KYGGYGNLIVTFK 331

Query: 351 IEFPPDNWFTEKSDLTQIKNILPRST--SDKTKLSDDPLNTELLLKFEVLETLPDTLKEG 408
           I+FP +N+ TE   L +++NILP  T  S   K S D     +L  F+  +      + G
Sbjct: 332 IKFPENNFATE-DKLKELENILPARTPVSIPAKASIDEC---VLSDFDPTKYSKSKGRSG 387

Query: 409 QDQGENNAESHGEYRGEGSPQCAQQ 433
           +    +  E HGE       QCA Q
Sbjct: 388 RSYDSDEEEQHGE-----GVQCASQ 407

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  185 bits (469), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 141/407 (34%), Positives = 202/407 (49%), Gaps = 56/407 (13%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+  ATD +IKKAYRK AL++HPDK     +   EA+E KFKE S+AYEILS
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKYHPDK-----NPSEEAAE-KFKEASSAYEILS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSP 111
           D +KR  YD +G                      D F  FF     + P      P+R  
Sbjct: 59  DSEKREVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRP----RGPQRGK 114

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+K  +  +++ELY G+T K    + ++C  CEG G    K G V      +C  C GQG
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGG---KKGAVK-----KCSSCNGQG 166

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
                R + P    R + +C  C G G         K++CK C+G+ +  E K+L V V 
Sbjct: 167 IKFVTRQMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVE 221

Query: 232 RGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
            G++DG  I    EADQ    P    GD++F + E  R  K+   +R G + + E  I L
Sbjct: 222 PGMKDGQRIVFKGEADQ---APDVIPGDVVFIVSE--RPHKN--FKRDGDDLVYEAEIDL 274

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
             A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   +G+L I  
Sbjct: 275 LTAIAG--GEFALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIP-KYGGYGNLVIKF 331

Query: 350 NIEFPPDNWFTEKSDLTQIKNILP---------RSTSDKTKLSD-DP 386
            I+F P+N FT + +L +++ ILP         ++T D+  L+D DP
Sbjct: 332 TIKF-PENHFTTEENLKKLEEILPPRIVPAIPKKATVDECVLADFDP 377

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  184 bits (466), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 198/407 (48%), Gaps = 56/407 (13%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV   ATD +IKKAYRK AL++HPDK     +   EA+E KFKE SAAYEILS
Sbjct: 5   TKFYDILGVPVTATDVEIKKAYRKCALKYHPDK-----NPSEEAAE-KFKEASAAYEILS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSP 111
           D +KR  YD +G                      D F  FF     + P      P+R  
Sbjct: 59  DPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRP----RGPQRGK 114

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+K  +  +++ELY G+T K    + ++C  CEG G    K G V      +C  C GQG
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKECEGRGG---KKGAVK-----KCTSCNGQG 166

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
                R + P    R + +C  C G G         K++CK C+G+ +  E K+L V V 
Sbjct: 167 IKFVTRQMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVE 221

Query: 232 RGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
            G++DG  I    EADQ    P    GD++F + E          +R G + + E  I L
Sbjct: 222 PGMKDGQRIVFKGEADQ---APDVIPGDVVFIVSERPH----KSFKRDGDDLVYEAEIDL 274

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
             A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   +G+L I  
Sbjct: 275 LTAIAG--GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIP-KYGGYGNLIIKF 331

Query: 350 NIEFPPDNWFTEKSDLTQIKNILP---------RSTSDKTKLSD-DP 386
            I+F P+N FT + +L +++ ILP         ++T D+  L+D DP
Sbjct: 332 TIKF-PENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDP 377

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  184 bits (466), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 208/421 (49%), Gaps = 47/421 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+ +A+ S+IKKAYRK AL++HPDK     +   EA+E KFKE SAAYE+LS
Sbjct: 5   TKFYDILGVSPSASSSEIKKAYRKFALKYHPDK-----NPSEEAAE-KFKEASAAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSP 111
           D++KR  YD +G                      D F  FF               +R  
Sbjct: 59  DDEKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGP--QRGR 116

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+K  L  T++ELY G+T K    + ++C  CEG G ++   G V      +C  C GQG
Sbjct: 117 DIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQG 168

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
                R + P    R + +C+ C G G         K++CK C+ + +  E K+L V + 
Sbjct: 169 VKFVTRQMGP-MLQRFQAECEVCHGTG----DIIDPKDRCKTCNAKKVTNERKILEVHIE 223

Query: 232 RGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
            G++DG  +    EADQ    P    GD+IF + +    P +   +R G + + E  I L
Sbjct: 224 PGMKDGQKVVFKGEADQ---APDIIPGDVIFVVSQK---PHE-HFQRAGDDLVYEAEIDL 276

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
             A+ G   +F  K   G  L ++I PG+VI PG    I  +G P+  +   +G+L +  
Sbjct: 277 LTAIAG--GEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIP-KYGGYGNLIVKF 333

Query: 350 NIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLK-FEVLETLPDTLKEG 408
           NI+FPP N FT++  L +++ ILP  T  KT + +  +  E +L  F+  +  P   + G
Sbjct: 334 NIKFPP-NHFTDEESLKKLEEILPPRT--KTNIPEGAVIDECVLSPFDPSKYKPSGARGG 390

Query: 409 Q 409
           Q
Sbjct: 391 Q 391

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  183 bits (465), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 146/447 (32%), Positives = 212/447 (47%), Gaps = 56/447 (12%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY +LGV+ +A D+ IKKAYRK AL++HPDK  +  + D      KFK+I+ AYEILS
Sbjct: 5   TKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD------KFKQITGAYEILS 58

Query: 62  DEDKRAHYD-----------LYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRS 110
           D  KR  YD             G            D F  FF       P      P++ 
Sbjct: 59  DSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRP----RGPQKG 114

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            D++  +  T++ LY G+  K    + V+C  CEG G    K G V      +C  C GQ
Sbjct: 115 RDIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGG---KAGSVK-----KCTSCNGQ 166

Query: 171 GFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSV 230
           G     R + P    R +  C+ C+G+G     A    ++CK C G+ + +E K+L V++
Sbjct: 167 GVKFVTRHMGP-MIQRFQTTCEVCNGEGDVIPAA----DRCKDCDGKKIASERKILEVNI 221

Query: 231 PRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
             G++ G  I    EADQ+ G+   GD++F + E Q  P+ V   R G N   E  I L 
Sbjct: 222 QPGMKHGQKIVFQGEADQQPGQ-IPGDVVFVVNE-QEHPRFV---RNGDNLHYEAEIDLL 276

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G   +F  +   G  L + I PG+VI PG +  IE +G P+    + +GDL I  N
Sbjct: 277 TAIAG--GQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFN 333

Query: 351 IEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTE----LLLKFEVLETLPDTLK 406
           ++F P + F ++  L +++ ILP  T     L   P N E    +L  FE  +      +
Sbjct: 334 VKF-PKSHFADEEALKKLEAILPPKT-----LPRIPPNAEVEECVLADFEPAK---HDSR 384

Query: 407 EGQDQGENNAESHGEYRGEGSPQCAQQ 433
            G  +G++      E   EG  QCA Q
Sbjct: 385 SGNGRGQSYDSDEEEAHTEGV-QCASQ 410

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  182 bits (462), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/407 (33%), Positives = 199/407 (48%), Gaps = 55/407 (13%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+  ATD +IKKAYRK AL++HPDK     +   EA+E KFKE S+AYEILS
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKYHPDK-----NPSEEAAE-KFKEASSAYEILS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSP 111
           D +KR  YD +G                      D F  FF      +  R    P+R  
Sbjct: 59  DSEKRDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPR---GPQRGK 115

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+K  +  +++ELY G+T K    + ++C  CEG G    K G V      +C  C GQG
Sbjct: 116 DIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGG---KKGAVK-----KCSSCNGQG 167

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
                R + P    R + +C  C G G         K++CK C+G+ +  E K+L V V 
Sbjct: 168 IKFVTRQMGP-MIQRFQTECDVCHGTGDIV----DPKDRCKSCNGKKVENERKILEVHVE 222

Query: 232 RGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
            G++DG  I    EADQ    P    GD++F + E          +R G + + E  I L
Sbjct: 223 PGMKDGQRIVFKGEADQ---APDVIPGDVVFLVSERPH----KSFKRDGDDLVYEAEIDL 275

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
             A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   +G+L I  
Sbjct: 276 LTAIAG--GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVP-KYGGYGNLIIKF 332

Query: 350 NIEFPPDNWFTEKSDLTQIKNILP---------RSTSDKTKLSD-DP 386
            ++F P+N FT + +L +++ ILP         ++T D+  L+D DP
Sbjct: 333 TVKF-PENHFTAEENLKKLEEILPPRTVPAIPKKATVDECVLADFDP 378

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  182 bits (462), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/407 (33%), Positives = 199/407 (48%), Gaps = 56/407 (13%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+  ATD +IKKAYRK AL+ HPDK     +   EA+E KFKE S+AYE+LS
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKFHPDK-----NPSEEAAE-KFKEASSAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSP 111
           D +KR  YD +G                      D F  FF     + P    + P+R  
Sbjct: 59  DSEKREVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRP----KGPQRGR 114

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           D+K  +  +++ELY G+T K    + ++C  CEG G    K G V      +C  C GQG
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKECEGRGG---KKGAVK-----KCTGCNGQG 166

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231
                R + P    R + +C  C G G         K++CK C+G+ +  E K+L V V 
Sbjct: 167 IKFVTRQMGP-MIQRFQTECDACHGTGDIV----DPKDRCKSCNGKKIENERKILEVHVE 221

Query: 232 RGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
            G++DG  I    EADQ    P    GD++F + E          +R G + + E  I L
Sbjct: 222 PGMKDGQKIVFKGEADQ---APDVIPGDVVFLVSERPH----KHFKRDGDDLVYEAEIDL 274

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
             A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   +G+L +  
Sbjct: 275 LTAIAG--GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVP-KYGGYGNLIVKF 331

Query: 350 NIEFPPDNWFTEKSDLTQIKNILP---------RSTSDKTKLSD-DP 386
            I+F P+N FT + +L +++ ILP         ++T D+  L+D DP
Sbjct: 332 TIKF-PENHFTTEENLKKLEEILPPRATPTIPKKATVDECVLADFDP 377

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  182 bits (461), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 139/445 (31%), Positives = 210/445 (47%), Gaps = 52/445 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+  A++S+IKK YRK AL++HPDK     +   EA+E KFKE SAAYE+LS
Sbjct: 5   TKFYDILGVSPTASESEIKKGYRKAALKYHPDK-----NPTAEAAE-KFKECSAAYEVLS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY-----------DPFESFFNFEQDEEPSRHYEDPKRS 110
           D +KR  YD YG                       D F  FF     + P      P++ 
Sbjct: 59  DPEKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRP----RGPQKG 114

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            D+K  +  T++ELY G+T K    + ++C +CEG G +             +C  C GQ
Sbjct: 115 RDIKHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGK--------ADAVKKCSSCGGQ 166

Query: 171 GFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSV 230
           G     + + P    R + +C  C G G         K +CK CHG+ +  E K+L V +
Sbjct: 167 GIKFVTKQMGP-MIQRFQTECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKI 221

Query: 231 PRGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNIS 288
             G++DG  I    E+DQ    P    GD++F + E          +R G++ +    I 
Sbjct: 222 EPGMKDGQRIVFKGESDQ---APDIIPGDVVFVVNEKPH----KHFQRSGNDLVYLAEID 274

Query: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYIS 348
           L  A+ G   +F  +   G  L ++I  G+VI PG    IE +G P+  +   +G+L I 
Sbjct: 275 LLTAIAG--GEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPIL-KYGGYGNLIIQ 331

Query: 349 VNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEG 408
            NI+F P+N FT++S+L +++ ILP    +K  +       E +L          +   G
Sbjct: 332 FNIKF-PENHFTDESNLKKLEEILP--PRNKVTIPAKAEVEECVLADYDPAKYRTSNGRG 388

Query: 409 QDQGENNAESHGEYRGEGSPQCAQQ 433
           Q    ++ ++HG   G    QCA Q
Sbjct: 389 QSYDSDDEDAHGGAEG---VQCASQ 410

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  180 bits (457), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 211/444 (47%), Gaps = 49/444 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV+ +A D+ IKKAYRK AL+ HPDK  +  + D      KFKE++ AYEILS
Sbjct: 5   TKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAAD------KFKELTVAYEILS 58

Query: 62  DEDKRAHYD-----------LYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRS 110
           D  KR  YD             G+           D F  FF     + P      P++ 
Sbjct: 59  DSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRP----RGPQKG 114

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            D+K  +  +++ELY G+T K    + ++C  CEG G    K G V      +C  C GQ
Sbjct: 115 RDIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGG---KAGAVK-----KCSSCNGQ 166

Query: 171 GFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSV 230
           G     R + P    R + +C  C G G         K++CK C+G+ +  E K+L V +
Sbjct: 167 GIKFITRQMGP-MIQRFQAECDVCSGTGDII----DPKDRCKSCNGKKIDNERKILEVHI 221

Query: 231 PRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
             G++DG  I    EADQ  G    GD++F I   QR  K    ERKG + + +  + L 
Sbjct: 222 EPGMKDGQKIVFQGEADQAPG-IIPGDVVFVIS--QRPHK--HFERKGDDLLYQAEVDLL 276

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G   +F  +   G  L +SI PG+VI PG    IE +G P+  +   +G+L ++  
Sbjct: 277 SAIAG--GEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQ-KYGGYGNLIVTFK 333

Query: 351 IEFPPDNWFTEKSDLTQIKNIL-PRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQ 409
           I F P N F ++  L +++ IL PRS     K ++  +   +L  F+  +    + K+  
Sbjct: 334 INF-PTNHFADEESLKKLEEILPPRSKPSIPKSAE--VEECILTDFDHSK---HSGKQSN 387

Query: 410 DQGENNAESHGEYRGEGSPQCAQQ 433
            +G N      E+ G    QCA Q
Sbjct: 388 GRGANYDSDEEEHGGAEGVQCASQ 411

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  179 bits (453), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 213/454 (46%), Gaps = 68/454 (14%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV++ A++++IKKAYRK AL++HPDK     +   EA+E KFKE S+AYE+L 
Sbjct: 5   TKFYDLLGVSATASETEIKKAYRKTALKYHPDK-----NPSEEAAE-KFKEASSAYEVLM 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY-------------DPFESFFNFEQDEEPSRHYEDPK 108
           D +KR  YD +G                         D F  FF        +     P+
Sbjct: 59  DAEKREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFG-----GGASRPRGPQ 113

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R  D+K  + +T++ELY G+T K    + ++C  CEG G    K G V      +C  C 
Sbjct: 114 RGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGG---KEGAVK-----KCTSCN 165

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           GQG     R + P    R + +C  CDG G       + K++CK C G+ +  E K+L V
Sbjct: 166 GQGVKFITRQMGP-MIQRFQTECDACDGTGDII----NPKDRCKACSGKKVANERKILEV 220

Query: 229 SVPRGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELN 286
            V  G++DG  I    EADQ    P    GD+IF + E           R   + + E +
Sbjct: 221 HVDPGMKDGQKIVFKGEADQ---APDIIPGDVIFVVSERPH----KHFRRDSDDLVYEAD 273

Query: 287 ISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLY 346
           I L  A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   FG+L 
Sbjct: 274 IDLLTAIAG--GEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVL-KYGGFGNLL 330

Query: 347 ISVNIEFPPDNWFTEKSDLTQIKNILP--RSTSDKTKLS-DDPLNTELLLKFEVLETLPD 403
           +  NI FP D+ FT   ++ +++ ILP  + TS  +K   DD + +E            D
Sbjct: 331 VKFNIVFPKDH-FTSLENMKKLEEILPPRKKTSIPSKAHVDDCVLSEF-----------D 378

Query: 404 TLKEGQDQGENNAESHGE----YRGEGSPQCAQQ 433
             K    +G  +A S+ E      G    QCA Q
Sbjct: 379 AAKYSSTRGGRSANSYDEDDEDQPGAEGVQCASQ 412

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  177 bits (449), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/383 (33%), Positives = 184/383 (48%), Gaps = 44/383 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T  Y +LGV  +A D+ IKK YRK AL+ HPDK  ++ + D      KFKE++ AYE+LS
Sbjct: 5   TKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAAD------KFKELTVAYEVLS 58

Query: 62  DEDKRAHYD-----------LYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRS 110
           D  KR  YD             G+           D F  FF        +     P++ 
Sbjct: 59  DSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFG-----GGASRPRGPQKG 113

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            D+K  +  +++ELY G+T K    + V+C  CEG G    K G V      +C  C GQ
Sbjct: 114 RDIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGG---KEGAVK-----KCASCNGQ 165

Query: 171 GFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSV 230
           G     R + P    R + +C  C+G G         K++CK C+G+ +  E K+L V +
Sbjct: 166 GVKFITRQMGP-MIQRFQAECDACNGTGDIV----DPKDRCKTCNGKKIDNERKILEVHI 220

Query: 231 PRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
             G++DG  I    EADQ  G    GD+IF I   QR  K    ERKG N   +  + L 
Sbjct: 221 EPGMKDGQKIVFQGEADQAPGV-IPGDVIFVIS--QRPHK--HFERKGDNLYYQAEVDLL 275

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVN 350
            A+ G   +F  +   G  L + I PG+VI PG    IE +G P+  +   FGDL ++  
Sbjct: 276 SAIAG--GEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQ-KYGGFGDLIVTFK 332

Query: 351 IEFPPDNWFTEKSDLTQIKNILP 373
           + F P N F ++  L +++ ILP
Sbjct: 333 VNF-PTNHFADEESLKKLEEILP 354

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  174 bits (441), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 142/441 (32%), Positives = 214/441 (48%), Gaps = 49/441 (11%)

Query: 5   YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
           Y +LGV+ +AT+ +IKKAYRK AL++HPDK     +   EA+E KFKE+S+AYE+LSD +
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK-----NPSAEAAE-KFKEVSSAYEVLSDSE 61

Query: 65  KRAHYDLYGSXXXXXXXXXXY----------DPFESFFNFEQDEEPSRHYEDPKRSPDVK 114
           KR  YD +G                      D F  FF         R     +R  D+K
Sbjct: 62  KRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGP---QRGRDIK 118

Query: 115 IPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTE 174
             + +T++ELY G+T K    + ++C  C G G    K G V      +C  C GQG+  
Sbjct: 119 HEIAVTLEELYKGRTAKLALNKQILCKGCNGRGG---KEGAVK-----KCSSCNGQGYKF 170

Query: 175 KVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGL 234
             R + P    R + +C+ C G G         K++CK C+G+ +  E K+L V V  G+
Sbjct: 171 VTRQMGP-MIQRFQTECEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDPGM 225

Query: 235 RDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEA 292
           +DG  I    EADQ    P    GD+IF + E          +R G + + E  I L  A
Sbjct: 226 KDGQKIVFKGEADQ---APDVIPGDVIFVVSEKPH----KNFQRVGDDLVYEAEIDLLTA 278

Query: 293 LTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIE 352
           + G   +F  +   G  L ++I PG+VI PG    +E +G P+  +   +G+L ++  I 
Sbjct: 279 VAG--GEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPI-AKFGGYGNLLVTFKIN 335

Query: 353 FPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQG 412
           FPP N FT   +L +++ ILP   +  T  S   +   +L +F+  +      + GQ   
Sbjct: 336 FPP-NHFTSDENLKKLEEILP-PRAKTTIPSKAHVEDCVLSEFDAAKYNRQNGRGGQSYD 393

Query: 413 ENNAESHGEYRGEGSPQCAQQ 433
           +++ + HG   G    QCA Q
Sbjct: 394 DDDDDEHG---GAEGVQCASQ 411

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  169 bits (429), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 128/385 (33%), Positives = 184/385 (47%), Gaps = 45/385 (11%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY VLGV+  A DS+IKKAYRK AL++HPDK  N   +  E    KFKE+SAAYEILS
Sbjct: 5   TKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDK--NPTEEGAE----KFKEVSAAYEILS 58

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY-----------DPFESFFNFEQDEEPSRHYEDPKRS 110
           D +KR  YD +G                       D F  FF               +R 
Sbjct: 59  DSEKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGP--QRG 116

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            D+K  +  T++ELY G+T K    + ++C  CEG G ++   G V      +C  C GQ
Sbjct: 117 RDIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKK---GAVK-----KCSSCNGQ 168

Query: 171 GFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSV 230
           G     R + P    R + +C  C G G         K++CK C+ + +  E K+L V +
Sbjct: 169 GVKFVTRQMGP-MIQRFQAECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHI 223

Query: 231 PRGLRDGDTIKVVNEADQELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNIS 288
             G++DG  I    EADQ    P    GD+IF + +          +R G + + E  I 
Sbjct: 224 EPGMKDGQNIVFKGEADQ---APDVIPGDVIFVVAQKPH----KHFQRSGDDLVYEAEID 276

Query: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYIS 348
           L  A+ G   +F  +   G  L +SI PG+VI PG+   IE +G P+  +    G+L + 
Sbjct: 277 LLTAIAG--GEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIP-KYGGHGNLIVH 333

Query: 349 VNIEFPPDNWFTEKSDLTQIKNILP 373
             ++F P   F ++  L +++ ILP
Sbjct: 334 FTVKF-PQKHFADEDSLKKLEEILP 357

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  165 bits (417), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/389 (31%), Positives = 187/389 (48%), Gaps = 63/389 (16%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           ++LY +LGV+++A+  DIKKAYR  AL+HHPDK  N +S   E S++KF++I  AYEIL 
Sbjct: 7   SELYDILGVSASASRQDIKKAYRVNALKHHPDK--NGHS---EESKLKFQQICKAYEILK 61

Query: 62  DEDKRAHYDLYGSXXXXX-----------XXXXXYDPFESFF-------NFEQDE----- 98
           DE KR  YD +G+                      D F  FF       +F  D+     
Sbjct: 62  DERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFG 121

Query: 99  -------EPSRHYEDPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRR 151
                   PSR  E P R PD+K  LK T++E+Y+GK  K   KR  +C  C+G G  + 
Sbjct: 122 KRQGAHTAPSRR-ELP-RGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKA 179

Query: 152 KNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKC 211
                      +C  C G+G   + +   P   T     C  C G+G        +K+ C
Sbjct: 180 S----------QCYTCGGRGIRTETKRHGPMVQTWSS-TCSDCAGRGSFM----KQKDIC 224

Query: 212 KKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQ----ELGKPKT--GDLIFSIEED 265
           + C+G+G   E ++  + V +G+ +G  + +  EAD+    ELG      GD+I  +E  
Sbjct: 225 RDCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILE-- 282

Query: 266 QRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNI 325
           Q   K     R  S  +    + L  +L G    +V     G++L + + PG++++PG I
Sbjct: 283 QLPHKAFWRHRDASLVLDHCKVDLKTSLCG-GPVWVDSHPSGKLLKIDVLPGEILKPGAI 341

Query: 326 IKIEQEGWPLNGEATKFGDLYISVNIEFP 354
             +E  G P +G   +FG+LYI  ++ FP
Sbjct: 342 KCVEGMGMPKSG--GRFGNLYIRFDVAFP 368

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  164 bits (414), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 132/408 (32%), Positives = 195/408 (47%), Gaps = 62/408 (15%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY VL V+  A+  +I+KAYR LAL+HHPDK  N++S   E S+ KF E++ AYEIL 
Sbjct: 5   TRLYDVLNVSPEASAVEIRKAYRLLALKHHPDK--NNHS---EESKSKFLEVNEAYEILI 59

Query: 62  DEDKRAHYDLYGS--XXXXXXXXXXYDP-FESFFN--------------------FEQDE 98
           DE KR+ YD YG+             DP   SFFN                    F++  
Sbjct: 60  DEKKRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMS 119

Query: 99  EPSRHYEDPKRS----PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNG 154
            PS   +  K+S    PD+K  LK T+  LY GK  K    R  +C  C+G G  + +  
Sbjct: 120 SPSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVRT- 178

Query: 155 QVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKC 214
                    CK C+G+G   + R + P   T   + C  C+G G        + + C+ C
Sbjct: 179 ---------CKACRGRGQQSRSRQMGPMMQTW-TQTCSDCNGMGTF----TKDSDVCRDC 224

Query: 215 HGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQ----ELGKPKT--GDLIFSIEEDQRC 268
            GEG   E K+  V V  G+  G  I +  EAD+      G      GD+I +I + +  
Sbjct: 225 EGEGCIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKD- 283

Query: 269 PKDVQLERKGSNFMTE-LNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIK 327
           PK  ++ R G + M     I L  +L G K   +    +G+++N++I PG++I+P +   
Sbjct: 284 PKFQRVNRNGCDLMVRNCKIPLVTSLCGGKLS-IDGHPNGKLINVTILPGELIKPNHFKS 342

Query: 328 IEQEGWPLNGEATK---FGDLYISVNIEFPPDNWFTEKSDLTQIKNIL 372
           IE  G P   E      +G+LYI   +EF P+   +E   +T++K +L
Sbjct: 343 IENLGMPRYEEKRAPEGYGNLYIQFQVEF-PETLASET--VTKLKQVL 387

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  162 bits (411), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 186/405 (45%), Gaps = 70/405 (17%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           DLY  LGVA+NA+  +IKKAYR  AL+HHPDK  N +S   E S++KF++I  AYEIL D
Sbjct: 8   DLYDTLGVAANASRQEIKKAYRLKALKHHPDK--NGHS---EQSKLKFQQICKAYEILGD 62

Query: 63  EDKRAHYDLYGSXXXXXXXXXX--------------------------------YDPFES 90
           + KR  YD +G+                                           D F S
Sbjct: 63  DKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFGS 122

Query: 91  FFNFEQDEEPSRHYEDPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRR 150
              F    + SR    P+R PD+K  LK T++E+YNGK  K   KR  +C  C+G G ++
Sbjct: 123 SRGFR--AQGSRR-SAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKK 179

Query: 151 RKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNK 210
                        C  C+G+G   + +   P   T     C  C G G     ++     
Sbjct: 180 ----------ATSCYACRGKGMQTQTKRQGPIMQTWSS-TCGTCGGSGTIVKPSDI---- 224

Query: 211 CKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQ----ELGKPKT--GDLIFSIEE 264
           C  CHG+G   E K+  + V +G+ +G T+ V  EAD+    + G  +   GD+I  +E 
Sbjct: 225 CNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILE- 283

Query: 265 DQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGN 324
            Q   + ++     S  ++E  + L  +L G    +V     G++L + + PG++++PG 
Sbjct: 284 -QLPHRSLKRGHDSSLLLSECQVDLKTSLCG-GTVWVDSHPSGKVLKIDVIPGELLKPGA 341

Query: 325 IIKIEQEGWPLNGEATKFGDLYISVNIEFP----PDNWFTEKSDL 365
           I  ++  G P +     +GDL+I   + FP    PD   T ++ L
Sbjct: 342 IKCVQSMGMPKSKGG--YGDLFIKFKVIFPDNLKPDTIQTMQAAL 384

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  159 bits (402), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 178/413 (43%), Gaps = 63/413 (15%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY VLGV    + +++KK+Y+  AL++HPDK  N +S   EAS+ +F++I+ AY +L 
Sbjct: 5   TRLYDVLGVQPGVSAAELKKSYKLAALRYHPDK--NGHS---EASKQRFQQIADAYRVLG 59

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY------------DPFESFFN----------FEQDEE 99
           DE  R  YD YG+                       D F  FF           F +   
Sbjct: 60  DERLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGA 119

Query: 100 PSRHYEDPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVP 159
            S       R PD+K  L+ T++ELY GK  +    R  +C  C G G  R         
Sbjct: 120 SSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAST------ 173

Query: 160 PEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL 219
               C  C GQG   + +       T     C+ C G G      ++    C  C G G 
Sbjct: 174 ----CTACSGQGICSQTKRQGSLVQTWSS-TCRVCSGSGTIVKDCDT----CTSCGGAGY 224

Query: 220 FAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKT------GDLIFSIEEDQ-----RC 268
             E KV  V +  G+R G  +    EAD+ +  P        GDL  +IEE       +C
Sbjct: 225 LRERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQC 284

Query: 269 PKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKI 328
             D  L       +TEL++ L  +L G    ++     G+++ L I PG+++ PG I  I
Sbjct: 285 RGDANL------LLTELHVDLRTSLCG-GTVYIEDHPSGKLIQLEIIPGELLEPGAIKCI 337

Query: 329 EQEGWPLNGEATKFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTK 381
           E  G P   + +++G L+I  +++FP        S +T I   L   T+ +T+
Sbjct: 338 EHLGMPHPDDPSQYGHLFIKFHVDFPKT---LADSTITAIAQALDADTNVRTR 387

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  153 bits (386), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 178/386 (46%), Gaps = 57/386 (14%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T+LY  L ++ +AT  +IKKAYR  AL+ HPDK  N++S+D   S+ KF+EI  AYEIL 
Sbjct: 7   TELYDTLNISVDATPQEIKKAYRLAALKSHPDK--NNHSED---SKRKFQEICKAYEILG 61

Query: 62  DEDKRAHYDLYG----SXXXXXXXXXXY---------DPFESFFNFEQDEEPSRHYEDP- 107
           D  K+  YD YG    S          Y         D F  FF        S  + D  
Sbjct: 62  DAKKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDT 121

Query: 108 -------------KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNG 154
                         R PD+K  L+ +++ELY+GK  K +  R  +C  C+G       NG
Sbjct: 122 MFFTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKG-------NG 174

Query: 155 QVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKC 214
             +      C+ C GQGF  + R   P   T     C+ C G G    +    K+ C +C
Sbjct: 175 GTSSSA---CRACNGQGFYTQTRRHGPMVQTWST-TCQDCGGSGTFVRR----KDVCSEC 226

Query: 215 HGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQEL----GKPKT--GDLIFSIEEDQRC 268
            G+G   E K+  + V  G+  G  I +  EAD+ +    GK +   GD+I  +++ +  
Sbjct: 227 KGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKH- 285

Query: 269 PKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKI 328
               Q+       M + ++ L  +L G  +  +     G  L + + PG++++PG +  +
Sbjct: 286 -PLFQIHNDTDLVMNDCHVDLKTSLCG-GEVLIENHPCGSALKIEVLPGEILKPGCVKCV 343

Query: 329 EQEGWPLNGEATKFGDLYISVNIEFP 354
           E  G P + ++  FG+LYI   ++FP
Sbjct: 344 ESMGMP-HPQSQGFGNLYIRFQVDFP 368

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  140 bits (353), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 112/365 (30%), Positives = 167/365 (45%), Gaps = 37/365 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y++LGV+  A D DIK AYR+L+ ++HPDK    N DD  A   KF E+  AYE+LSD
Sbjct: 20  DYYSILGVSKGAGDKDIKSAYRQLSKKYHPDK----NPDDDSAHN-KFIEVGEAYEVLSD 74

Query: 63  EDKRAHYDLYGSXXXXXXXXXX----------YDPFESFFNFEQDEEPSRHYEDPKRSPD 112
            +KR  YD YG+                    +DPF+ F          +      R  +
Sbjct: 75  PEKRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHN 134

Query: 113 VKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGF 172
           ++   ++T++E Y G +  F    N  C++CEG G    ++G+VT     +C  CKG G 
Sbjct: 135 LETREELTLKEYYRGTSIDFNLNLNDFCEHCEGSG---SQDGKVT-----KCPDCKGHGV 186

Query: 173 TEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPR 232
             ++  + P    + ++ C +C G+G      ++ KNKCK CHGE +  + K   V VP 
Sbjct: 187 VVQIVRMGP-VTQQIQQMCGKCQGRG------STIKNKCKHCHGEKVVRKPKSFHVDVPP 239

Query: 233 GLRDGDTIKVVNEADQELGKP-KTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
           G         V + + + G     GDL     E  R   ++   R+G +      +SL E
Sbjct: 240 GAP--RNFVEVKQGESDKGPDFDAGDLFIKFSETSR--DNLGYRRRGDDLFRTEALSLRE 295

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           AL G  ++ +      R + +      V   G I +I   G P   E  KFGDLYI   +
Sbjct: 296 ALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP--KEHNKFGDLYIDYVV 353

Query: 352 EFPPD 356
             P D
Sbjct: 354 IVPDD 358

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  140 bits (353), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/374 (31%), Positives = 167/374 (44%), Gaps = 53/374 (14%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           M  LY VLGVAS+A+ S+IKKAYRKLAL++HPDK    N+ D +  E  F++IS AY +L
Sbjct: 1   MESLYDVLGVASDASQSEIKKAYRKLALRYHPDK----NNGDEKCHE-AFQKISHAYGVL 55

Query: 61  SDEDKRAHYDLYG--SXXXXXXXXXXYDPFESFFN-----FEQDEEPSRHYEDPKRSPDV 113
            D  +R  YD  G  +           D F SFFN                  P R P++
Sbjct: 56  GDVAQRQRYDQSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNI 115

Query: 114 KIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFT 173
              LK T+Q+LY GK  K   +R   C+ C          G   V     C  C G G  
Sbjct: 116 IHELKCTLQDLYRGKVIKLALRRTAPCERC--------SLGAANV-----CSSCNGSGNI 162

Query: 174 EKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRG 233
            ++  + P   T     C  C G+G+           C +C G     E  V  V V  G
Sbjct: 163 TRIERVGPLTQTWSS-TCNACQGQGRMSV-------DCSQCGGAQYLNERVVFKVHVKPG 214

Query: 234 LRDGDTIKVVNEADQ-------ELGKPKTGDLIFSIEEDQRCPKDVQLERKGSN-----F 281
           + DG TI +  EADQ        L   ++GD++  I E      D + +R   N     F
Sbjct: 215 MHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRE----LADAKFKRSALNKRENLF 270

Query: 282 MTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIK-IEQEGWPLNGEAT 340
           + ++ + L  ALTG  +  +     G ++ ++I PG+ + P N IK +E  G P++    
Sbjct: 271 VDQVKVDLTTALTG-GNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQ 328

Query: 341 KFGDLYISVNIEFP 354
           + GDLYI      P
Sbjct: 329 R-GDLYIRFCTHSP 341

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  138 bits (348), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 104/370 (28%), Positives = 173/370 (46%), Gaps = 43/370 (11%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y++LG+  +A+D D+K AYR+L+ ++HPDK    N  D E++  +F E+  AYE+LSD
Sbjct: 19  DYYSILGLNKDASDKDVKSAYRQLSKKYHPDK----NPGD-ESAHQRFIEVGEAYEVLSD 73

Query: 63  EDKRAHYDLYGSXXXXXXXXXX-------------YDPFESFFNFEQDEEPSRHYEDPK- 108
            +KR  +D YG+                       +D FE  FN                
Sbjct: 74  PEKRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMH 133

Query: 109 --RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKL 166
             + P +++  ++++++ Y+G   +F+   N ICD+CEG G    ++G+V   P+     
Sbjct: 134 RGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG---SEDGKVETCPD----- 185

Query: 167 CKGQGFTEKVRMLAPGFAT-REKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKV 225
           C GQG    ++++  G  T R ++ C +C G+G      +  KN+CK C G  +  + K 
Sbjct: 186 CGGQGIL--IQIIRMGIMTQRIQQPCGRCSGRG------HIIKNQCKACGGHKVVKKPKS 237

Query: 226 LTVSVPRGL-RDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTE 284
             V VP G  RD   ++   EADQ     + GD+     E  +   ++   R+G +    
Sbjct: 238 FQVEVPAGAPRDHVEVR-HQEADQST-DMEAGDIFVEFTESDK--NNMGYRRRGDHLFRT 293

Query: 285 LNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGD 344
             +S  EAL G   + +    D + + L  P G ++  G I +I   G P       FGD
Sbjct: 294 EVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGD 353

Query: 345 LYISVNIEFP 354
           L++   +  P
Sbjct: 354 LFVEYAVVMP 363

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  138 bits (347), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 178/367 (48%), Gaps = 40/367 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LGV   A+D DIK AYR+L+ ++HPDK    N  D +A   +F E+  AYE LSD
Sbjct: 21  DYYAILGVGRGASDKDIKSAYRQLSKKYHPDK----NPGDEDAHN-RFIEVGEAYEALSD 75

Query: 63  EDKRAHYDLYGSXXXXXXXXXX---------YDPFESFFNFEQDEEPSRHY-----EDPK 108
            +KR  YD +G+                   +DPF+ F         SR +        +
Sbjct: 76  PEKRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQ 135

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R   +++  ++ +++ Y+G + +F    N  CD C+G G    ++G+V      +C  C 
Sbjct: 136 RGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG---SQDGKVE-----KCGQCG 187

Query: 169 GQGFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLT 227
           G+G    V+++  GF T++ ++ C++C+G+G+        KNKCK CHG  +  ++K   
Sbjct: 188 GRGMV--VQVIRQGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKKNKSFH 239

Query: 228 VSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNI 287
           V VP G    D + V+    ++    + GD+   + E     +++   R+G +      +
Sbjct: 240 VDVPAGAPR-DFVAVIRGEAEKSPDTEPGDIYVKVVESP--VQNMGYRRRGPDLFRTEVL 296

Query: 288 SLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYI 347
           SL EAL G   + +      + + LS   G  ++ G +  I+  G PL    TK+GDLY+
Sbjct: 297 SLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLE-SGTKYGDLYV 355

Query: 348 SVNIEFP 354
              I  P
Sbjct: 356 DYVIVMP 362

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  139 bits (351), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 130/422 (30%), Positives = 187/422 (44%), Gaps = 78/422 (18%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY  L V   AT  DIKKAY+KLAL++HPDK  N++S+D   S+ KF+ +  AYEIL+
Sbjct: 5   TKLYETLNVPITATTLDIKKAYKKLALKYHPDK--NNHSED---SKTKFQAVCQAYEILN 59

Query: 62  DEDKRAHYDLYGSXXXXXXXXXXY----------------------DPFESFF--NFEQD 97
           D+  RA YD  G                                  D F  FF  N    
Sbjct: 60  DKQSRAIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAA 119

Query: 98  EEPSR-------------HYEDPK------RSPDVKIPLKMTIQELYNGKTFKFKFKRNV 138
           ++PS+             H  + K      R PD+K  LK T++ELYNGK  K    R  
Sbjct: 120 KQPSQSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTR 179

Query: 139 ICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKG 198
           +C  C G G  +R            C+ C+G GF  + R + P   T   + C  CDG G
Sbjct: 180 LCLPCNGFGGLQR----------TTCESCQGDGFQTQTRRMGPMVQTW-TQTCASCDGAG 228

Query: 199 KHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQ----ELGKPK 254
             + K N   + C  CHGEG   E K+  V V  G +DG  + +  EAD+     L K K
Sbjct: 229 -CFIKPN---DVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEK 284

Query: 255 T--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNL 312
              GD++ +I++ +      Q+       M    + L  +L G  + ++     G+++ L
Sbjct: 285 VIPGDVVITIKQSRDENNCFQMINNKDLLMNGCPVDLVTSLCG-GEVYIDNHPSGKLIKL 343

Query: 313 SIPPGKVIRPGNIIKIEQEGWPL-----NGEATKFGDLYISVNIEFPPDNWFTEKSDLTQ 367
            I PG++++P     IE  G P      +    + GDLYI   I++P      E   +TQ
Sbjct: 344 DIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYPEQ---LENETMTQ 400

Query: 368 IK 369
           +K
Sbjct: 401 LK 402

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  137 bits (345), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 114/455 (25%), Positives = 197/455 (43%), Gaps = 98/455 (21%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           ++LY +L ++SNA   DIKKAYR LAL++HPDK     ++  E S++ F++IS AYE+L 
Sbjct: 5   SELYDILNISSNADAKDIKKAYRVLALKYHPDK-----NNHSEESKVMFQKISEAYEVLI 59

Query: 62  DEDKRAHYD----------------------------------------LYGSXXXXXX- 80
           D +KR  YD                                        L+GS       
Sbjct: 60  DVEKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAG 119

Query: 81  ------------XXXXYDPF----ESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMTIQEL 124
                           ++PF     +F NF    E +   E  +R PD+K  L+ ++++L
Sbjct: 120 DLFAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVE-LERGPDIKHTLRCSLKDL 178

Query: 125 YNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFA 184
           Y GK  K +  R  +C  C G G  ++           +C  C G G   + R + P   
Sbjct: 179 YYGKKTKLRLDRTRLCVLCMGQGSMKKS----------KCFTCNGLGSLTQTRRMGPMIQ 228

Query: 185 TREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVN 244
           T  +  C  C G G    ++++    C+ C G G   E K+  V +  G+ +G  I +  
Sbjct: 229 TFSQ-SCPDCQGSGMFVKRSDT----CQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPG 283

Query: 245 EADQ----ELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKD 298
           EAD+      GK K   GD++ +I  +Q    + ++       +   +++L++AL G   
Sbjct: 284 EADEVVNTSFGKQKVIAGDIVLTI--NQLKDNNFEVINDCDLLLDNFSVNLSKALCG-GT 340

Query: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP--------LNGEATKFGDLYISVN 350
            F++    G ++ + I PG+++ PG I  +   G P        ++      G+LY+  +
Sbjct: 341 IFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFD 400

Query: 351 IEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDD 385
           I+FP      E+  + ++K +L        +++D+
Sbjct: 401 IKFPTR---LEEDTIAKLKAVLSEDRYAHAEMADE 432

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  134 bits (336), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 109/376 (28%), Positives = 178/376 (47%), Gaps = 49/376 (13%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LG+   A++  IK AYR+L+ ++HPDK    N +D EA    F EI  AYE+LSD
Sbjct: 29  DYYKILGIPKEASEKAIKSAYRQLSKKYHPDK----NQNDEEAHN-HFIEIGEAYEVLSD 83

Query: 63  EDKRAHYDLYGSXXXXXXXXXX------------YDPFESFFNFEQDEEPSRHY------ 104
            +KR  YD +GS                      +DPF+ F       + +         
Sbjct: 84  PEKRRTYDQFGSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGG 143

Query: 105 ----EDPKR-SPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVP 159
               +D +R +  +++   ++++E + G    F+      CD+C+G G    ++G+V   
Sbjct: 144 GGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG---SEDGKVD-- 198

Query: 160 PEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL 219
              +CK C G GF  +V  + P    +   +C +C G G      ++ KN CKKCHG+ L
Sbjct: 199 ---KCKECGGNGFVVQVIRMGP-VTQQMHTQCPKCHGAG------STIKNHCKKCHGQKL 248

Query: 220 FAESKVLTVSVPRGLRDGDTIKVV-NEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKG 278
             +SK + V VP G    D +K+V N  D+EL   + GDL+   +E  +   ++   R+G
Sbjct: 249 VTKSKEINVKVPAGAPR-DFLKIVENGGDKEL-NAEAGDLLVQFQEIAQ--NNLGYRRRG 304

Query: 279 SNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGE 338
           ++      +   +A+ G  ++ +      R + +S  PG  +    I K+   G P+ G 
Sbjct: 305 NDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQG- 363

Query: 339 ATKFGDLYISVNIEFP 354
           + +FGDLYI   I  P
Sbjct: 364 SDRFGDLYIDYVIIVP 379

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  134 bits (338), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/426 (26%), Positives = 182/426 (42%), Gaps = 94/426 (22%)

Query: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           LY  L +   A+ SDIKKAYR  AL++HPDK     +++ E S+ KF++IS AY IL DE
Sbjct: 7   LYNALNIPPTASQSDIKKAYRVQALRYHPDK-----NNESEESKKKFQDISEAYSILRDE 61

Query: 64  DKRAHYDLYGSXXXXXXX---------------XXXYDPFESFFNFEQDEEPSRHYEDP- 107
           ++R  YD YG+                          D F  FF+ +       +   P 
Sbjct: 62  NQRKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSPPF 121

Query: 108 ---------------------------------KRSPDVKIPLKMTIQELYNGKTFKFKF 134
                                            ++ PD+   LK TI++LY GK  K + 
Sbjct: 122 GFPFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKLRL 181

Query: 135 KRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQC 194
           +R+ +C  C+G G  +R            C  C G G   +   L P   T     C  C
Sbjct: 182 ERSKLCSICKGDGGVKRS----------MCNQCHGDGNITETTRLGPMLQTF-THTCNIC 230

Query: 195 DGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPK 254
           +G G  +   + E   C+ C+G G + E K+  V +  G++DG  I   NE D+ + K +
Sbjct: 231 NGNG--WVIISQE--TCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRR 286

Query: 255 T--GDLIFSIEEDQRCPKDVQLERKGS-------NFMTELNISLAEALTGFKDKFVTKTF 305
              G++I  I E +    D + +R          N+  +L  SL   +      ++    
Sbjct: 287 VIPGNVIIHINEIE----DNKFKRVNDGQDLYYWNYEIDLFTSLCGGVI-----YIKGHP 337

Query: 306 DGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNWFTEKSDL 365
           + +++ + I PG++I  G++  +E  G P N +  ++G LYI   +++P      EK ++
Sbjct: 338 NNKLIKVDILPGEIIESGSVKGVESLGMPKN-KGNEYGILYIQFQVKYP------EKLNM 390

Query: 366 TQIKNI 371
             IK I
Sbjct: 391 ESIKAI 396

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  132 bits (332), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 108/369 (29%), Positives = 173/369 (46%), Gaps = 41/369 (11%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGV  +A D +IK AYR+L+ ++HPDK    N  D EA   KF E+  AY++LSD
Sbjct: 22  DYYKILGVNKDANDKEIKSAYRQLSKKYHPDK----NPGDEEAHN-KFIEVGEAYDVLSD 76

Query: 63  EDKRAHYDLYGSXXXXXXXXXX---------YDPFESF---FN---FEQDEEPSRHYEDP 107
            +KR  YD YG+                   +DPFE F   FN   F             
Sbjct: 77  SEKRNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGR 136

Query: 108 KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
            R  ++ +  ++++ + YNG+ FK+  + N  C+ C G G    K+G+VT  P+     C
Sbjct: 137 PRGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTG---SKDGKVTRCPD-----C 188

Query: 168 KGQGFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVL 226
           +G+G    V+++  G  T++ +  C +C G G+        KN C  CHG  +    K  
Sbjct: 189 QGRGVI--VQVIQMGIMTQQIQHVCDRCSGSGEII------KNPCPHCHGHKVAKMDKEF 240

Query: 227 TVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELN 286
           TV +P G +  + + + +   ++      GDL+F   E+     ++   R+G +      
Sbjct: 241 TVKLPNGAQR-NYVDIKHGEAEKGADFDAGDLMFEFRENSM--NNMGYRRRGDHLYRTEV 297

Query: 287 ISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP-LNGEATKFGDL 345
           +S+ EAL G  ++ +      + + L     +V+  G I  +   G P LN +  KFGDL
Sbjct: 298 LSVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDL 357

Query: 346 YISVNIEFP 354
           +I   I  P
Sbjct: 358 FIDYVILMP 366

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  132 bits (331), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 170/365 (46%), Gaps = 37/365 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LG+  +A+D +IK +YR+L+ + HPDK    N  D EA   KF EI  AYE+LSD
Sbjct: 21  DYYAILGLNKDASDKEIKSSYRQLSKKFHPDK----NPGDEEAHH-KFIEIGEAYEVLSD 75

Query: 63  EDKRAHYDLYGSXXXXXXXXXX-----------YDPFESFFNFEQDEEPSRHYEDPK-RS 110
            +KR  +D YG+                     +D FE  FN              + R 
Sbjct: 76  PEKRKIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPRG 135

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            ++K+  +++++E Y G T +F    N ICD+C+G G     +G+V      +C  C+G+
Sbjct: 136 HNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG---SADGKVA-----KCSDCQGR 187

Query: 171 GFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229
           G    ++++  G  T++ ++ C +C GKG      +  KN CK CHG  +  + K   V 
Sbjct: 188 GVV--IQVIRMGMMTQQIQQMCGRCGGKG------SVIKNHCKTCHGSKVVKKQKPFHVE 239

Query: 230 VPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
           VP G     T     E+D+       GD+   IE +++   ++   R+G +      +S 
Sbjct: 240 VPPGAARHYTETRSGESDKG-ADFDAGDVF--IEFNEKTTNNLGYRRRGPHLYRTEVLSA 296

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
            EAL G   + V    + + + ++     V+  G + +I   G P       FGDL+I  
Sbjct: 297 REALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEY 356

Query: 350 NIEFP 354
            +  P
Sbjct: 357 VVVMP 361

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/357 (28%), Positives = 176/357 (49%), Gaps = 31/357 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LG++ +A+D +IK AYR+L+ ++HPDK    N  D EA   KF E+  AY+IL D
Sbjct: 20  DYYAILGLSKDASDKEIKSAYRQLSKKYHPDK----NPGDEEAHH-KFIEVGEAYDILGD 74

Query: 63  EDKRAHYDLYGSXXXXXXXXXX-----YDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPL 117
            +KR  YD++G+               +DPF+ F      +     +   +RS + ++  
Sbjct: 75  PEKRKTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGG--FRQTQRSQNYQVRN 132

Query: 118 KMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVR 177
           +++++E Y+G   +F+   N ICD+C G G     +G+V V     C  C+G+G   +V 
Sbjct: 133 QVSLKEFYSGGEVEFEIPLNDICDSCHGSG---SADGKVKV-----CPACQGRGVVVQVI 184

Query: 178 MLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDG 237
            + P     +++  +          K  + +N CK C G  +  ++K      P G+   
Sbjct: 185 RMGPITQQIQQQCGQC-------GGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRN 237

Query: 238 DTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFK 297
              K   E+D+     ++GD+I    E ++  +++   R+G+N      I+  EA+ G  
Sbjct: 238 HIDKKSGESDKSPDM-ESGDIIIEYNESEK--ENLGYRRRGNNLYRTEIITANEAINGGW 294

Query: 298 DKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFP 354
            + +    + + + LS P G ++  G+I +I+  G P+ G +  FGDLYI   +  P
Sbjct: 295 TREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMG-SKNFGDLYIDYVVLVP 350

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  130 bits (327), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 108/373 (28%), Positives = 180/373 (48%), Gaps = 47/373 (12%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LGVA +A++ DIK AYR+++ + HPDK    N+ D EA   KF EI  AYE+LSD
Sbjct: 19  DYYAILGVAKDASEKDIKSAYRQMSKKWHPDK----NAGDDEAHH-KFIEIGEAYEVLSD 73

Query: 63  EDKRAHYDLYGSXX------------XXXXXXXXYDPFESFFNFEQDEEPSRHYEDPKRS 110
            +KRA YD +G+                      +DPF+ F     D  P    ++ ++ 
Sbjct: 74  SEKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGG--QNVRKG 131

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            ++ +   +T+   Y+G         N  C++C G G    ++ Q        C+ C+G+
Sbjct: 132 SNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSG---AEDNQFAT-----CETCQGR 183

Query: 171 GFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229
           G    ++++  GF T++ ++ C  C GKGK      + K+ CK C G  +    K   +S
Sbjct: 184 GVI--IQVIQMGFMTQQIQQVCGACQGKGK------TIKHVCKICRGARVVKTPKTFEIS 235

Query: 230 VPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
           VP G +    +    +A++ +   ++GDL+F  EE+    +++   R+G +      +  
Sbjct: 236 VPAGAQRNYNVVKSGQAEK-VPDMQSGDLVFVFEENSH--ENLGYRRRGDHLYRTEVLHW 292

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP-LN--GEATK-FGDL 345
            EAL G  ++ +    D + + +      V  PG I ++   G P LN  G++T  +GDL
Sbjct: 293 KEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDL 352

Query: 346 YISVNI----EFP 354
           +I   I    EFP
Sbjct: 353 FIEYVIVSPKEFP 365

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  130 bits (326), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 107/365 (29%), Positives = 169/365 (46%), Gaps = 32/365 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LGV   A++ +IK AYR+L+ ++HPDK    N  + EA    F E+  AY++LSD
Sbjct: 20  DYYAILGVDKQASEKEIKSAYRQLSKKYHPDK----NPGNDEAHH-HFIEVGEAYDVLSD 74

Query: 63  EDKRAHYDLYGSXXXXXXXXXX-------YDPFESFFNFEQDEEPSRHYEDPKRSPDVKI 115
            +KR  YD +G+                 +DPF+ F         +R    P R  ++++
Sbjct: 75  PEKRQIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKP-RGQNLQV 133

Query: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175
              ++++  Y G  F+F    N ICD C+G G    ++G+    P+     C G G   K
Sbjct: 134 NHDISLKTFYLGTEFEFTLNLNDICDACDGSG---SEDGKTETCPD-----CGGSGQIMK 185

Query: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235
           V    P    R ++ C +C G+G+        K+ CKKC G  +  +SKV T  V  G+ 
Sbjct: 186 VFRAGP-IEQRVRQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKVEPGM- 237

Query: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295
           + + I V+    ++    + GDL     E ++    +   R+G+       +S  EAL G
Sbjct: 238 ERNHIHVMQGQSEKHPDIEPGDLYQYFRESEK--DSMGYRRRGNTLYRTEILSFKEALQG 295

Query: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355
             ++ +      + L LS P G  ++ G    I+  G P+     KFGDL I   I  P 
Sbjct: 296 GWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLPG 355

Query: 356 DNWFT 360
           + W T
Sbjct: 356 E-WST 359

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  129 bits (325), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 169/365 (46%), Gaps = 37/365 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +L +  +ATD DI+ AYR+L+ ++HPDK    N +D +A   KF E+  AYEILSD
Sbjct: 22  DYYKILELDKDATDKDIRSAYRQLSKKYHPDK----NPNDEDAHH-KFIEVGQAYEILSD 76

Query: 63  EDKRAHYDLYG------SXXXXXXXXXXYDPFESFFN-FEQDEEPSRHYEDP-----KRS 110
            +KR  YD +G                 +DPF+ F   F        H  +P     +R 
Sbjct: 77  PEKRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQRG 136

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
            +V      +++  YNG   KF    N ICD+C G G     +G+ T     +C  C+G+
Sbjct: 137 QNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSG---SNDGKST-----KCPDCQGR 188

Query: 171 GFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229
           G T  V+++  G  T++ ++ C +C GKG+        KN CK CHG  +  + K   + 
Sbjct: 189 GVT--VQVIRMGMMTQQIQQVCGKCGGKGQII------KNPCKTCHGSKVVQKPKDFEIE 240

Query: 230 VPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289
           +P G      +   + A  +     +GD+     E+ +   ++   R+G +      ++ 
Sbjct: 241 LPAGAPR-KFVHAEHGAADKHPDYDSGDVYIEFTENDK--DNMGYRRRGPHLYRTEVLNA 297

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
            EAL G  ++ +      +I+ +   P K+I+ G   +I   G PL      FGDL+I  
Sbjct: 298 TEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDY 357

Query: 350 NIEFP 354
            +  P
Sbjct: 358 VVVMP 362

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  129 bits (323), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 174/369 (47%), Gaps = 45/369 (12%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+L +  +AT+ +IK AYR+L+ ++HPDK    N+   EA + KF E+  AY++LSD
Sbjct: 23  DYYAILEIDKDATEKEIKSAYRQLSKKYHPDK----NAGSEEAHQ-KFIEVGEAYDVLSD 77

Query: 63  EDKRAHYDLYGSXXXXXXXXXX----------YDPFESFFNFEQDEEPSRHY----EDPK 108
            +K+  YD +G+                    +DPF+ F    Q               +
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQ 137

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R P +K+  K+++++ Y+G + +F    N  CD C G G    K  Q        C  C+
Sbjct: 138 RGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKLAQ--------CPDCQ 189

Query: 169 GQGFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLT 227
           G+G    +++L  G  T++ ++ C +C G G+        KN+CK CHG+ +  ++K   
Sbjct: 190 GRGVI--IQVLRMGIMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKKNKFFH 241

Query: 228 VSVPRGLRDGDTIKVVNEADQELGKP--KTGDLIFSIEEDQRCPKDVQLERKGSNFMTEL 285
           V VP G         V EA++    P    GDL+  IE  ++  +++   R+G N     
Sbjct: 242 VDVPPGAPRNYMDTRVGEAEK---GPDFDAGDLV--IEFKEKDTENMGYRRRGDNLYRTE 296

Query: 286 NISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDL 345
            +S AEAL G   + +    + + + LS P   V+  G +  ++  G P   +   +GDL
Sbjct: 297 VLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDL 354

Query: 346 YISVNIEFP 354
           YI   +  P
Sbjct: 355 YIDYVVVMP 363

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  127 bits (320), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 171/365 (46%), Gaps = 37/365 (10%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LG+A +ATD +IK AYR+L+ + HPDK    N  + +A + KF E+  AYE+LSD
Sbjct: 21  DYYQILGIAKDATDKEIKSAYRQLSKKFHPDK----NPGNEDAHQ-KFIEVGEAYEVLSD 75

Query: 63  EDKRAHYDLYGSXXXXXXXXXX-------YDPFESFFNF----EQDEEPSRHYEDPKRSP 111
             KR  +D +G+                 +DPF+ F            P        R P
Sbjct: 76  PQKRQTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPRGP 135

Query: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           ++    ++++++ Y G    F    N +CD+C G G     +G++T  P+     C+G+G
Sbjct: 136 NIMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG---SDDGKLTPCPD-----CQGRG 187

Query: 172 FTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSV 230
               ++++  G  T++ ++ C +C GKG+ +      K +C+KCHG  +  + K   V +
Sbjct: 188 VI--IQLIRMGMMTQQIQQMCGRCGGKGQLF------KKQCRKCHGNKVMPQKKEFQVKL 239

Query: 231 PRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLA 290
           P+G +         EAD+     + GDL+    E+ +   ++   R+G N      +++ 
Sbjct: 240 PKGAKRHYMDVKHGEADKN-PDLEAGDLLIEFNENDK--SNMGYRRRGQNLYRTEVLNVT 296

Query: 291 EALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLN-GEATKFGDLYISV 349
           EAL G   + +      + L +      V+  G + +I   G P   G+   FGDL+I  
Sbjct: 297 EALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDY 356

Query: 350 NIEFP 354
            +  P
Sbjct: 357 VVIMP 361

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  127 bits (320), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 110/370 (29%), Positives = 168/370 (45%), Gaps = 49/370 (13%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGV+ +A+D +IK AYR+L+ + HPDK    N  D +A   KF E+  AYE+LSD
Sbjct: 25  DYYGILGVSKDASDKEIKSAYRQLSKKFHPDK----NPGDEDAHH-KFIEVGEAYEVLSD 79

Query: 63  EDKRAHYDLYGSXXXX------------XXXXXXYDP---FESFFNFEQDEEPSRHYEDP 107
           + KR  YD +G+                      +DP   FE  F   +           
Sbjct: 80  DQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRG----R 135

Query: 108 KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
            R  +++   ++T+++ Y G +  F    N  C+NC G G    ++G+ T      C  C
Sbjct: 136 PRGHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSG---SQDGKTT-----HCSEC 187

Query: 168 KGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLT 227
           +GQG   +V  + P    + ++ C  C GKG+        KNKCK+CHG  +  ++K   
Sbjct: 188 RGQGVVIQVVRMGP-LTQKIQQMCGACQGKGQ------VIKNKCKRCHGAKVERKAKHFH 240

Query: 228 VSVPRGL-RDGDTIKVVNEADQELGKP--KTGDLIFSIEEDQRCPKDVQLERKGSNFMTE 284
           V VP G  RD   +K   EAD+    P   +GD+     E  R   ++   R+G +    
Sbjct: 241 VDVPAGAPRDFVDVK-AGEADK---GPDFDSGDVFIKFSESSR--DNMGYRRRGPHLYRT 294

Query: 285 LNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGD 344
             +SL EAL G   + +      + L L    G  +R G I ++   G P  G   K GD
Sbjct: 295 EVLSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHG-KHGD 353

Query: 345 LYISVNIEFP 354
           L++   +  P
Sbjct: 354 LFVDYVVVIP 363

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  129 bits (324), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 122/458 (26%), Positives = 186/458 (40%), Gaps = 88/458 (19%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           T LY +L V  +A+   IKKA+   AL+ HPDK  N++S   E S+ +F+EIS AYE+LS
Sbjct: 5   TRLYDLLNVECDASQVTIKKAFHAAALRCHPDK--NNHS---EESKKQFQEISKAYEVLS 59

Query: 62  DEDKRAHYDLYGSXXXXXXXX----------------------XXYDPFESFFNFEQDEE 99
           D   R  YD YG+                                 D F  FFN   D  
Sbjct: 60  DPKSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAG 119

Query: 100 PSRHYED------------------PKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICD 141
           PS  +                     +  PD+K  LK  + +LY GK  K    R  +C 
Sbjct: 120 PSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCS 179

Query: 142 NCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHY 201
           +C+G G  R  +          C+ CKGQG   K R + P   T     C  C G G   
Sbjct: 180 SCDGKGGMRVAS----------CRTCKGQGEVVKTRRVGPMVQTMSS-TCNSCHGTGTFI 228

Query: 202 AKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQ------ELGKPKT 255
                + + C  C G G+  E K+  V V  G+     I +  EAD+       L K + 
Sbjct: 229 ----KDSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQP 284

Query: 256 GDLIFSIEEDQRCPKDVQLERKGSNFMTELN--ISLAEALTGFKDKFVTKTFDGRILNLS 313
           GD++  I+      K+ Q +    + +   N  + L   L G  +  +     G+I+ LS
Sbjct: 285 GDVVIVID----LVKNTQFQVVNDHDLVLKNCEVPLKTCLCG-GEIMIEGHPSGKIIKLS 339

Query: 314 IPPGKVIRPGNIIKIEQEGWP-----------LNGEATKFGDLYISVNIEFP---PDNWF 359
           I P ++++P     +E  G P              +   +G+LY+   ++FP    D   
Sbjct: 340 IIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPERLEDTTI 399

Query: 360 TEKSD-LTQIKNILPRSTSDKTKLSDDPLNTELLLKFE 396
           T+  + L Q  N+     SD+ ++ D   N++  ++ E
Sbjct: 400 TKLQEILEQDPNVKKEDESDQKRIDDAVTNSDGAVEVE 437

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  126 bits (317), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 104/371 (28%), Positives = 172/371 (46%), Gaps = 51/371 (13%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+L +  +A++ +IK AYR+L+ ++HPDK  N+ SD+   +  KF EI  AYE+LSD
Sbjct: 23  DYYAILDIGKDASEKEIKSAYRQLSKKYHPDK--NAGSDE---AHHKFIEIGEAYEVLSD 77

Query: 63  EDKRAHYDLYGSXXXXXXXXXX--------YDPFE----SFFNFEQDEEPSRHYEDPKRS 110
            +K+  YD +G+                  +DPF+     F   +            +R 
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRG 137

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
           P +K+   +++++ Y+G + +F    N  CD C G G    K  Q        C  C+G+
Sbjct: 138 PTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGKLAQ--------CPDCQGR 189

Query: 171 GFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229
           G    V+++  G  T++ ++ C +C G G+        KN+CK CHG+ +  ++K   V 
Sbjct: 190 GII--VQVVRMGIMTQQIQQICGRCAGTGQ------VIKNQCKTCHGKKVTKKNKFFHVD 241

Query: 230 VPRGLRDGDTIKVVNEADQELGKPK------TGDLIFSIEEDQRCPKDVQLERKGSNFMT 283
           VP G          N  D   G+ +       GDL+  IE  +   +++   R+G N   
Sbjct: 242 VPPGAPR-------NYMDTRAGEAEKGPDFDAGDLV--IEFREMDTENMGYRRRGHNLYR 292

Query: 284 ELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFG 343
              +S AEAL G  ++ +    + + + LS P   V+  G I  ++  G P    +   G
Sbjct: 293 TEVLSAAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKG--SRDHG 350

Query: 344 DLYISVNIEFP 354
           DLYI   +  P
Sbjct: 351 DLYIDYVVVMP 361

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  125 bits (315), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 106/374 (28%), Positives = 174/374 (46%), Gaps = 54/374 (14%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+L V  +A++ +IK AYR+L+ ++HPDK  NS S   E +  KF E+  AY++LSD
Sbjct: 23  DYYAILEVDKDASEKEIKSAYRQLSKKYHPDK--NSGS---EEAHHKFIEVGEAYDVLSD 77

Query: 63  EDKRAHYDLYGSXXXXXXXXXX-----------YDPFESFFNFEQDEEPSRHY----EDP 107
            +K+  YD +G+                     +DPF+ F +  Q               
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQR 137

Query: 108 KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
           +R P +K+  K+++++ Y+G + +F    N  CD C G G    K  Q        C  C
Sbjct: 138 QRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGKLAQ--------CPDC 189

Query: 168 KGQGFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVL 226
           +G+G    +++L  G  T++ ++ C +C G G+        KN+CK CHG+ +  ++K  
Sbjct: 190 QGRGVI--IQVLRMGIMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIKKNKFF 241

Query: 227 TVSVPRGLRDGDTIKVVNEADQELGKPK------TGDLIFSIEEDQRCPKDVQLERKGSN 280
            V VP G          N  D   G+ +       GDL+  IE  ++  +++   R+G N
Sbjct: 242 HVDVPPGAPR-------NYLDTRAGEAEKGPDFDAGDLV--IEFKEKDTENMGYRRRGDN 292

Query: 281 FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEAT 340
                 +S  EAL G   + +    + + + LS P   V+  G I  ++  G P +G+  
Sbjct: 293 LYRTEVLSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKG- 351

Query: 341 KFGDLYISVNIEFP 354
             GDLYI   +  P
Sbjct: 352 -HGDLYIDYVVIMP 364

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  126 bits (316), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 138/287 (48%), Gaps = 28/287 (9%)

Query: 107 PKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKL 166
           P R PD+K  LK T+ ELY+GK  K    R  +C +C+G G  RR+           CK 
Sbjct: 159 PSRGPDIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRRT----------CKT 208

Query: 167 CKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVL 226
           C+GQG   + R   P   T  +  C  C+G G +  +A+     C +C GE    E K+ 
Sbjct: 209 CRGQGQQTETRRTGPMVQTWTQ-TCPDCNGLGTYTKQADV----CHECRGESYIKERKIF 263

Query: 227 TVSVPRGLRDGDTIKVVNEADQ----ELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSN 280
            V V +G+  G TI +  EAD+      G  K   GD++ +I++ +   K  ++ R G +
Sbjct: 264 DVEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKD-SKFHRVNRYGCD 322

Query: 281 F-MTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEA 339
             M   +I L+ +L G  D ++     G++L +SI PG++I P  +  IE  G P  G  
Sbjct: 323 LVMGSCSIDLSTSLCG-GDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHD 381

Query: 340 TKFGDLYISVNIEFP----PDNWFTEKSDLTQIKNILPRSTSDKTKL 382
              G+LYI   +E+P    PD     +S L Q K +  +  S   K+
Sbjct: 382 GGKGNLYIQFQLEYPVGLEPDTIGRLQSVLLQDKYVQNQIQSQNAKV 428

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (73%), Gaps = 5/73 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY  L V+ +AT S+IK+AY+ +AL++HPDK  N +S+D   ++ KF+E+  AYEIL+
Sbjct: 5  TRLYDTLKVSPDATISEIKRAYKVMALKYHPDK--NHHSED---AKNKFQEVCKAYEILA 59

Query: 62 DEDKRAHYDLYGS 74
          DEDKR  YD YG+
Sbjct: 60 DEDKRVMYDRYGT 72

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  124 bits (311), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 104/369 (28%), Positives = 167/369 (45%), Gaps = 46/369 (12%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LGV+ +A++ +IK AYR+L+ ++HPDK    N  D E +  KF E+  AYE+LSD
Sbjct: 24  DYYAILGVSKDASEKEIKSAYRQLSKKYHPDK----NPGD-ETAHHKFIEVGEAYEVLSD 78

Query: 63  EDKRAHYDLYGSXXXXXXXXXX--------------YDP---FESFFNFEQDEEPSRHYE 105
           + KR  Y+ YG+                        +DP   FE  F  ++         
Sbjct: 79  DQKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRG--- 135

Query: 106 DPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECK 165
              R  +++   ++T++E Y G +  F    N  CDNC+G G    ++G+ T      C 
Sbjct: 136 -RPRGHNLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTG---SQDGKTT-----RCS 186

Query: 166 LCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKV 225
            C+GQG   ++  + P    + ++ C  C GKG+        KNKCK+CHG  +  ++K 
Sbjct: 187 DCQGQGVVIQIIRMGP-ITQQIQQMCGACQGKGQII------KNKCKQCHGAKVERKTKH 239

Query: 226 LTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTEL 285
             V VP G    D + V N    +      GD+     E  R   ++   R+G +     
Sbjct: 240 FHVDVPAGAPR-DFVDVKNGEADKGPDFDAGDVYIKFSESSR--DNMGYRRRGVHLHRTE 296

Query: 286 NISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDL 345
            ++L EAL G   + +      + + L    G  +R G   ++   G P +G    FGDL
Sbjct: 297 VLTLKEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKDGR--HFGDL 354

Query: 346 YISVNIEFP 354
           ++   +  P
Sbjct: 355 FVDYVVLTP 363

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  122 bits (307), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 170/367 (46%), Gaps = 43/367 (11%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+L +   A++ +IK AYR+L+ + HPDK    N+   EA + KF E+  AY++LSD
Sbjct: 23  DYYAILEIDKGASEKEIKSAYRQLSKKFHPDK----NAGSEEAHQ-KFIEVGEAYDVLSD 77

Query: 63  EDKRAHYDLYGSXXXXXXXXXX--------YDPFESFFNFEQDEEPSRHY----EDPKRS 110
            +K+  YD +G+                  +DPF+ F    Q               +R 
Sbjct: 78  PEKKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRG 137

Query: 111 PDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
           P +K+  K+++++ Y+G + +F    N  CD C G G    K  Q        C  C+G+
Sbjct: 138 PMIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGKLAQ--------CPDCQGR 189

Query: 171 GFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229
           G    +++L  G  T++ ++ C +C G G+        KN+CK CHG  +   +K   V 
Sbjct: 190 GVI--IQVLRMGIMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVD 241

Query: 230 VPRGLRDGDTIKVVNEADQELGKP--KTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNI 287
           VP G           EA++    P    GDL+  IE  ++  +++   R+G N      +
Sbjct: 242 VPPGAPRNYMDTRAGEAEK---GPDFDAGDLV--IEFKEKDSENMGYRRRGDNLYRTEVL 296

Query: 288 SLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYI 347
           S+ EAL G  ++ +    + + + LS P    +  G I  ++  G P  G+   +GDLYI
Sbjct: 297 SIEEALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMPKGGKG--YGDLYI 354

Query: 348 SVNIEFP 354
              +  P
Sbjct: 355 DYVVIMP 361

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  122 bits (307), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 129/480 (26%), Positives = 203/480 (42%), Gaps = 116/480 (24%)

Query: 2   TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIK-FKEISAAY--- 57
           T LY +L V + AT+ +IKKAYRK AL+HHPDK      ++  A  IK F++IS AY   
Sbjct: 5   TKLYDILEVNTTATEQEIKKAYRKKALKHHPDK------NNHSAESIKLFQDISHAYETL 58

Query: 58  ---------------------EILSDEDK------------RAHY--DLY---------- 72
                                EI++ ++              AH   DL+          
Sbjct: 59  SNSNKRELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSS 118

Query: 73  --GSXXXXXXXXXXYDPFESF---FNFEQ--DEEPSRHYEDPKRSPDVKIPLKMTIQELY 125
             G+            PF+SF   FN     D E    +E     P ++  LK  + +L+
Sbjct: 119 GTGASGFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHE-MASGPGIRHNLKCNLYDLF 177

Query: 126 NGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFAT 185
           +GK  K    R  +C  C+G G ++            +C+ C+G G     + + P   T
Sbjct: 178 HGKRAKLALNRTRLCQRCQGYGGKK----------ATQCRGCQGTGLFTTTKRMGPMVQT 227

Query: 186 REKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIKVVNE 245
            +   CK+C G GK+       K+ C +C G G   E K   V V  G+R+G+ I +  E
Sbjct: 228 WQT-TCKECSGTGKYI----RSKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGE 282

Query: 246 ADQ----ELGKPKT--GDLIFSI------EEDQRCP-----KDVQLERKGSNFMTELNIS 288
           AD+    E GK +   GD+I +I      E + R        D+ L+    NF  +L  S
Sbjct: 283 ADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILD----NFEVDLKTS 338

Query: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYIS 348
           L       +D        G    + +  G++++PG I  +E +G P++     FG+LYI 
Sbjct: 339 LCGGTIIIEDH-----PSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FGNLYIR 392

Query: 349 VNIEFPPDNWFTEKSD-LTQIKNILPRSTSDKTKLSDD------PLNTELLLKFEVLETL 401
             ++FP       KSD + ++  IL +  +  + LSD        +N+  + + +VL T 
Sbjct: 393 FRVKFPEQ----LKSDTINKLSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLSTF 448

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  120 bits (302), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 168/371 (45%), Gaps = 51/371 (13%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LG++ N  + +IK AYR+L+ + HPDK    N +D +A   KF EI  AYE+LSD
Sbjct: 23  DYYKILGLSKNCNEKEIKSAYRQLSKKFHPDK----NPNDEDAHN-KFIEIGEAYEVLSD 77

Query: 63  EDKRAHYDLYGSXXXXXXXXXX----------YDPFESFFNFEQDEEPSRHYEDP----- 107
            +KR  YD +G+                    +DPF+ F                     
Sbjct: 78  PEKRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGFGGF 137

Query: 108 ---------KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTV 158
                    +R   +K+   +T+++ YNG +  F    N  CD+C G G    ++G+V  
Sbjct: 138 GGGQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG---SEDGKVK- 193

Query: 159 PPEVECKLCKGQGFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGE 217
               +C  C G+G    ++++  G  T++ +++C +C G G+        +NKCK C G 
Sbjct: 194 ----KCPDCGGRGVV--IQVIRMGIVTQQVQQRCNRCAGSGEII------QNKCKVCSGA 241

Query: 218 GLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPK-DVQLER 276
            +  + K ++VS   G+          EA++  G  + GDLI    E    P+ ++   R
Sbjct: 242 KVQKKEKDISVSFDSGIERNHISVQQGEAEKGPG-IEPGDLIVEFFE---VPEANMGYRR 297

Query: 277 KGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLN 336
           +G +      ++L EA+ G   + +      + L L   P  ++  G + KI   G P+ 
Sbjct: 298 RGKDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPIL 357

Query: 337 GEATKFGDLYI 347
           G   KFGDLYI
Sbjct: 358 GSKGKFGDLYI 368

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  112 bits (281), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 105/377 (27%), Positives = 170/377 (45%), Gaps = 51/377 (13%)

Query: 3   DLYAVLGVASNA-TDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
           D Y +LG+  N   + +IK AYRKL+ ++HPDK    N +D++A +  F ++  AY++L 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDK----NKNDKDAQQ-NFIKVGEAYDVLG 78

Query: 62  DEDKRAHYDLYGSXXXXXXXXXX-----------YDPFESF----------FNFEQDEEP 100
           D DK+  YD  G                      +DPF+ F                  P
Sbjct: 79  DPDKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNP 138

Query: 101 SRHYEDPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPP 160
                  +R P +K+  ++++++ Y G  F+F    +  CD+C G G    ++G+  V P
Sbjct: 139 FGGGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTG---SEDGKTKVCP 195

Query: 161 EVECKLCKGQGFTEKVRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL 219
           +     CKG G    ++++  G  T++ ++ C +C G+G      +  KN CK C+G  +
Sbjct: 196 D-----CKGSGII--IQIIRMGMMTQQIQQPCGRCRGQG------HLIKNFCKVCNGAKV 242

Query: 220 FAESKVLTVSVPRGL-RDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKD-VQLERK 277
             + K   V VP G  R+   +K          +P  GD+I    E    P D +   R+
Sbjct: 243 QQKLKDFKVYVPPGSPRNHVEVKAGQAEKNPNYEP--GDVIIEFNE---LPLDNLGYRRR 297

Query: 278 GSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNG 337
           G+N      ISL EAL G  ++ +      + +NL   P   I  G I  ++  G P+  
Sbjct: 298 GNNLFRTEYISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPN 357

Query: 338 EATKFGDLYISVNIEFP 354
           +  KFGDLYI   +  P
Sbjct: 358 KKNKFGDLYIDYKVIIP 374

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  110 bits (274), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 165/360 (45%), Gaps = 32/360 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D YA+LGV   AT+ DIK AYR+L+ ++HPDK    N  D  A    F E+  AYE LSD
Sbjct: 21  DYYAILGVDREATEKDIKSAYRQLSKKYHPDK----NPGDTTAHH-NFIEVGEAYEALSD 75

Query: 63  EDKRAHYDLYGSXXXXXXXXXX------YDPFESFFNF-EQDEEPSRHYEDPKRSPDVKI 115
            +KR  YD YG+                +DPF+ F                 +RS  +++
Sbjct: 76  PEKRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQV 135

Query: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175
             ++T+++ Y+G   +F    N  CD+C   G    ++G+V       C  C  +G    
Sbjct: 136 QEELTLRQYYHGTAVEFTLSLNDHCDHCGATG---SQDGKVE-----RCTQCSVRGVI-- 185

Query: 176 VRMLAPGFATRE-KRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGL 234
           V++   GF T++ ++ C +  G    + KA  +  KCK C G     ++K   V VP G 
Sbjct: 186 VQVGRQGFMTQQFQQVCPRLLGP---WPKALPK--KCKVCQGHKAIKKNKSFRVEVPPGA 240

Query: 235 RDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALT 294
              D + V     +++     GD+   + E+ R   ++   R+G+N      +SL EAL 
Sbjct: 241 PR-DFVAVQQGEAEKVPDMDPGDIYVKVFENTR--DNMGYRRQGANLFRTEVLSLKEALH 297

Query: 295 GFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFP 354
           G   + +      + +  S   G+ ++ G + ++   G PL  ++  FGDLY+   +  P
Sbjct: 298 GDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLP-DSAGFGDLYVDYVVILP 356

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score =  110 bits (275), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 127/288 (44%), Gaps = 30/288 (10%)

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R PD+K  LK T++ELY GKT K    R  IC  CEG G  ++            CK CK
Sbjct: 186 RGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQK----------YTCKTCK 235

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           GQG   + + + P       + C  C G G         K+ C++C G G   + K+L V
Sbjct: 236 GQGVQTQTKCMGP-LVQSWSQTCADCGGAGIFV----ESKDICQQCQGLGFIKQRKILQV 290

Query: 229 SVPRGLRDGDTIKVVNEADQELGKPKT------GDLIFSIEEDQRCPKDVQLERKGSNFM 282
           +V  G      I +  E D+ + K         GD++ +I   +  PK  Q+    S   
Sbjct: 291 TVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKD-PK-FQVTDNCSLIY 348

Query: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP--LNGEAT 340
            +  + L  +L G    ++     G+++ L I PG+V++P     IE  G P  +NG  +
Sbjct: 349 KKCKVDLMTSLCG-GIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRS 407

Query: 341 KFGDLYISVNIEFP----PDNWFTEKSDLTQIKNILPRSTSDKTKLSD 384
            FG LY+  ++ +P    P+N    +  L   K I     + +T  SD
Sbjct: 408 GFGHLYVKFDVSYPERLEPENAMKLQKILAHDKYIQAEQRATETADSD 455

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 5/73 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY  L V + A+ S+IKKAYR  AL++HPDK     ++  E S+ KF+EI  AYE+L 
Sbjct: 5  TSLYDSLNVTTTASTSEIKKAYRNAALRYHPDK-----NNHTEESKRKFQEICQAYEVLK 59

Query: 62 DEDKRAHYDLYGS 74
          D   R+ YD YG+
Sbjct: 60 DNHLRSLYDQYGT 72

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  108 bits (271), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 124/274 (45%), Gaps = 27/274 (9%)

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R PD+K  LK  ++ELY+GK  K    R  +C  C G G         ++   V C  C+
Sbjct: 151 RGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHG---------SMTSSV-CGECR 200

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           GQG   + R   P   T     C+ C G G  + K+N   + C+ C G G   E K+  V
Sbjct: 201 GQGVYSQTRRHGPLVQTWSS-SCRNCSGAGT-FVKSN---DVCQTCRGTGYIRERKIFEV 255

Query: 229 SVPRGLRDGDTIKVVNEADQEL----GKPKT--GDLIFSIEEDQRCPKDVQLERKGSNFM 282
            +  GL +   I +  EADQ +    GK +   GD+I  ++E Q      +  R+    +
Sbjct: 256 EIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQE-QCSTGRYRRFRESDLVL 314

Query: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKF 342
           T   + L  +L G    ++     GR + L + PG+++ PG+I  +E  G P     +++
Sbjct: 315 TRCVVDLRTSLCG-GSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNPSQY 373

Query: 343 GDLYISVNIEFP----PDNWFTEKSDLTQIKNIL 372
           GDLYI   + FP    P+      S L    NI+
Sbjct: 374 GDLYIKFCVNFPERLEPETMNVISSALASDSNII 407

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +L V+   +  ++KK+Y+  AL++HPDK  N +S   E+++  F++I+ AY ILS
Sbjct: 5  TRFYDLLNVSPTVSPQELKKSYKLAALRYHPDK--NGHS---ESAKQAFQQITEAYGILS 59

Query: 62 DEDKRAHYDLYG 73
          DE KR  YD YG
Sbjct: 60 DERKRKIYDRYG 71

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score =  108 bits (269), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 133/289 (46%), Gaps = 31/289 (10%)

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R PD+K  LK T++ELY GKT K    R  IC  C+G G  R+            CK CK
Sbjct: 182 RGPDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRK----------YTCKPCK 231

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           GQG   + + + P       + C  C G G  + K    K+ C++C G G   + K+L V
Sbjct: 232 GQGIQTQTKRMGP-LVQSWSQTCADCGGAGT-FVK---NKDICEQCQGLGFIKQRKILQV 286

Query: 229 SVPRGLRDGDTIKVVNEADQEL-----GKPKT--GDLIFSIEEDQRCPKDVQLERKGSNF 281
           +V  G      I +  E D+ +     G+ K   GD++ +I   +  PK  Q+       
Sbjct: 287 TVQPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKD-PK-FQITDNCDLI 344

Query: 282 MTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP--LNGEA 339
             +  + L  +L G    ++     G+++ + I PG+V++PG    +E  G P  +NG  
Sbjct: 345 CKKCEVDLMTSLCG-GIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVR 403

Query: 340 TKFGDLYISVNIEFP----PDNWFTEKSDLTQIKNILPRSTSDKTKLSD 384
           + FG LY+  ++ +P    P+N    KS L   K I    ++ +T  +D
Sbjct: 404 SGFGHLYVKFDVTYPERLEPENAAKVKSILANDKYINAERSAMETTDAD 452

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 5/73 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY  L V + A+ S+IKKAYR  AL++HPDK     ++  E S+ KF+EI  AYE+L 
Sbjct: 5  TSLYDSLNVTATASTSEIKKAYRNAALKYHPDK-----NNHTEESKRKFQEICQAYEVLK 59

Query: 62 DEDKRAHYDLYGS 74
          D   R+ YD YG+
Sbjct: 60 DNHLRSLYDQYGT 72

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  107 bits (268), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 125/279 (44%), Gaps = 32/279 (11%)

Query: 103 HYEDPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEV 162
           H+ D  R PD+K  LK T++ELY GKT K    R  IC  C+G G  ++           
Sbjct: 171 HHLD--RGPDIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK----------C 218

Query: 163 ECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAE 222
            CK CKGQG   + R + P       + C  C G G         K+ C++C G G   E
Sbjct: 219 TCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFV----KNKDICQQCQGLGFIKE 273

Query: 223 SKVLTVSVPRGLRDGDTIKVVNEADQELG-------KPKTGDLIFSIEEDQRCPKDVQLE 275
            K+L V+V  G      I +  E D+ +        K   GD++ +I   +    + Q+ 
Sbjct: 274 RKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLK--DPNFQVI 331

Query: 276 RKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP- 334
              +    +  I    +L G    ++     G+++ L I PG++++PG    +E  G P 
Sbjct: 332 NYSNLICKKCKIDFMTSLCG-GVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPK 390

Query: 335 -LNGEATKFGDLYISVNIEFPPDNWFTEKSDLTQIKNIL 372
            +NG  + FG LY+  ++ +P      E  +  +I+NIL
Sbjct: 391 FINGVRSGFGHLYVKFDVTYPER---LEPENAKKIQNIL 426

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score =  102 bits (255), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 115/413 (27%), Positives = 169/413 (40%), Gaps = 94/413 (22%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y VLGV S+A+  +IKKAY KLA Q+HPD  +N  +     +E KF ++  AYEIL
Sbjct: 33  IKDPYGVLGVKSSASQGEIKKAYYKLAKQYHPD--INKEA----GAEKKFHDLQNAYEIL 86

Query: 61  SDEDKRAHYD-----------LYGSXXXXXXXXXXYDPFESF-------------FNFE- 95
           SDE KR  +D             G           ++PF S+              NFE 
Sbjct: 87  SDESKRKQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDFGGINFED 146

Query: 96  -----------------------QDEEPSRHYEDPKRSPDVKIPLKMTIQELYNGKT-FK 131
                                  ++   S  Y   K    V +   M+ ++   GK+  K
Sbjct: 147 LFGAAFSGSGGAGGAKAGGAGASRNPFSSSGYRQYK-GDSVHVSYNMSFKDAVFGKSGVK 205

Query: 132 FKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKC 191
            KF     CD C G G ++  +         +C  C+G G    VR    GF       C
Sbjct: 206 LKFNVFDPCDTCSGSGIKKGASRH-------QCPGCQGSGTKIHVRG---GFQMMS--TC 253

Query: 192 KQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIKVVNEA---- 246
            +C G+G      NS  + C  CHGEG+ F   K +TV +P GL+DGD I++  +     
Sbjct: 254 NECQGEG---TTVNSS-DLCGACHGEGVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPE 309

Query: 247 ---DQELG---KPKTGDLIFS--IEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKD 298
              D  L    K   GD++ +  +EED   P     ++    +  E+ I+ A AL G   
Sbjct: 310 VALDPSLAGSVKLTRGDVLVNVRVEED---PTFTIRDKSDIWYTMEIPITTA-ALGG--- 362

Query: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
                T DG  + L + PG   + G++I +   G P +      G + +   I
Sbjct: 363 TVQVPTVDGSHIRLKVAPG--TQSGDVITVPNMGVPRSNLTRSRGAMKVQYRI 413

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R PD+K  LK T++ELY GKT K    R  IC  C+G G  ++            CK CK
Sbjct: 179 RGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKK----------YACKTCK 228

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           GQG   +   + P       + C  C G G         K+ C++C G G   + K+L V
Sbjct: 229 GQGVQTQTNRMGP-LVQSWSQTCADCGGAGIFV----ESKDICQQCQGLGFVKQRKILQV 283

Query: 229 SVPRGLRDGDTIKVVNEADQELG-------KPKTGDLIFSI--EEDQRCPKDVQLERKGS 279
           +V  G      I +  E D+ +        K   GD++ +I   +D R     Q+    +
Sbjct: 284 AVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPR----FQIVDDYN 339

Query: 280 NFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP--LNG 337
               +  + L  +L G    ++     G+++ L I PG+V++PG    +E  G P  +NG
Sbjct: 340 LIYKKCKVDLMTSLCG-GVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFING 398

Query: 338 EATKFGDLYISVNIEFP 354
             + FG +Y+   + +P
Sbjct: 399 VRSGFGHMYVKFEVTYP 415

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 46/73 (63%), Gaps = 5/73 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY  L V + A+ S+IKKAYR  AL++HPDK     ++  E S+ KF+EI  AYE L 
Sbjct: 5  TSLYDSLNVTATASTSEIKKAYRNAALKYHPDK-----NNHTEESKRKFQEICQAYETLK 59

Query: 62 DEDKRAHYDLYGS 74
          D   R+ YD YG+
Sbjct: 60 DNHLRSLYDQYGT 72

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 133/305 (43%), Gaps = 51/305 (16%)

Query: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168
           R PD+K  L  T++ELY GK  K    R   C +C G+G      G  T+     C  C+
Sbjct: 169 RGPDIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMG------GMNTII----CNECQ 218

Query: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228
           G+G   + +ML P         C  C G G ++  + S    CK+C GEG   E  + TV
Sbjct: 219 GKGINTETKMLGP-MVQSWSSTCFNCSGMG-YFIDSQS---GCKECQGEGYLRERTIFTV 273

Query: 229 SVPRGLRDGDTIKVVNEADQ-----ELGKPKT--GDLIFSIE--EDQRCPKDVQLERKGS 279
           +V  G+R+   I +  EADQ     +L K K   GD+I  I   E +    D  +++ G 
Sbjct: 274 TVKPGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQ-GE 332

Query: 280 N--------------FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNI 325
           N               +    I L  +L G  + ++     G+++ L I P ++++P  +
Sbjct: 333 NKNKFHFEIINEKDLLLRNCQIDLITSLCG-GEIYIKNHPSGKLIKLDIIPSEILKPDCL 391

Query: 326 IKIEQEGWPL-------NGEA-TKFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTS 377
             +E  G P        NGE     GDLYI   +++P      E   + ++++IL     
Sbjct: 392 KCVENLGMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTK---LENETIDKLRSILSEDIH 448

Query: 378 DKTKL 382
            K +L
Sbjct: 449 MKNEL 453

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 5/73 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY++L V + AT  +IK AY+KLAL++HPDK     ++  E S++KF+EI  AYE+L 
Sbjct: 12 TRLYSILQVPTAATLFEIKNAYKKLALKYHPDK-----NNHSEESKLKFQEICKAYEVLH 66

Query: 62 DEDKRAHYDLYGS 74
          D+DK+  YD YG+
Sbjct: 67 DKDKKLLYDTYGT 79

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 138/312 (44%), Gaps = 45/312 (14%)

Query: 108 KRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
           KR PD+K  LK T+  LY+GK  K + +R   C  C+G G    K+          C  C
Sbjct: 228 KRGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKS----------CSKC 277

Query: 168 KGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLT 227
            G+G   + +   P   T   + C  C G G  +A A   ++ C +C GEG   E K+  
Sbjct: 278 NGRGSLTQTKKFGPMTQTF-TQTCDGCGGNGT-FADA---QDICNECQGEGFLNEKKIFE 332

Query: 228 VSVPRGLRDGDTIKVVNEADQ----ELGKPKT--GDLIFSIEEDQRCPKDVQLERKGSNF 281
           V +  G+ DG  I +  EAD+     LGK +   GD+I +I      P       +G++ 
Sbjct: 333 VEITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTI---NLLPDPTFKVVQGADL 389

Query: 282 M-TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP------ 334
           +     I+L  +L G    ++       ++ ++I PG++I+ G I  +E  G P      
Sbjct: 390 LYANYKINLLTSLCG-GSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSV 448

Query: 335 ------LNGEATKFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS----D 384
                    + T  G+L I   I +P      E   + +++NIL      + +++    D
Sbjct: 449 GHSNDIQANKPTLKGNLVIHFEIVYPD---MLETDTVIELQNILNNDKYIQNQITEEEAD 505

Query: 385 DPLNTELLLKFE 396
           + ++ E L+++E
Sbjct: 506 NKVDLEDLVEYE 517

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%), Gaps = 5/73 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +L V  ++ +S IKKAYR LAL++HPDK     ++  E S+  F++IS AY +LS
Sbjct: 5  TQLYDILQVRYDSDESVIKKAYRTLALKYHPDK-----NNLSEESKQMFQKISEAYVVLS 59

Query: 62 DEDKRAHYDLYGS 74
          ++DKR  YD YG+
Sbjct: 60 NKDKRQMYDKYGT 72

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 120/279 (43%), Gaps = 55/279 (19%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y  LG+ SNA+ SDIKKAY KLA ++HPD       +  E +E KF ++  AYEIL
Sbjct: 45  IKDPYKTLGINSNASQSDIKKAYYKLAKKYHPD------INKEENAEAKFHDLQNAYEIL 98

Query: 61  SDEDKRAHYDLYG--SXXXXXXXXXXYDPFESF-FNFEQDEEP-----SRHYED------ 106
           SDE KR  YD +G  +           +PF S  F F     P       ++ED      
Sbjct: 99  SDEQKRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAF 158

Query: 107 -----------------PKRSPDVKIPLKMTIQE-LYNGKTFKFKFKRNVICDNCEGLGW 148
                              +   + +   +  ++ ++  K  K  F     C+ C G G 
Sbjct: 159 KQQHSNNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGL 218

Query: 149 RRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEK 208
           +   +       +  C+ C G G    +R    GF  +    C  C+G+G          
Sbjct: 219 KHNAH-------KSTCQTCNGTGTRVHIR---GGF--QMMSTCNDCNGEGTKI----DPN 262

Query: 209 NKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIKVVNEA 246
           + C  CHG+G+ F  +K +TV +P  L+DGD I+V N+ 
Sbjct: 263 DYCNHCHGDGVEFKRNKEITVDLPNALQDGDVIRVSNKG 301

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 84.0 bits (206), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 119/308 (38%), Gaps = 72/308 (23%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGV+ +A+ SDIK+AY KLA ++HPD       +    ++  F  +  AYEILSD
Sbjct: 48  DPYKTLGVSRDASPSDIKRAYYKLAKKYHPD------INKEPGADKTFHNLQNAYEILSD 101

Query: 63  EDKRAHYDLYGSXX----XXXXXXXXYDP-----------------FESFF--------- 92
           E K+  YD YGS              ++P                 FE  F         
Sbjct: 102 EKKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGF 161

Query: 93  -------NFEQDEEPSRHYEDPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEG 145
                   F       R Y+         +  K  +  L N      K+K    C  C G
Sbjct: 162 RNGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNN---VSLKYKSLDPCGTCHG 218

Query: 146 LGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKAN 205
            G    KNG+        C  C G G    V+    GF  +    C  C G+G   A+ +
Sbjct: 219 SGL---KNGE--QHKRKTCSYCNGTGTQVHVK---SGF--QMASTCMHCHGEGTTIARED 268

Query: 206 SEKNKCKKCHGEGLFAES-KVLTVSVPRGLRDGDTIKV----------VNEADQELGKPK 254
           +    C  C G+G+   S K L V+ P GL DGD I++          V E D+ + K  
Sbjct: 269 T----CSACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSI-KLS 323

Query: 255 TGDLIFSI 262
            GDL+  I
Sbjct: 324 RGDLLVRI 331

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 109/391 (27%), Positives = 159/391 (40%), Gaps = 88/391 (22%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y+VLGV ++A+ S+IKKAY KLA ++HPD  +N   D    +E KF ++  AYEIL
Sbjct: 77  IKDPYSVLGVNNSASTSEIKKAYYKLAKKYHPD--INKQPD----AEKKFHDLQNAYEIL 130

Query: 61  SDEDKRAHYDLYGSXX------------------------XXXXXXXXYDPFESF-FNFE 95
           SDE+KR  YD +G                                    +PF  F  NFE
Sbjct: 131 SDENKRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINFE 190

Query: 96  -----------------QDEEPSRHYEDPKRSPDVKIPLKMTIQE-LYNGKTFKFKFKRN 137
                            +    S  Y + K  P ++I   +  ++ ++  +    KF   
Sbjct: 191 DLFGAAFGNGPHATGGGRARRQSNIYREFKGDP-IEIVHNLNFKDAVFGVQNVNLKFNSM 249

Query: 138 VICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGK 197
             C+ C G G  R  N + T      C  C G G  +KV + + GF       C  C G+
Sbjct: 250 DPCNKCSGSGLNR--NAKRTT-----CPSCHGSG--QKVHIRS-GFQMVS--TCNHCHGE 297

Query: 198 GKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIKV------------VN 244
           G         K+ C  CHG+G+    +K + V++P GL+DGD I+V            ++
Sbjct: 298 GTII----DSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASID 353

Query: 245 EADQELGKPKTGDLIFSIEEDQRCPKDVQLE-RKGSNFMTELNISLAEALTGFKDKFVTK 303
            A     K   GDL+  +    R  KD     R   +      I +  A+ G   K    
Sbjct: 354 PAMMNSIKLSRGDLLVRV----RVNKDPNFSIRDKYDIWFTKQIPITTAILGGVVKI--P 407

Query: 304 TFDGRILNLSIPPGKVIRPGNIIKIEQEGWP 334
           T DG  + L + PG   +   II I   G P
Sbjct: 408 TVDGTQIRLKVSPG--TKHDQIISIPNLGVP 436

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 130/303 (42%), Gaps = 63/303 (20%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGVA +A+ S+IKKAY KLA ++HPD  +N   D    +E  F  +  AYEILSD
Sbjct: 56  DPYKTLGVARSASQSEIKKAYYKLAKKYHPD--INKEPD----AEKTFHNLQNAYEILSD 109

Query: 63  EDKRAHYDLYGSXXXXXXX-----XXXYDPFESFFNFEQDEEPSRHYED---------PK 108
           EDKRA +D +G+               ++PF +       +    ++ED           
Sbjct: 110 EDKRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAFGGGAS 169

Query: 109 RSPDVKIPLKMTIQELYNGKTFK----FKFKRNVI--------------CDNCEGLGWRR 150
              +     ++ +   Y G T +      FK  V               CD C G G ++
Sbjct: 170 GRSNGGFGSRVNMVREYKGDTIEIIHNLSFKDAVFGVNNVSLTFNALDPCDTCHGSGLKK 229

Query: 151 RKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNK 210
            +N +        C  C G G    VR    GF  +    C  C G+G   A     ++ 
Sbjct: 230 GENHK-----RRSCSYCNGTGTQIHVR---SGF--QMASTCNHCHGEGTIIA----FEDM 275

Query: 211 CKKCHGEGLFAES-KVLTVSVPRGLRDGDTIKV----------VNEADQELGKPKTGDLI 259
           C KCHG+G+  ++ K + V++P  L DGD I++          V E D++  K   GDL+
Sbjct: 276 CTKCHGDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLSRGDLL 335

Query: 260 FSI 262
             I
Sbjct: 336 VRI 338

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 108/400 (27%), Positives = 162/400 (40%), Gaps = 85/400 (21%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LG+  +AT ++IKKAY KLA ++HPD  +N   D    +E KF ++  AYEILSD
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD--INKEVD----AEKKFHDLQNAYEILSD 114

Query: 63  EDKRAHYD------------LYGSXXXXXXXXXXYDPFESFFNFEQDEEPSRHYED---- 106
           E+KR  YD              G           +  F  F N         ++ED    
Sbjct: 115 ENKRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFGGINFEDLFGA 174

Query: 107 --------------------PKRSPDVKIPLKMTIQE-LYNGKTFKFKFKRNVICDNCEG 145
                                 R   ++I  K++ ++ ++     + KF     C  C G
Sbjct: 175 AFGGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSG 234

Query: 146 LGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKAN 205
            G +   +       +V C  C G G T  +R    GF       C  C+G+G       
Sbjct: 235 TGMKPNTH-------KVNCSTCHGTGTTVHIR---GGFQMMST--CPTCNGEGT----MK 278

Query: 206 SEKNKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIK---------VVNEAD-QELGKPK 254
             ++ C KCHGEG+    +K +TV +P GL+DGD ++         +  EAD ++  K  
Sbjct: 279 RPQDSCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLS 338

Query: 255 TGDLIFSIEEDQRCPKDVQLERKGSN---FMTELNISLAEALTGFKDKFVTKTFDGRILN 311
            GD++  I    R  KD     K      +  E+ I+ A AL G        T +G+ + 
Sbjct: 339 RGDILVRI----RVDKDPNFSIKNKYDIWYDKEIPITTA-ALGG---TVTIPTVEGQKIR 390

Query: 312 LSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           + + PG   +   +I I   G P     T  GD+ I   I
Sbjct: 391 IKVAPG--TQYNQVISIPNMGVPKT--TTIRGDMKIQYKI 426

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 109/404 (26%), Positives = 161/404 (39%), Gaps = 88/404 (21%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LG+  +AT ++IKKAY KLA ++HPD  +N   D    +E KF ++  AYEILSD
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD--INKEPD----AEKKFHDLQNAYEILSD 114

Query: 63  EDKRAHYD-----------LYGSXXXXXXXXXXYDPFESF-----------FNFE----- 95
           + KR  +D             G+          +  F  F            NFE     
Sbjct: 115 DTKRQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGINFEDLFGA 174

Query: 96  ---------------QDEEPSRHYEDPKRSPDVKIPLKMTIQE-LYNGKTFKFKFKRNVI 139
                               S  Y   +  P ++I  K++ ++ ++  K  + KF     
Sbjct: 175 AFGGGGAGAGAGRGGSGGRSSPMYRQYRGDP-IEIVHKVSFKDAVFGAKNVQLKFSALDP 233

Query: 140 CDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGK 199
           C  C G G +   +       +V C  C G G T  VR    GF       C  C+G+G 
Sbjct: 234 CGTCSGTGMKPNTH-------KVSCTTCHGSGSTVHVR---GGFQMMS--TCPTCNGEG- 280

Query: 200 HYAKANSEKNKCKKCHGEGLFA-ESKVLTVSVPRGLRDGDTIK---------VVNEAD-Q 248
                   ++ C  CHGEG+ A   K +TV +P GL+DGD ++         +  EAD Q
Sbjct: 281 ---TMKRPQDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQ 337

Query: 249 ELGKPKTGDLIFSIEEDQRCPKDVQLE-RKGSNFMTELNISLAEALTGFKDKFVTKTFDG 307
           +  K   GD++  I  D    KD     R   +   +  I +  A  G        T DG
Sbjct: 338 DSIKLSRGDILVRIRVD----KDPSFSIRNKYDIWYDKEIPITTAALG--GTITIPTVDG 391

Query: 308 RILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           + + + + PG   +   +I I   G P    AT  GD+ +   I
Sbjct: 392 QKIRIKVAPG--TQYNQVISIPNMGVPRT--ATLRGDMKVQYKI 431

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 100/376 (26%), Positives = 156/376 (41%), Gaps = 74/376 (19%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGV  +A+ S+IKKAY KLA ++HPD      + D      KF ++  AYEILSD
Sbjct: 33  DPYDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGD------KFHDLQNAYEILSD 86

Query: 63  EDKRAHYD-----------LYGSXXXXXXXXXXYDPFESFFNF----------------- 94
            DK++ YD             G           +  F  F NF                 
Sbjct: 87  ADKKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGG 146

Query: 95  --EQDEEP--SRHYEDPKRSPDVKIPLKMTIQE-LYNGKTFKFKFKRNVICDNCEGLGWR 149
                  P  S  + + +  P +++  +M  ++ ++  K    KF+    C  C+G G +
Sbjct: 147 GRSSRGSPFGSSMFREYRGDP-IEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMK 205

Query: 150 RRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKN 209
                Q        C  C G G T  VR    GF  +    C+QC G+G         ++
Sbjct: 206 TGAKPQ-------SCPSCHGTGTTVHVRA---GF--QMATTCQQCGGEG----TTTKRED 249

Query: 210 KCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIKVVNEADQ-ELGKP---------KTGDL 258
            C  CHG+G+ + + K + V +P+GL+DGD ++V  +     +  P         + GD+
Sbjct: 250 LCGSCHGDGVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDV 309

Query: 259 IFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGK 318
           +  I  D+  P+    ++    F+ ++ I+ A AL G        T DG  + L + PG 
Sbjct: 310 LVRIRVDKD-PRFSIRDKWDIWFIQDIPITTA-ALGG---TVQVPTVDGSHVRLRVQPG- 363

Query: 319 VIRPGNIIKIEQEGWP 334
             +   II I   G P
Sbjct: 364 -TQHDQIISIPNMGVP 378

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 109/393 (27%), Positives = 156/393 (39%), Gaps = 96/393 (24%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y VLG+  +AT S+IKKAY KLA ++HPD       +    +E KF ++  AYEIL
Sbjct: 49  IKDPYKVLGINKSATSSEIKKAYYKLAKKYHPD------INKEPTAEKKFHDLQNAYEIL 102

Query: 61  SDEDKRAHYDLYGSXX-------------------XXXXXXXXYDPFESF-FNFEQ---- 96
           SDE K++ YD +GS                              +PF  F  NFE     
Sbjct: 103 SDETKKSQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINFEDLFGA 162

Query: 97  ----------------DEEPSRHYEDPKRSP---DVKIPLKMTIQELYNGKTFKFKFKRN 137
                               S  Y + K  P     +IP K  +  L N        K N
Sbjct: 163 AFGGGAGTGPGGARSGGARRSNMYREFKGDPLEITHRIPFKDAVFGLAN-----VSLKYN 217

Query: 138 VI--CDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCD 195
           V+  C  C G G ++            +C  C G G  +KV + + GF  +    C +C 
Sbjct: 218 VMDPCHTCHGSGIKQGAQKH-------QCPSCHGSG--QKVHIRS-GF--QMVSTCNECH 265

Query: 196 GKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIKVVNEA-------D 247
           G+G       +  + C  CHG+ + F     + V++P GL+DGD I++  +        D
Sbjct: 266 GEGTIL----NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALD 321

Query: 248 QELG---KPKTGDLIFSIEEDQRCPKDVQLERKGSN---FMTELNISLAEALTGFKDKFV 301
            EL    K   GD++  I    R  KD +   K      F  ++ I+ A AL G      
Sbjct: 322 PELKNSVKLTRGDVLVRI----RVDKDNRFSIKDKYDIWFTKDIPITTA-ALGGI---VT 373

Query: 302 TKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP 334
             T DG  L L +  G   +   +I I   G P
Sbjct: 374 IPTVDGTTLRLKVQAG--TQHDQVISIPNLGVP 404

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/72 (56%), Positives = 52/72 (72%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+S+A+D++IKK YRK AL++HPDK       D E    KFKEIS A+EILS
Sbjct: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG----DTE----KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D +KR+ YD YG
Sbjct: 57 DSNKRSVYDQYG 68

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A D +IKK YRK ALQ+HPDK   +          KFK+IS AYEILS
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTE--------KFKQISEAYEILS 56

Query: 62 DEDKRAHYDLYG 73
          D +KR  YD YG
Sbjct: 57 DSNKREVYDQYG 68

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G G   E K + + + RG + G  I   NE D     P+TG    L F ++E        
Sbjct: 195 GPGGSQEKKQIDIQLKRGWKAGTKITYKNEGD---FNPRTGGRKTLQFVLQEKAHP---- 247

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEG 332
             +R G N +  + +S  E+L GF      +T DGR L+LS    + I+P        +G
Sbjct: 248 LFKRDGENLLYTVPLSFQESLLGFSK--TVQTIDGRSLSLSRT--QPIQPTETTTYPGQG 303

Query: 333 WPLNGEATKFGDLYISVNIEFP 354
            P      + GDL I+  I++P
Sbjct: 304 MPNPKNPNQRGDLIITYKIDYP 325

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A D +IKK YRK AL++HPDK     + D E    KFKEIS A+EILS
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKP----TGDTE----KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D++KR  YD YG
Sbjct: 57 DKNKREVYDQYG 68

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A+D+++KK YRK AL++HPDK              KFKEIS A+EILS
Sbjct: 5  TKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D +KR  YD YG
Sbjct: 57 DPNKREVYDTYG 68

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 14/142 (9%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G+    E K + + +  G + G  I   NE D     P TG    + F I+E    P + 
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYN---PSTGGRQTIQFIIQEK---PHEF 257

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEG 332
             +R G++ +  L ++  E+L GF DK V +T DGR   +SI   + ++P   ++   +G
Sbjct: 258 -FKRDGNDLIYTLPLTFKESLLGF-DKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQG 312

Query: 333 WPLNGEATKFGDLYISVNIEFP 354
            PL+   ++ GDL +    ++P
Sbjct: 313 MPLSKNPSERGDLIVKYKTDYP 334

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 47/72 (65%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A D +IKK YRK AL++HPDK   +          KFKEIS A+EILS
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTE--------KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D +KR  YD YG
Sbjct: 57 DSNKREVYDQYG 68

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 16/143 (11%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G+    E   + + +  G + G  I   N  D     P TG    L F I+E        
Sbjct: 210 GQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYN---PSTGGRKTLQFVIKEKVHP---- 262

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLS-IPPGKVIRPGNIIKIEQE 331
             +R+    +  L ++  E+L GF+     +T DGR L +S + P   ++P +      +
Sbjct: 263 NFKREDDTLVYYLPLTFKESLLGFQK--TIQTIDGRTLPISRVQP---VQPNDSSTYPGQ 317

Query: 332 GWPLNGEATKFGDLYISVNIEFP 354
           G P+  +  + GD+ +   IE+P
Sbjct: 318 GMPMTKKPGQRGDMIVKYKIEYP 340

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV   AT  +IKKAYRK ++Q HPDK    N DD  A+E +F+ IS AY++LS
Sbjct: 5  TGYYEILGVTPTATAVEIKKAYRKKSVQEHPDK----NRDDPMATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          DED R  YD +G
Sbjct: 60 DEDLRGKYDRFG 71

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (66%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV  +A + +IKK YRK AL++HPDK     + D E    KFK+IS AYEILS
Sbjct: 5  TKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKP----TGDTE----KFKQISEAYEILS 56

Query: 62 DEDKRAHYDLYG 73
          D +KR  YD YG
Sbjct: 57 DSNKREIYDQYG 68

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 8/139 (5%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLE 275
           G G   E   + + +  G + G  +   N+ D          L F I+E          +
Sbjct: 216 GPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPHP----TFQ 271

Query: 276 RKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPL 335
           R+  N +  + ++  E+L GF      +T DGR  NL I   + I+P  I +   +G P+
Sbjct: 272 REDDNLVCTVPLTFKESLLGFSK--TVQTIDGR--NLPISRSQPIQPTEITRYPGQGMPI 327

Query: 336 NGEATKFGDLYISVNIEFP 354
           + +  + GDL +   I +P
Sbjct: 328 SKKPGQRGDLIVKYKIAYP 346

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LG++ +A +++IKK YRK AL++HPDK              KFKEIS A+EILS
Sbjct: 5  TKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DAQKREVYDTYG 68

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G G  +E   + + +  G + G  I    E D     P+TG    L F ++E    P + 
Sbjct: 209 GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYN---PRTGGRQTLQFVLQEK---PHEF 262

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEG 332
              R+ ++ +  L +S  E+L GF  +   +T DG+   + I   + I+P        +G
Sbjct: 263 -FTRQDNDLIYTLPLSFKESLLGFSKQ--VQTIDGK--TIPITRTQPIQPTQTSTYPGQG 317

Query: 333 WPLNGEATKFGDLYISVNIEFP 354
             L+   ++ GDL I   I++P
Sbjct: 318 MTLSKNPSQRGDLIIKFKIDYP 339

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y VLGV+  AT  +IKKAYRK A+Q HPDK    N DD EA E KF+ +  AY++LS
Sbjct: 5  TEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDK----NPDDPEA-ETKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D + R+ YD +G
Sbjct: 60 DTELRSRYDQFG 71

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSD-DREASEIKFKEISAAYEI 59
           M D Y +LG++S+A+D DIK AYRKL+L+ HPDK+    S+ DRE  E ++ +I+ AYE 
Sbjct: 119 MFDPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYES 178

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 179 LTDELIRFNYLTYG 192

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 129/298 (43%), Gaps = 43/298 (14%)

Query: 104 YEDPKRSPDVKIPLKMTIQE-LYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEV 162
           Y + + SP ++I  +++ ++ ++  K    K+     C+ C+G G +   +         
Sbjct: 174 YREYQGSP-IEISHRISFKDSVFGTKNVNLKYSAYDPCNTCDGSGLKPGAS-------RS 225

Query: 163 ECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FA 221
            C  C G G    VR    GF  +    C QC G+G     A++    C+ CHGEG    
Sbjct: 226 TCPGCSGTGTRVHVRA---GF--QMASTCNQCGGEGSVLRDADT----CQTCHGEGAKLD 276

Query: 222 ESKVLTVSVPRGLRDGDTIKV----------VNEADQELGKPKTGDLIFSIEEDQRCPKD 271
           ++  L V +P GL+DGD I++          V+ A ++  +   GDL+  I  D    KD
Sbjct: 277 KNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSRGDLLLRIRVD----KD 332

Query: 272 VQLERKGSN---FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKI 328
            + + K      F  ++ I+ A AL G        T DG  + L + PG   +  +++ I
Sbjct: 333 PRFQIKNKYDIWFTQDIPITTA-ALGGV---VTIPTVDGEQVRLKVSPG--TQHHDVVSI 386

Query: 329 EQEGWPLNGEATKFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDP 386
            Q+G P     T+ GD+ +   +         EK     + +I   S++ ++ LS  P
Sbjct: 387 PQKGVPRGSFGTR-GDMKVQYRVVIKKPQSQAEKCLWEALADISGDSSAKRSVLSSQP 443

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%), Gaps = 6/73 (8%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y+ LGV+++AT S+IKKAY KLA ++HPD  +N  +D    ++ KF ++  AYEIL
Sbjct: 37  LKDPYSTLGVSNSATSSEIKKAYYKLAKKYHPD--INKAAD----AQKKFHDLQNAYEIL 90

Query: 61  SDEDKRAHYDLYG 73
           SD+ KR  +D YG
Sbjct: 91  SDDCKRQQWDQYG 103

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 52/91 (57%), Gaps = 5/91 (5%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y VLGV  +AT   IKKAYRK A+Q HPDK    N +D EA + KF+E+S AY++LS
Sbjct: 5  TKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDK----NPNDPEA-QAKFQEVSKAYKVLS 59

Query: 62 DEDKRAHYDLYGSXXXXXXXXXXYDPFESFF 92
          D + R+ YD  G            DPFE   
Sbjct: 60 DGELRSRYDEVGLSDERGDVMMEEDPFEMLM 90

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ N  D+++KK YRK AL++HPDK       D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG----DTE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D +KR  YD YG
Sbjct: 57 DPNKREVYDKYG 68

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 61/136 (44%), Gaps = 14/136 (10%)

Query: 222 ESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGD---LIFSIEEDQRCPKDVQLERKG 278
           E K + + +  G + G  I   NE D     P TG    L F I+E      D  L+R G
Sbjct: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYN---PSTGGRQTLQFIIQEKMH---DF-LKRDG 260

Query: 279 SNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGE 338
           ++    L +S  E+L GF       T DGR   + I   + ++P    +   +G PL+  
Sbjct: 261 NDLTYTLPLSFKESLLGFSK--TVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKN 316

Query: 339 ATKFGDLYISVNIEFP 354
            ++ GDL +   I++P
Sbjct: 317 PSERGDLIVKYKIDYP 332

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+++ ATD +IKKAYRK +++ HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TEYYDLLGISTTATDIEIKKAYRKKSIKEHPDK----NPNDPSATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D+  R++YD YG
Sbjct: 60 DKQLRSNYDKYG 71

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV++ A+  +IKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++L 
Sbjct: 5  TEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDK----NPNDPTATE-RFQAISEAYQVLG 59

Query: 62 DEDKRAHYDLYG 73
          D+D RA YD YG
Sbjct: 60 DDDLRAKYDKYG 71

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 47/72 (65%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A + ++KK Y+K AL++HPDK       D E    KFKEIS AYEILS
Sbjct: 5  TKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAG----DTE----KFKEISEAYEILS 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DSSKREIYDQYG 68

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 16/137 (11%)

Query: 222 ESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGD---LIFSIEEDQRCPKDVQLERKG 278
           E   + + +  G + G  I   NE D     P+TG    L F ++E          +R G
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYN---PQTGGRKTLQFVLQEKSHP----LYKRDG 270

Query: 279 SNFMTELNISLAEALTGFKDKFVTKTFDGRILNLS-IPPGKVIRPGNIIKIEQEGWPLNG 337
            N +  L +S  E+L GF      +T DGR L +S I P   ++P  +     +G P++ 
Sbjct: 271 DNLIYSLPLSFKESLLGFSK--TIQTIDGRTLPISKIQP---VQPTEVSSYPGQGMPVSK 325

Query: 338 EATKFGDLYISVNIEFP 354
              + GDL +   I++P
Sbjct: 326 RPGQRGDLVVKYKIDYP 342

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (62%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LG++ +A + +IKK YRK AL++HPDK              KFKEIS A+EILS
Sbjct: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREVYDQYG 68

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A ++++KK YRK AL++HPDK     S D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPSAQETELKKGYRKAALKYHPDK----PSGDAE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREVYDTYG 68

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (71%), Gaps = 4/71 (5%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV S A+D+D+KKAYR+ ALQ+HPDK + +    ++A+EI F  I AAYE+LS
Sbjct: 3  TCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNV---QQATEI-FASIRAAYEVLS 58

Query: 62 DEDKRAHYDLY 72
          D  +RA YD +
Sbjct: 59 DAQERAWYDAH 69

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV S+A+D ++KKAYRK ALQ+HPDK    N D+ E +  KF  I AAYE+LSD  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK----NPDNVEEATEKFAIIRAAYEVLSDSQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV S+A+D ++KKAYRK ALQ+HPDK    N D+ E +  KF  I AAYE+LSD  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK----NPDNVEEATQKFAIIRAAYEVLSDSQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 47/72 (65%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +L V+  A + +IKK YRK AL++HPDK     + D E    KFKEIS A+EILS
Sbjct: 5  TGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKP----TGDTE----KFKEISEAFEILS 56

Query: 62 DEDKRAHYDLYG 73
          D +KR  YD YG
Sbjct: 57 DAEKREVYDQYG 68

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 49/71 (69%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y +L V   ATDSDIKKAYRKLA++ HPDK  NS+    EA    FK I+ A+E+LS+
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDK--NSHPKAGEA----FKVINRAFEVLSN 74

Query: 63 EDKRAHYDLYG 73
          E+KR+ YD  G
Sbjct: 75 EEKRSIYDRIG 85

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 123/284 (43%), Gaps = 42/284 (14%)

Query: 113 VKIPLKMTIQELYNG-KTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           + +P  ++ ++   G K  K K+     C  C G G +       +      C +C G G
Sbjct: 191 IHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGSGLK-------SGAKRSSCSICHGTG 243

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSV 230
               VR    GF  +    C QC+G+G    +++    +C  C GEG+ F   K + V +
Sbjct: 244 TQMHVRA---GF--QMASTCTQCNGEGSSIRRSD----QCSSCRGEGVVFNRQKEIDVDL 294

Query: 231 PRGLRDGDTIKVVNEA-------DQELG---KPKTGDLIFSIEEDQRCPKDVQLERKGSN 280
           P GL+DGD +KV ++        D E+    + + GDL+  I    R  +D + + + + 
Sbjct: 295 PHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQI----RVERDPRFQIRNNY 350

Query: 281 ---FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNG 337
              +  ++ I+ A AL G  +     T DG  L L I PG   +   ++ +  +G P   
Sbjct: 351 DIWYTQDIPITTA-ALGGVVN---IPTVDGEQLRLKIAPG--TQHEQVVSVPNKGVPKGL 404

Query: 338 EATKFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTK 381
            A++ GD+ +   I         EK     + ++   +T+ +T+
Sbjct: 405 TASR-GDMKVQYKISLRKPQSKAEKYLWEALADVTGDNTAKRTE 447

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 50/74 (67%), Gaps = 6/74 (8%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y  LGV+ +A+ S IKKAY KLA ++HPD  +N +    E +E KF ++  AYEIL
Sbjct: 49  IRDPYETLGVSRDASTSQIKKAYYKLAKKYHPD--INKD----EGAEKKFHDLQNAYEIL 102

Query: 61  SDEDKRAHYDLYGS 74
           SDE KR+ YD +G+
Sbjct: 103 SDESKRSQYDQFGA 116

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 51/72 (70%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+ + AT  +IKKAYRK +++ HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TEYYELLGIETTATAVEIKKAYRKKSIEEHPDK----NPNDPGATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D D RA+YD +G
Sbjct: 60 DSDLRANYDKFG 71

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 52/72 (72%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          ++ Y +LGV++ AT  +IKKAYRK ++Q HPDK    N +D +A+E +F+ IS AY++L 
Sbjct: 5  SEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDK----NPNDPKATE-RFQAISEAYQVLG 59

Query: 62 DEDKRAHYDLYG 73
          D++ RA YD YG
Sbjct: 60 DDELRAKYDKYG 71

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A ++++KK YRK AL++HPDK     + D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPSAQETELKKGYRKAALKYHPDKP----TGDAE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREIYDNYG 68

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 16/143 (11%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G G   E + + + +  G + G  I   NE D     P+TG    + F I+E    P + 
Sbjct: 205 GPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYN---PRTGRRQTMQFIIQEK---PHE- 257

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLS-IPPGKVIRPGNIIKIEQE 331
              R G++ +  L ++  E+L GF      +T DGR L +S + P   ++P ++     +
Sbjct: 258 NYTRDGNDLIYTLPLTFKESLLGFNK--TIQTIDGRTLPISRVQP---VQPSDVSTYPGQ 312

Query: 332 GWPLNGEATKFGDLYISVNIEFP 354
           G P+    ++ G+L +   I++P
Sbjct: 313 GMPVAKNPSQRGNLIVKYKIDYP 335

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV ++A+D ++KKAYRK ALQ+HPDK    N D+ E +  KF  I AAYE+LSD  
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDK----NPDNVEEATQKFAVIRAAYEVLSDPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A + ++KK YRK AL++HPDK       D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTG----DTE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREIYDQYG 68

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV + A+DSD+KKAYR+ ALQ+HPDK    N D+ E +   F  I +AYE+L+D  
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDK----NPDNVEEATTVFATIRSAYEVLADPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (63%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+  A + ++KK YRK AL++HPDK       D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG----DTE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DSQKREIYDQYG 68

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (63%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+  A + ++KK YRK AL++HPDK       D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG----DTE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DSQKREIYDQYG 68

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 63/138 (45%), Gaps = 16/138 (11%)

Query: 221 AESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGD---LIFSIEEDQRCPKDVQLERK 277
           +E   + + + +G + G  I   NE D     P+TG    L F ++E          +R 
Sbjct: 229 SEKTQIDIQLKQGWKAGTKITYKNEGDYN---PRTGGRKTLQFVLQEKAHP----LFKRD 281

Query: 278 GSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLS-IPPGKVIRPGNIIKIEQEGWPLN 336
           G N +  L +S  E+L GF      +T DGR L +S + P   I+P    +   +G P+ 
Sbjct: 282 GDNLIYTLPLSFKESLLGFSK--TIQTIDGRTLPISRVQP---IQPSESSRYPGQGMPIT 336

Query: 337 GEATKFGDLYISVNIEFP 354
            +  + GDL +   I++P
Sbjct: 337 KKPGQRGDLIVKYKIDYP 354

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+ +A + ++KK YRK AL++HPDK              KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREIYDSYG 68

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 64/142 (45%), Gaps = 14/142 (9%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEAD--QELGKPKTGDLIFSIEEDQRCPKDVQ 273
           G G   E K + + +  G + G  I   NE D  Q+ G  +T  + F I+E         
Sbjct: 203 GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQT--MQFVIQEKLHP----H 256

Query: 274 LERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLS-IPPGKVIRPGNIIKIEQEG 332
            +R G+N +  L +S  E+L GF      +T DGR L +S + P   I+P        +G
Sbjct: 257 FKRDGNNLIYTLPLSFKESLLGFSK--TIQTIDGRTLPISRVQP---IQPSETSTYPGQG 311

Query: 333 WPLNGEATKFGDLYISVNIEFP 354
            PL     + GDL I   +++P
Sbjct: 312 MPLPKTPAQRGDLIIKYKVDYP 333

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV   ATD +IKKAYRK ++  HPDK    N DD  A+E +F+ IS AY++LS
Sbjct: 5  TEYYDLLGVEVTATDVEIKKAYRKKSILEHPDK----NRDDPAATE-RFQSISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          ++D RA+YD  G
Sbjct: 60 NKDLRANYDKSG 71

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+  A + ++KK YRK AL++HPDK       D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTG----DTE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D+ KR  YD YG
Sbjct: 57 DKQKREIYDQYG 68

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 14/142 (9%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G G   E   + + +  G + G  +   N  D     P+TG    L F I+E        
Sbjct: 218 GPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYN---PRTGGRKTLQFVIQEKTHP---- 270

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEG 332
             +R G +    L ++  E+L GF      +T DGR L LS      ++P    +   +G
Sbjct: 271 LYKRNGDDLEYTLPLTFKESLLGFSK--TIQTIDGRTLPLSR--SSPVQPTETSRYPGQG 326

Query: 333 WPLNGEATKFGDLYISVNIEFP 354
            P+    ++ GDL +   I++P
Sbjct: 327 MPMPKMPSQRGDLVVRFKIDYP 348

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+  A + ++KK YRK AL++HPDK              KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DAQKREIYDQYG 68

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y VLGV   AT +DIKKAYRK A+Q HPDK    + DD EA + KF+ +  AY++LS
Sbjct: 5  TEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDK----HPDDPEA-QSKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSKYDQFG 71

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV++ A+  +IKKAYRK ++Q HPDK    N +D +A+E +F+ IS AY++L 
Sbjct: 5  TEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK----NPNDLKATE-RFQAISEAYQVLG 59

Query: 62 DEDKRAHYDLYG 73
          D++ RA YD +G
Sbjct: 60 DDELRAKYDKFG 71

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 46/68 (67%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGV  +AT  D++++Y +L  + HPDK  N N + R+ +E K  EI+ AYEILSD
Sbjct: 528 DYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSD 587

Query: 63  EDKRAHYD 70
           +DKR  YD
Sbjct: 588 DDKRTKYD 595

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+  A + ++KK YRK AL++HPDK              KFKEIS A+EIL+
Sbjct: 5  TKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREIYDQYG 68

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV  +A   DIKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 6  TTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDK----NPNDPTATE-RFQAISQAYQVLS 60

Query: 62 DEDKRAHYDLYG 73
           ED RA YD YG
Sbjct: 61 KEDLRAKYDKYG 72

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LG+   AT ++IKKAYRK +++ HPDK    N +D  A+E +F++IS AY++LS
Sbjct: 5  TTYYDILGITPTATQAEIKKAYRKKSIKEHPDK----NPNDPTATE-RFQQISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          DE  R +YD +G
Sbjct: 60 DEHLRNNYDQFG 71

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 47/72 (65%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGV+ NA   +I+KAY  L  ++HPDK+  +++D +E+      +I+ AYE LSD
Sbjct: 542 DYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSD 601

Query: 63  EDKRAHYDLYGS 74
           EDKR  YDL  S
Sbjct: 602 EDKRKEYDLSKS 613

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y  LG++  AT ++IKKAYR+ A++ HPDK    + DD EA E KF+ +  AY++LS
Sbjct: 5  TEYYDRLGISPTATPTEIKKAYRRKAMETHPDK----HPDDPEA-ENKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          DE  RA YD YG
Sbjct: 60 DESLRARYDEYG 71

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +L V S+A+D D+KKAYR+ ALQ+HPDK    N D+ E +   F EI AAYE+LSD  
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDK----NPDNVEEATTIFAEIRAAYEVLSDPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y +L V   ATDS+IKKAYRKLA++ HPDK  NS+    EA    FK I+ A+E+LS+
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDK--NSHPKAGEA----FKVINRAFEVLSN 74

Query: 63 EDKRAHYDLYG 73
          E+KR+ YD  G
Sbjct: 75 EEKRSIYDRIG 85

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 51/83 (61%), Gaps = 4/83 (4%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +L V S+ATD+D+K+AYRK AL +HPDK  N   +  EA+E+ F +I AAYE+LSD  
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRN---NIEEATEV-FAQIRAAYEVLSDAQ 61

Query: 65 KRAHYDLYGSXXXXXXXXXXYDP 87
          +RA YD +            YD 
Sbjct: 62 ERAWYDAHKDQILNDSIDDAYDS 84

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-NSDDREASEIKFKEISAAYEI 59
           + D Y +LG++++A+D DIK AYRKL+++ HPDKV     SD++   E  + +I+ AYE 
Sbjct: 123 LFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYES 182

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVV-NSNSDDREASEIKFKEISAAYEI 59
           + D YA+LGV+ +ATD DIK AYRKL+++ HPDK+  +   ++R   E  + +IS AYE 
Sbjct: 121 LFDPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEA 180

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  +A+Y  YG
Sbjct: 181 LTDEITKANYLTYG 194

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 111/275 (40%), Gaps = 35/275 (12%)

Query: 123 ELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPG 182
            ++  K    KF     C  C+G G +   +          C  C G G    +R    G
Sbjct: 189 SVFGTKNVNLKFSAYDPCGTCDGSGLKPGAS-------RTTCPGCSGTGTRVHIRA---G 238

Query: 183 FATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIK 241
           F  +    C QC G+G        + + C  CHGEG    +   + V +P GL+DGD I+
Sbjct: 239 F--QMASTCNQCGGEGS----VVRDSDTCATCHGEGASLNKDHAIKVDLPHGLQDGDVIR 292

Query: 242 V----------VNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291
           +          V+ A ++  +   GD++  I  D+  P+  Q++ K   ++T+       
Sbjct: 293 ISGQGSYPNIAVDPAMKDTVRLSRGDVLLRIRVDKD-PR-FQIKNKYDIWLTQDIPITTA 350

Query: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351
           AL G        T DG  + L + PG   +  +++ I Q+G P     ++ GD+ +   I
Sbjct: 351 ALGGI---VTVPTVDGEQVRLKVAPG--TQHNDVVSISQKGVPRGAFGSR-GDMKVQYKI 404

Query: 352 EFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDP 386
                    E+     + ++   + + ++ LS  P
Sbjct: 405 SIKKPQSQAERCLWEALADVTGDTLARRSVLSSQP 439

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 6/73 (8%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D YA LGV+ +A+ S+IKKAY KLA ++HPD  +N   D    ++ KF ++  AYEIL
Sbjct: 38  LKDPYATLGVSKSASGSEIKKAYYKLAKKYHPD--INKAED----AQKKFHDLQNAYEIL 91

Query: 61  SDEDKRAHYDLYG 73
           SD+ KR  +D +G
Sbjct: 92  SDDSKRQQWDQFG 104

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV +NATD ++KKAYR+ ALQ HPDK    N D+ E +   F  + AAYE+L+D  
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDK----NPDNVEETTAIFASVRAAYEVLADPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 5/91 (5%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +L V+ +A+  +IKK+YRKLA++ HPDK    N DD +A + KF+E++ AY++L 
Sbjct: 5  TTYYDILQVSVDASPQEIKKSYRKLAIKTHPDK----NPDDPQA-QTKFQELAKAYQVLI 59

Query: 62 DEDKRAHYDLYGSXXXXXXXXXXYDPFESFF 92
          D+D R  YD +G            DP+E   
Sbjct: 60 DDDLRKKYDQFGLDETNGEIPMDQDPYEMLM 90

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV S+A+D ++KKAYRK ALQ+HPDK    N D+ + +  KF  I AAYE+LSD  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK----NPDNVQEATEKFAIIRAAYEVLSDPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y VLGV   AT ++IKKAYR+ A+Q HPDK    + DD EA + KF+E+  AY++LS
Sbjct: 5  TGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDK----HPDDPEA-QAKFQEVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSRYDEFG 71

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LG+  +AT  +IKKAYRK +++ HPDK    N +D +A+E +F+ IS AY++LS
Sbjct: 5  TAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDK----NPNDPQATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          DE  R  YD YG
Sbjct: 60 DESLRLKYDKYG 71

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 6/72 (8%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y  LGVA +A+ S IKKAY KLA Q HPD  +N +    E +E KF ++  AYEIL
Sbjct: 39  IRDPYETLGVAKDASASQIKKAYYKLAKQFHPD--INKD----EGAEKKFHDLQNAYEIL 92

Query: 61  SDEDKRAHYDLY 72
           SDE+KR  YD +
Sbjct: 93  SDENKRRQYDQF 104

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 110/254 (43%), Gaps = 42/254 (16%)

Query: 113 VKIPLKMTIQELYNG-KTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171
           +++P K++ ++   G K    ++     C  C G G +     Q +V     C  C G G
Sbjct: 175 IQVPFKLSFRDAVFGLKDVPLRYAVYDQCGTCSGSGLK--AGAQRSV-----CGGCHGTG 227

Query: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSV 230
               VR    GF  +    C QC G+G    + +    +C  C GEG+ F  +K + +  
Sbjct: 228 TQVHVRA---GF--QMASTCSQCSGEGYSIRRGD----RCGTCSGEGVVFNRNKEVKMDF 278

Query: 231 PRGLRDGDTIKV----------VNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSN 280
           P GL+DGD +KV          V+       + + GDL+  ++ +    +D + + K + 
Sbjct: 279 PHGLQDGDVVKVPGQGSFPHIQVDPKTAHTMRLRRGDLLVQVQVE----RDPRFQIKNNY 334

Query: 281 ---FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNG 337
              ++ E+ I+ A AL G        T DG  + L + PG   +P  ++ I  +G P  G
Sbjct: 335 DIWYVQEIPITTA-ALGG---TVSIPTVDGDQIRLKVIPG--TQPDQVVSIPNKGVP-RG 387

Query: 338 EATKFGDLYISVNI 351
            +   GD+ +   I
Sbjct: 388 LSGARGDMKVQYRI 401

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGVA++A   DIKKAYRK +++ HPDK    N DD  A+E +F+ IS AY++LS
Sbjct: 5  TTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDK----NPDDPTATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
           E+ R  YD +G
Sbjct: 60 SEELRMKYDKFG 71

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +LGV+  A + ++KK YRK AL++HPDK              KFKEIS A+EIL+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D + R  YD YG
Sbjct: 57 DPNTREVYDQYG 68

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 14/142 (9%)

Query: 216 GEGLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDV 272
           G G   E   + + +  G + G  +   N+ D     P++G    L F I+E        
Sbjct: 182 GPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYN---PRSGGRKTLQFVIQEKAHP---- 234

Query: 273 QLERKGSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEG 332
             +R G + +  L +S  E+L GF       T DGR L LS    + I+P  I     +G
Sbjct: 235 DFKRDGDDLIYILRLSFKESLLGFSK--TINTIDGRKLPLSR--SQPIQPTEISTYPGQG 290

Query: 333 WPLNGEATKFGDLYISVNIEFP 354
            P++   ++ G+L I   I++P
Sbjct: 291 MPVSKNPSQRGNLIIKYKIDYP 312

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV+ +A   DIKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDK----NPNDPTATE-RFQAISQAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
           +D RA YD +G
Sbjct: 60 KDDLRAKYDKFG 71

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y VLG+   AT ++IKKAYR+ A++ HPDK    + DD  ASE +F+++  AY++LS
Sbjct: 5  TEYYDVLGIPPTATATEIKKAYRRKAMETHPDK----HPDDPTASE-RFQQVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D D R  YD +G
Sbjct: 60 DPDLRKQYDEFG 71

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LG++ +AT  +IKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TAYYELLGISPSATAIEIKKAYRKKSIQEHPDK----NPNDPTATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D+  R  YD YG
Sbjct: 60 DDTLRLKYDKYG 71

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 52/72 (72%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV  N+TD +IKKAYRK +++ HPDK  N N+ D   +  KF+ IS AY++LS
Sbjct: 5  TEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDK--NPNNPD---ATKKFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D++ R++YD +G
Sbjct: 60 DKNLRSNYDKFG 71

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y VLGVA  AT  +I+KAY  L  ++HPDK+  +++D  E       +I+ AYE LSD
Sbjct: 535 DYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSD 594

Query: 63  EDKRAHYDL 71
           +DKR  YDL
Sbjct: 595 DDKRKEYDL 603

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-NSDDREASEIKFKEISAAYEI 59
           + D Y +LG++S+A+D DIK AYRKL+++ HPDK+     +D+++  E  + +I+ AYE 
Sbjct: 123 LFDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYES 182

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 63.2 bits (152), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 49/71 (69%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y +L V   ATD +IKKAYRKLA++ HPDK    NS  R ASE  FK I+ A+E+LS+
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDK----NSHPR-ASE-AFKVINRAFEVLSN 74

Query: 63 EDKRAHYDLYG 73
          E+KR+ YD  G
Sbjct: 75 EEKRSIYDRIG 85

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV++ A+  +IKKAYRK ++Q HPDK    N +D +A+E +F+ IS AY++L 
Sbjct: 5  TEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK----NPNDPKATE-RFQAISEAYQVLG 59

Query: 62 DEDKRAHYDLYG 73
          D + R  YD YG
Sbjct: 60 DNELRVKYDKYG 71

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV + A+D+D+KKAYRK AL +HPDK    N D+ E +   F  I AAYE+L+D  
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDK----NRDNVEEATAIFATIRAAYEVLADPQ 61

Query: 65 KRAHYDLY 72
          +RA YD +
Sbjct: 62 ERAWYDSH 69

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV+ NA   +IKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDK----NPNDPSATE-RFQSISQAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          +E+ R  YD +G
Sbjct: 60 NEELRTKYDKFG 71

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+  +AT ++IKKAYRK A++ HPDK    + DD +A + KF+ +  AY++LS
Sbjct: 5  TEYYDILGIQPSATSTEIKKAYRKKAMETHPDK----HPDDPDA-QSKFQSVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D+D R  YD +G
Sbjct: 60 DDDLRKRYDEFG 71

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +LGV+S A D ++KKA+R+ ALQ+HPDK    N D+ E +   F +I AAYE+L+D 
Sbjct: 5  YYELLGVSSTADDLELKKAFRRKALQYHPDK----NRDNVEEATETFAQIRAAYEVLNDP 60

Query: 64 DKRAHYDLYGS 74
           +RA YD + S
Sbjct: 61 QERAWYDSHKS 71

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LG+  NAT  +IKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TAYYDLLGITPNATSIEIKKAYRKKSVQEHPDK----NPNDPGATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          +++ RA YD  G
Sbjct: 60 NDELRAKYDRLG 71

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 5/69 (7%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LG+   AT  +IKKAYRK ++Q HPDK    N +D  A+E +F+ IS AY++LS E+
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDK----NPNDPTATE-RFQAISEAYQVLSSEE 62

Query: 65 KRAHYDLYG 73
           RA YD +G
Sbjct: 63 LRAKYDKFG 71

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 125/305 (40%), Gaps = 47/305 (15%)

Query: 109 RSPDVKIPLKMTIQE-LYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLC 167
           R   ++I  K++ ++ ++  K  + +F     C  C G G +   +       +V C  C
Sbjct: 198 RGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTH-------KVSCSTC 250

Query: 168 KGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVL 226
            G G T  +R    GF       C  C+G+G         ++ C KCHGEG+    +K +
Sbjct: 251 HGTGTTVHIR---GGFQMMST--CPTCNGEGT----MKRPQDNCTKCHGEGVQVNRAKTI 301

Query: 227 TVSVPRGLRDGDTIK---------VVNEAD-QELGKPKTGDLIFSIEEDQRCPKDVQLER 276
           TV +P GL+DGD ++         +  EAD ++  K   GD++  I  D    KD     
Sbjct: 302 TVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD----KDPNFSI 357

Query: 277 KGSN---FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGW 333
           K      +  E+ I+ A AL G        T +G+ + + + PG   +   +I I   G 
Sbjct: 358 KNKYDIWYDKEIPITTA-ALGG---TVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGV 411

Query: 334 PLNGEATKFGDLYISVNIEFPPDNWFTEKSDLTQIKNI----LPRSTSDKTKLSDDPLNT 389
           P    +T  GD+ +   I         EK     + ++    + + T      +   +N 
Sbjct: 412 PKT--STIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTNDDMAKKTMQPGTAAGTAINE 469

Query: 390 ELLLK 394
           E+L K
Sbjct: 470 EILKK 474

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LG+  +AT ++IKKAY KLA ++HPD  +N   D    +E KF ++  AYEILSD
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD--INKEPD----AEKKFHDLQNAYEILSD 114

Query: 63  EDKRAHYD 70
           E KR  YD
Sbjct: 115 ETKRQQYD 122

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T LY +L V   A + ++KK YRK AL++HPDK       D E    KFKEIS A+EIL+
Sbjct: 5  TKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTG----DTE----KFKEISEAFEILN 56

Query: 62 DEDKRAHYDLYG 73
          D  KR  YD YG
Sbjct: 57 DPQKREIYDQYG 68

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 14/136 (10%)

Query: 222 ESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGD---LIFSIEEDQRCPKDVQLERKG 278
           E   + + +  G + G  I   ++ D     PKTG    L F I E          +R+ 
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYN---PKTGGRKTLQFIISEKPHP----HFKRED 280

Query: 279 SNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGE 338
            N +  L ++  E+L GF      +T DG+  NL +  G+ ++P        +G P+  +
Sbjct: 281 DNLIYTLPLTFKESLLGFSK--TIQTIDGK--NLPLSRGQPVQPSETTTYPGQGMPITKK 336

Query: 339 ATKFGDLYISVNIEFP 354
             + GDL I   +++P
Sbjct: 337 PGQRGDLLIKYKVDYP 352

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L +   A+DSD+KKAYRKLA++ HPDK    N   R A    FK+I+ A+E+LSDE
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDK----NRHPRAAE--AFKKINRAFEVLSDE 78

Query: 64 DKRAHYDLYG 73
          +KR  YD  G
Sbjct: 79 NKRKVYDQIG 88

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 92/225 (40%), Gaps = 40/225 (17%)

Query: 124 LYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGF 183
           ++  K    KF+    C  C G G +       +   +  C  C G G T  VR    GF
Sbjct: 207 VFGKKNVSIKFRALDPCGTCNGSGLK-------SGASKTTCPSCHGSGTTVHVRA---GF 256

Query: 184 ATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAES-KVLTVSVPRGLRDGDTIKV 242
                  C+ C G+G     ++     CK CHGEG+   + K +TV +P GL+DGD +++
Sbjct: 257 QMMST--CQTCGGEGTTVNASDF----CKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRI 310

Query: 243 VNEA-------DQELGKP---KTGDLIFSIEEDQRCPKDVQLERKGSN---FMTELNISL 289
             +        D+E+ K      GD++  I    R  KD     K      +  E+ I+ 
Sbjct: 311 PGQGSYPDIAVDKEMAKSVKLSRGDILVRI----RVNKDPHFSIKNKYDIWYTKEIPITT 366

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP 334
           A AL G        T +G  + + +P G    P  +I I   G P
Sbjct: 367 A-ALGG---TVSIPTIEGTKIRIKVPAGTA--PEQVISIPNMGVP 405

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGV  +++ SDIKKAY KLA ++HPD  +N  +     +E KF ++  AYEILSD
Sbjct: 47  DPYETLGVKKSSSQSDIKKAYYKLAKKYHPD--INKEA----GAEKKFHDLQNAYEILSD 100

Query: 63  EDKRAHYD 70
           E KR  YD
Sbjct: 101 ESKRKQYD 108

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y VLG++  AT S+IKKAYRK+A+  HPDK    + DD EA + KF+ +  AY++L+
Sbjct: 5  TEFYDVLGISPEATPSEIKKAYRKMAMLTHPDK----HPDDPEA-QAKFQAVGEAYQVLN 59

Query: 62 DEDKRAHYDLYG 73
          D   R  YD +G
Sbjct: 60 DPALRKQYDEFG 71

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +L V   A+D+D+KKAYR+ ALQ+HPDK +N+    +EA++I F  I  AYEILSD  
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNINNI---KEATDI-FANIRTAYEILSDPQ 61

Query: 65 KRAHYD 70
          +R  YD
Sbjct: 62 ERVWYD 67

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 4/68 (5%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV   A+D+++KKAYRK ALQ HPDK    N D+ + +   F  I AAYE+LSD  
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDK----NPDNVDEATENFATIRAAYEVLSDPQ 61

Query: 65 KRAHYDLY 72
          +RA YD +
Sbjct: 62 ERAWYDAH 69

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGV+ +A+  +I+KAY  L  ++HPDK+  +++D +E+      +I+ AYE LSD
Sbjct: 538 DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSD 597

Query: 63  EDKRAHYDL 71
           +DKR  YDL
Sbjct: 598 DDKRKEYDL 606

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 125/294 (42%), Gaps = 54/294 (18%)

Query: 112 DVKIPLKMTIQE-LYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQ 170
           +V +P +++ ++ ++  K  K  ++    C +C+G G +   +  V       C  C G 
Sbjct: 171 NVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLKAGHSRSV-------CPTCHGT 223

Query: 171 GFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVS 229
           G    VR    GF  +    C+ CDG+G        + +KC  CH  G     +K +TV 
Sbjct: 224 GTQVHVR---AGF--QMASTCQTCDGEGSTI----KDSDKCGTCHSHGFKLNSNKTITVD 274

Query: 230 VPRGLRDGDTIKVVNEAD-----------QELGKPKTGDLIFSIEEDQRCPKDVQLERKG 278
           +P GL+DGDTI+V N+              EL   + GDL+  +    R  KD + +   
Sbjct: 275 LPHGLQDGDTIRVPNQGSYPGMAIDPSMKSELHLTR-GDLLIRV----RVRKDTRFQVSN 329

Query: 279 SN---FMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPL 335
           +    +  E+ I+ A AL G  +     T +   + L +  G   +   +I+I  +G P 
Sbjct: 330 NYDIIYTQEIPITTA-ALGGVIE---VPTVEEEKIRLKVSSG--TQHDQVIRIPNKGVPR 383

Query: 336 NGEATKFGDLYI--SVNIEFPPDN-----WFTEK---SDLTQIKNILPRSTSDK 379
                + GD+ +   + I+ P D      W T     +D T  + I P  +S K
Sbjct: 384 GARGDR-GDMLVKFKIVIKKPKDETERYLWETLAHLTNDTTARRTITPSGSSAK 436

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 6/72 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          D Y VLG+  N++ SDIKKAY KLA ++HPD  +N   D    S+ KF ++  AYEILSD
Sbjct: 25 DPYKVLGINKNSSQSDIKKAYYKLAKKYHPD--INKEED----SQKKFHDLQNAYEILSD 78

Query: 63 EDKRAHYDLYGS 74
          EDKR  YD +G+
Sbjct: 79 EDKRKQYDQFGA 90

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+  +A+ +DIKKAYRK A+  HPDK    + DD EA + KF+ I  AY++LS
Sbjct: 5  TEYYDLLGLQPDASATDIKKAYRKKAMLTHPDK----HPDDPEA-QAKFQAIGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D D R+ YD +G
Sbjct: 60 DPDLRSRYDEFG 71

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-NSDDREASEIKFKEISAAYEI 59
           + D Y +LGV+++A+D DIK AYRKL+++ HPDK+      D++   E  + +I+ AYE 
Sbjct: 123 LFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYES 182

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y +L V   ATD +IKKAYRKLA++ HPDK  N +    EA    FK I+ A+E+LS+
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDK--NPHPKASEA----FKIINRAFEVLSN 74

Query: 63 EDKRAHYDLYG 73
          E+KR  YD  G
Sbjct: 75 EEKRGLYDRIG 85

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV+ +A   DIKKAYRK ++Q HPDK    N +D +A+E +F+ IS AY++L 
Sbjct: 5  TTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDK----NPNDPKATE-RFQAISEAYQVLG 59

Query: 62 DEDKRAHYDLYG 73
           ++ RA YD +G
Sbjct: 60 SDELRAKYDKFG 71

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 6/72 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          ++ Y VL V   A+D++IKKAYR+LA++ HPDK    N   R A    FK I+ A+E+L 
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDK----NGHPRSAE--AFKVINRAFEVLG 75

Query: 62 DEDKRAHYDLYG 73
          DEDKR  +D  G
Sbjct: 76 DEDKRRLFDQLG 87

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-NSDDREASEIKFKEISAAYEI 59
           + D Y +LG++++A+D DIK AYRKL+++ HPDK+      D++   E  + +I+ AYE 
Sbjct: 123 LFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYES 182

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 183 LTDELVRQNYLKYG 196

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV   ATD ++KKAYRK ALQ HPDK  N ++ D EA+EI F  I +AYE+LSD  
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDK--NPDNVD-EATEI-FATIRSAYEVLSDPQ 61

Query: 65 KRAHYDLY 72
          +RA YD +
Sbjct: 62 ERAWYDAH 69

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDD-REASEIKFKEISAAYEILSDE 63
          Y +LGV   ATD ++KKAYRK ALQ HPDK    N D+  EA+EI F  I +AYE+LSD 
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDK----NPDNVEEATEI-FATIRSAYEVLSDP 60

Query: 64 DKRAHYDLY 72
           +RA YD +
Sbjct: 61 QERAWYDAH 69

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV+ +A   +IKKAYRK ++Q HPDK    N +D +A+E +F+ IS AY++LS
Sbjct: 5  TAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDK----NPNDPKATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
           ++ RA YD +G
Sbjct: 60 SDELRAKYDKFG 71

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV S+A+D ++KKAYRK ALQ+HPDK   + +   EA+EI F  I  AYE+LSD  
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK---NPTKVEEATEI-FATIRTAYEVLSDPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +L V  NA   DI+KAY +L  ++HPDK    + +++ A+E K   I+ AYEILSD
Sbjct: 507 DYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSD 566

Query: 63  EDKRAHYDL 71
           E KR  YDL
Sbjct: 567 ESKRKEYDL 575

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV  +AT ++IKKAYR+ A+Q HPDK    + DD +A + KF+ +  AY++LS
Sbjct: 5  TEYYDILGVEPDATPTEIKKAYRRKAMQTHPDK----HPDDPDA-QAKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSRYDEFG 71

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 57.0 bits (136), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 6/63 (9%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y VL V   A+D +IKKAYRKLA++ HPDK  N +    EA    FK I+ A+E+LSDE
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDK--NKHPRASEA----FKRINRAFEVLSDE 76

Query: 64 DKR 66
           KR
Sbjct: 77 QKR 79

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +L V+  A+D ++KKAYRK ALQ+HPDK    N ++ E +   F EI AAYE+LSD  
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDK----NRENPEEATAIFSEIRAAYEVLSDPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 1/72 (1%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREAS-EIKFKEISAAYEILS 61
           D Y +LGV+  A+D +IK AYRKL+L+ HPDKV    +++ + S E  + +IS AYE L+
Sbjct: 120 DPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALT 179

Query: 62  DEDKRAHYDLYG 73
           DE  + +Y +YG
Sbjct: 180 DELVKQNYLMYG 191

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 5/71 (7%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y VLGV+  A+  +IKKAYRK A++ HPDK    + DD +A + KF+ +  AY++LSD
Sbjct: 6  EYYDVLGVSPKASAIEIKKAYRKRAMETHPDK----HPDDPDA-QAKFQRVGEAYQVLSD 60

Query: 63 EDKRAHYDLYG 73
          E+ R  YD +G
Sbjct: 61 EELRKRYDEFG 71

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGV  +AT  +I+KAY  L  ++HPDK+  +++D +E+      +I+ AYE LSD
Sbjct: 538 DYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSD 597

Query: 63  EDKRAHYDL 71
           ++KR  YDL
Sbjct: 598 DNKRKEYDL 606

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y +L V  +A++SDIKKAYRKLA++ HPDK  N +    EA    FK+I+ A+E+LSD
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDK--NRHPRASEA----FKKINRAFEVLSD 75

Query: 63 EDKRAHYDLYG 73
          + KR  +D  G
Sbjct: 76 DSKRRIFDQLG 86

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-NSDDREASEIKFKEISAAYEI 59
           M D Y +LG++ +A+D DIK AYR+L+L+ HPDK+    ++++R A E  + +IS A+E 
Sbjct: 123 MFDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEA 182

Query: 60  LSDEDKRAHYDLYG 73
           L+D   R +Y  YG
Sbjct: 183 LTDPIVRENYLKYG 196

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y VL +   A+D++IKKAYRKLA++ HPDK  N +    EA    FK I+ A+E+LSDE
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDK--NKHPRASEA----FKRINRAFEVLSDE 76

Query: 64 DKRAHYDLYG 73
           KR  +D  G
Sbjct: 77 QKRRIFDQVG 86

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y +LGV   AT ++IKKAYR+ A++ HPDK    + DD EA + KF+ +  AY++LS
Sbjct: 5  TQYYDILGVKPEATPAEIKKAYRRRAMETHPDK----HPDDPEA-QSKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSRYDEFG 71

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           + Y +LG+ ++A   DI++AY  L  ++HPDK  N +  +R   E K   I+ AYE+LSD
Sbjct: 509 NYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSD 568

Query: 63  EDKRAHYDLY----GSXXXXXXXXXXYDPFESFFNFEQDEEP 100
           E KR  YD+     GS          Y      FNF++  +P
Sbjct: 569 ESKRKEYDMLRSGGGSQHAGGNGQQFYRNSGPMFNFKKGFKP 610

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 114/288 (39%), Gaps = 52/288 (18%)

Query: 124 LYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGF 183
           ++     + KF     C  C G G +   +       +V C  C G G T  +R    GF
Sbjct: 219 VFGSNNVQLKFSALDPCGTCSGTGMKPNTH-------KVNCGTCHGTGTTVHIR---GGF 268

Query: 184 ATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGL-FAESKVLTVSVPRGLRDGDTIKV 242
                  C  C+G+G         ++ C KCHGEG+     K +TV +P GL+DGD +++
Sbjct: 269 QMMST--CPTCNGEGT----MKRPQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRI 322

Query: 243 ----------VNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSN---FMTELNISL 289
                     V E  ++  K   GD++  I  D    KD     K      +  E+ I+ 
Sbjct: 323 PGQGSYPDIAVEEDLKDSVKLSRGDILVRIRVD----KDPNFSIKNKYDIWYNKEIPITT 378

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349
           A AL G        T +G+ + + + PG   +   +I I   G P     T  GD+ +  
Sbjct: 379 A-ALGG---TVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVPKT--PTIRGDMKVQY 430

Query: 350 NIEFPPDNWFTEK------SDLTQ----IKNILPRSTSDKTKLSDDPL 387
            I         EK      +D+T      K + P + +  T +S++ L
Sbjct: 431 KIVVKKPQSLAEKCLWEALADVTNDDMAKKTMQPGAAAGATTISEEML 478

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LG+  +AT ++IKKAY KLA ++HPD  +N   D    +E KF ++  AYEILSD
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD--INKEPD----AEKKFHDLQNAYEILSD 114

Query: 63  EDKRAHYDLY 72
           E KR  YD +
Sbjct: 115 ESKRQQYDQF 124

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+  +A+ ++IKKAYRK A+  HPDK    + DD EA + KF+ I  AY++LS
Sbjct: 5  TEYYDLLGIQPDASATEIKKAYRKKAMLTHPDK----HPDDPEA-QAKFQAIGQAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D + R+ YD +G
Sbjct: 60 DPELRSRYDEFG 71

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V   A+D DIKKAYRK+A++ HPDK    N   R A    FK+++ A+E+LSDE
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDK----NRHPRAAE--AFKKVNRAFEVLSDE 78

Query: 64 DKRAHYDLYG 73
           KR  YD  G
Sbjct: 79 KKRRVYDQLG 88

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y VL +  +A+D++IKK+YRKLA++ HPDK    N   R ASE  FK I+ A+E+LSDE
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDK----NPHPR-ASEA-FKVINRAFEVLSDE 78

Query: 64 DKRAHYDLYG 73
          +KR  YD  G
Sbjct: 79 EKRRLYDRLG 88

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSD-DREASEIKFKEISAAYEI 59
           M D Y +LG++++A++ DIK AYRKL+++ HPDK+    S+ +R   E  + +I+ AYE 
Sbjct: 127 MFDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEA 186

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R ++  YG
Sbjct: 187 LTDEAMRENFLKYG 200

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LGV   AT ++IKKAYR+ A++ HPDK  N  +     ++ KF+ +  AY++LS
Sbjct: 5  TEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPN-----AQAKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D++ R  YD  G
Sbjct: 60 DDELRKRYDQLG 71

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+   AT ++IKKAYR+ A++ HPDK    + DD +A + KF+ +  AY++LS
Sbjct: 5  TEYYDILGIKPEATATEIKKAYRRKAMETHPDK----HPDDPDA-QAKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D+  R+ YD +G
Sbjct: 60 DQGLRSKYDEFG 71

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+  +AT ++IKKAYR+ A++ HPDK    + DD +A + KF+ +  AY++LS
Sbjct: 5  TEYYDILGIKPDATSTEIKKAYRRKAMETHPDK----HPDDPDA-QAKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSKYDEFG 71

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +L +   AT  +IKKAYRK +++ HPDK    N +D  A+E +F+ IS AY++LS
Sbjct: 5  TEYYDLLDIDITATAIEIKKAYRKKSIKEHPDK----NPNDPTATE-RFQAISEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D++ RA+YD +G
Sbjct: 60 DKNLRANYDKFG 71

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LG++  AT  DI+KAY +L  ++HPDK  + +  +++ +  K  EI+ AYE LSD
Sbjct: 559 DYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSD 618

Query: 63  EDKRAHYDLYGSXXXXXXXXXXYDPFESFFNFEQ 96
           E K++ YD   S           +P  + F F Q
Sbjct: 619 EAKKSEYDSVRSGKSNQNMFRGANPVRNNFMFNQ 652

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y +L V   A+D++IKKAYRKLA++ HPDK    N+  R ASE  FK I+ A+E+LSD
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDK----NTHPR-ASEA-FKRINRAFEVLSD 77

Query: 63 EDKRAHYDLYG 73
            KR  +D  G
Sbjct: 78 VGKRRMFDQLG 88

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+   AT ++IKKAYR+ A++ HPDK    + DD +A + KF+ +  AY++LS
Sbjct: 5  TEYYDILGIKPEATSTEIKKAYRRKAMETHPDK----HPDDPDA-QAKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSKYDEFG 71

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 50/72 (69%), Gaps = 1/72 (1%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNS-DDREASEIKFKEISAAYEILS 61
           D Y +LG++ +A+D DIK AYRKL+++ HPDK+    S ++R + E K+ +I+ AYE L+
Sbjct: 121 DPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALT 180

Query: 62  DEDKRAHYDLYG 73
           DE  + ++  YG
Sbjct: 181 DEVIKENFLKYG 192

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 4/68 (5%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +LGV S A+D ++KKAYRK AL++HPDK    N ++ E +   F  I  AYE+LSD  
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDK----NPNNVEEATQAFATIRLAYEVLSDPQ 61

Query: 65 KRAHYDLY 72
          +RA YD +
Sbjct: 62 ERAWYDSH 69

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGVA N+   +I+KAY  L  ++HPDK    +  ++E +  K  EI+ AYEIL D
Sbjct: 554 DYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGD 613

Query: 63  EDKRAHYD 70
           E K+  YD
Sbjct: 614 ESKKKEYD 621

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 5/71 (7%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          + Y VLG+  +AT ++IKKAYR+ A+Q HPDK    + DD +A + KF+ +  AY++LSD
Sbjct: 6  EYYDVLGIQPDATPAEIKKAYRRKAMQTHPDK----HPDDPDA-QSKFQAVGEAYQVLSD 60

Query: 63 EDKRAHYDLYG 73
             ++ YD +G
Sbjct: 61 PQLKSRYDQFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (66%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y +LG+   AT ++IKKAYR+ A++ HPDK    + DD +A + KF+ +  AY++LS
Sbjct: 5  TEYYDILGIKPEATPTEIKKAYRRKAMETHPDK----HPDDPDA-QAKFQAVGEAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSKYDQFG 71

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 1/72 (1%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKV-VNSNSDDREASEIKFKEISAAYEILS 61
           D Y +LGV  ++T+ +IKKAYR L+L+ HPDK+  N +  +R + E  F +IS AYE L+
Sbjct: 121 DPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALT 180

Query: 62  DEDKRAHYDLYG 73
           +   + +Y LYG
Sbjct: 181 NPATKENYLLYG 192

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 95/228 (41%), Gaps = 40/228 (17%)

Query: 124 LYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGF 183
           ++  K    +F     C  C G G +  KN Q +      C  C G G T  VR    GF
Sbjct: 186 VFGAKNANLQFSVLDPCGVCHGSGLK--KNAQSST-----CPSCHGTGTTVHVRG---GF 235

Query: 184 ATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAES-KVLTVSVPRGLRDGDTIKV 242
             +    C QC G+G         ++ C KCHGEG+   S + ++V +P+GL+DGD ++V
Sbjct: 236 --QMASTCNQCGGEGTTV----RPEDVCSKCHGEGVELNSQRSISVDLPQGLQDGDVVRV 289

Query: 243 ----------VNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSN---FMTELNISL 289
                     V+   +   K   GD++  I  D    KD +   +      F  E+ I+ 
Sbjct: 290 PGQGSYPHLAVDPKMKNSVKLHRGDVLVRIRVD----KDSRFSIRNKTDIWFTKEIPITT 345

Query: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNG 337
           A AL G   +    T D   + L + PG   +   +I I   G P  G
Sbjct: 346 A-ALGG---QVTIPTVDDTQIRLKVQPG--TQHDQVISIPNMGVPRIG 387

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 6/74 (8%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y  LGV  NA+ S+IKKAY KLA + HPD  +N   +    +E KF ++  AYEIL
Sbjct: 34  IKDPYETLGVGKNASSSEIKKAYYKLAKKFHPD--INKEPN----AEAKFHDLQNAYEIL 87

Query: 61  SDEDKRAHYDLYGS 74
           SD+ K+  YD +G+
Sbjct: 88  SDDTKKQQYDQFGA 101

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 52/74 (70%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVV-NSNSDDREASEIKFKEISAAYEI 59
           + D YA+L +++++TD +I+ AYRKL+++ HPDK+  + ++D+R   E ++  I+ AY+ 
Sbjct: 113 LFDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKA 172

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 173 LTDEITRENYLRYG 186

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKV-VNSNSDDREASEIKFKEISAAYEILSD 62
           Y +LG+ S+A++ +IK+AYR + L+ HPDK  +N NS+    S     +I  AY+ L D
Sbjct: 5  FYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLID 64

Query: 63 EDKRAHYD 70
          +D R  YD
Sbjct: 65 QDLRKKYD 72

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 5/72 (6%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T+ Y  LG++ +AT ++IKKAYRK A+  HPDK  + N  D +A   KF+ +  AY++LS
Sbjct: 5  TEYYDALGISPDATPTEIKKAYRKKAMLTHPDK--HPNDPDAQA---KFQAVGQAYQVLS 59

Query: 62 DEDKRAHYDLYG 73
          D   R+ YD +G
Sbjct: 60 DPGLRSRYDEFG 71

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 1/72 (1%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVV-NSNSDDREASEIKFKEISAAYEILS 61
           D Y +LGV  ++TD +IK AYRKL+++ HPDK+  + N  +R A E +F  I+ AY+ L+
Sbjct: 111 DPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALT 170

Query: 62  DEDKRAHYDLYG 73
           DE  + +Y  YG
Sbjct: 171 DEITKENYRKYG 182

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V   A D++IKKAYRKLA++ HPDK  N +    EA    FK I+ A+E+LSD 
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDK--NPHPKASEA----FKIINRAFEVLSDV 76

Query: 64 DKRAHYDLYG 73
          +KR  YD  G
Sbjct: 77 EKRQLYDRIG 86

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +L V   A D+++KKAYR+ ALQ+HPDK   +  +  EA+EI F  I AAYE+LSD  
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK---NPENVEEATEI-FASIRAAYEVLSDPQ 61

Query: 65 KRAHYD 70
          +RA YD
Sbjct: 62 ERAWYD 67

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V  +++D DIKKAYRKLA++ HPDK  N      EA    FK I+ A+E+LSD 
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDK--NPYPKAHEA----FKLINRAFEVLSDS 75

Query: 64 DKRAHYDLYG 73
           KR  YD  G
Sbjct: 76 QKRQIYDQIG 85

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSD-DREASEIKFKEISAAYEI 59
           + D Y +LG++S+A++ +IK AYRKL+++ HPDK+    ++ +R   E  + +I+ AYE 
Sbjct: 117 LFDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEA 176

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R ++  YG
Sbjct: 177 LTDELTRQNFLKYG 190

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (53%), Gaps = 8/95 (8%)

Query: 2   TDLYAVLGVAS---NATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYE 58
            DLYA +G++     ATD+ I KA+RK  L+HHPDK   S   + +     FK I  AYE
Sbjct: 96  ADLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGF---FKIIQKAYE 152

Query: 59  ILSDEDKRAHYDL--YGSXXXXXXXXXXYDPFESF 91
            L+D +KRA YD   + +          YD FES+
Sbjct: 153 TLTDSNKRAQYDSCDFNADVQPPKKGTEYDFFESW 187

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V   A D++IKK+YRKLA++ HPDK  N +    EA    FK I+ A+E+L DE
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDK--NPHPKASEA----FKRINRAFEVLGDE 78

Query: 64 DKRAHYDLYG 73
           KR  +D  G
Sbjct: 79 KKRVLFDRIG 88

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 84/220 (38%), Gaps = 35/220 (15%)

Query: 140 CDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGK 199
           C  C G G +   +         EC  C G G T  VR    GF  +    C  C G G+
Sbjct: 225 CKTCTGSGMKPGSH-------RSECSSCHGTGTTVHVRA---GF--QMASTCMSCGGTGE 272

Query: 200 HYAKANSEKNKCKKCHGEGLFAE--SKVLTVSVPRGLRDGDTIKVVNEA----------D 247
           + A+    ++ C+ C GEG       + + V +P GL DGD I+V  +            
Sbjct: 273 NIAR----EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQ 328

Query: 248 QELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKDKFVTKTFDG 307
           ++  K   GDL+  I   Q     V   R G+       I +  A+ G     V  T DG
Sbjct: 329 RDQVKVTRGDLLVRIRVKQ---DKVFSIRNGNELWQTREIPVTTAVLG--GNVVIPTLDG 383

Query: 308 RILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYI 347
             L L +  G   R G  + +  +G P        GD+ +
Sbjct: 384 NQLRLRVRSG--TRDGETVSVPGQGVPRGRGGLSRGDMKV 421

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 6/72 (8%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y VLG+  +A  S+IKKAY KLA ++HPD  +N +    + S+ KF +I+ AYEILSD
Sbjct: 47  DPYKVLGLNKDAKASEIKKAYYKLAKKYHPD--INKD----KGSDKKFHDITNAYEILSD 100

Query: 63  EDKRAHYDLYGS 74
           E K+  YD +GS
Sbjct: 101 EKKKMQYDQFGS 112

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 52/74 (70%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVV-NSNSDDREASEIKFKEISAAYEI 59
           + D YA+L V++++TD +I+ AYRKL+++ HPDK+  + ++++R   E ++  I+ AY+ 
Sbjct: 115 LFDPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKA 174

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  R +Y  YG
Sbjct: 175 LTDEVTRENYLKYG 188

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V   A D++IKK+YRKLA++ HPDK    N   R ASE  FK I+ A+E+L D 
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDK----NPHPR-ASE-AFKLINRAFEVLGDS 76

Query: 64 DKRAHYDLYG 73
          +KR+ YD  G
Sbjct: 77 EKRSLYDRLG 86

>SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {ON}
           some similarities with uniprot|P35191 Saccharomyces
           cerevisiae YFL016C MDJ1 Protein involved in folding of
           mitochondrially synthesized proteins in the
           mitochondrial matrix localizes to the mitochondrial
           inner membrane member of the DnaJ family of molecular
           chaperones
          Length = 510

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 93/222 (41%), Gaps = 41/222 (18%)

Query: 140 CDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGK 199
           C++C   G +   +          C  C+G G    VR    GF  +    C QCDG+G 
Sbjct: 225 CNSCHSSGLKSGAS-------RTTCPGCQGTGTRVHVRA---GF--QMASTCTQCDGEGS 272

Query: 200 HYAKANSEKNKCKKCHGEGLFA-ESKVLTVSVPRGLRDGDTIKVVNEA-------DQELG 251
               ++     C  CHGEG+     K + V +P GL+DGD I++  E        D  + 
Sbjct: 273 VIRGSD----MCGTCHGEGVVMNRGKQIKVDLPHGLQDGDAIRISREGSYPHISIDPSMK 328

Query: 252 KP---KTGDLIFSIEEDQRCPKDVQLERKGSN---FMTELNISLAEALTGFKDKFVTKTF 305
                + GDL+  +  D    KD +   K +    F  E+ ++ A AL G        T 
Sbjct: 329 NSVHLRRGDLLLRVRVD----KDPRFSIKNNYDIWFTQEIPLTTA-ALGGV---VTVPTV 380

Query: 306 DGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYI 347
           DG+ + L +  G   +  +++ I Q+G P  G     GD+ +
Sbjct: 381 DGQQIRLKVKQG--TQHDDVVSIPQQGVP-RGTLGSRGDMKV 419

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 6/73 (8%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60
           + D Y  LGV+ +A+ S+IKKAY KLA ++HPD  +N   D    ++ KF ++  AYEIL
Sbjct: 54  IKDPYKTLGVSQSASGSEIKKAYYKLAKKYHPD--INKAED----AQKKFHDLQNAYEIL 107

Query: 61  SDEDKRAHYDLYG 73
           SDE K+  +D +G
Sbjct: 108 SDETKKQQWDQFG 120

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNS-DDREASEIKFKEISAAYEI 59
           + D Y +LGV+++A D +IK AYRKL+++ HPDK+ +  + + R   E  + +I+ AYE 
Sbjct: 120 LFDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYES 179

Query: 60  LSDEDKRAHYDLYG 73
           L+DE+ + +Y  YG
Sbjct: 180 LTDENVKENYLRYG 193

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           + Y VLGV   AT  DI+K+Y  +  ++HPDK    +   +  ++ K  EI+ AYEILSD
Sbjct: 505 NYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSD 564

Query: 63  EDKRAHYD 70
           E KR  YD
Sbjct: 565 EGKRKEYD 572

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y VL + ++ATD +I+KAY  L  ++HPDK    +   +  +  K   I+ AYEILSD
Sbjct: 560 DFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEILSD 619

Query: 63  EDKRAHYD 70
           E+KR  YD
Sbjct: 620 ENKRRDYD 627

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 6/69 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y+ LG++SNA +++I K+Y  LA Q HPDK         EAS  +FK IS A+ +L 
Sbjct: 12 TTYYSTLGLSSNANEAEIHKSYMMLARQLHPDK------SKSEASAEQFKLISHAHSVLM 65

Query: 62 DEDKRAHYD 70
          DE KR  YD
Sbjct: 66 DEAKRLKYD 74

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          D Y VL V  ++ +++IKK+YRKLA++ HPDK  N +    EA    FK I+ A+E+LSD
Sbjct: 22 DFYNVLKVERSSDETEIKKSYRKLAIKLHPDK--NPHPKASEA----FKVINRAFEVLSD 75

Query: 63 EDKRAHYDLYG 73
           +KR  +D  G
Sbjct: 76 NEKREIFDRIG 86

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVV-NSNSDDREASEIKFKEISAAYEI 59
           + D Y +LGVA++ATD +++ AYRKL+++ HPDK+  +   + R   E ++  I+ AY+ 
Sbjct: 114 LFDPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKA 173

Query: 60  LSDEDKRAHYDLYG 73
           L+DE  + +Y  +G
Sbjct: 174 LTDEITKENYLKFG 187

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 6/69 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y++LG+ SNAT S++ K+Y KLA   HPDK  +      + SE  FK +  A+ IL+
Sbjct: 12 TTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKS------DKSEELFKAVVHAHSILT 65

Query: 62 DEDKRAHYD 70
          DED++  YD
Sbjct: 66 DEDQKLRYD 74

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (63%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +LGV  N+   +I+K+Y  L  ++HPDK    + +++E +  K ++I+ AYE LSD
Sbjct: 604 DYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSD 663

Query: 63  EDKRAHYDL 71
           E KR  YDL
Sbjct: 664 ESKRKEYDL 672

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V   +T+++IKKAYRKLA++ HPDK  N +    EA    FK I+ A+E+LSD 
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDK--NPHPKASEA----FKIINRAFEVLSDN 75

Query: 64 DKRAHYDLYG 73
          +KR  +D  G
Sbjct: 76 EKRRIFDQLG 85

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y  LGV+ NA + DI++AY +L  ++HPDK    + ++R   + K   I+ AYE L D
Sbjct: 504 DYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYETLRD 563

Query: 63  EDKRAHYDLYGS 74
           + KR  YD+  S
Sbjct: 564 DSKRKEYDMVRS 575

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V  +A   +IKK+YRKLA++ HPDK  N +    EA    FK I+ A+E+LSD+
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDK--NPHPKAGEA----FKVINRAFEVLSDD 78

Query: 64 DKRAHYDLYG 73
          +KR+ +D  G
Sbjct: 79 EKRSVFDRIG 88

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64
          Y +L + S+AT  +IKKAYR   L  HPDK+   N+++R  + +   +I  AY+ILS+  
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLT-KNTNNR-VNSVTINKIQDAYKILSNNQ 67

Query: 65 KRAHYD 70
          KR  YD
Sbjct: 68 KRGEYD 73

>Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}
          YJL162C (REAL)
          Length = 559

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 6/69 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y++LG+ SNAT S++ K+Y KLA   HPDK  +   +D       FK +  A+ IL+
Sbjct: 12 TTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKCEDL------FKAVVHAHSILT 65

Query: 62 DEDKRAHYD 70
          D+D++  YD
Sbjct: 66 DKDQKLRYD 74

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (60%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +L V+ +A   DI+K+Y  L  + HPDK    +  +++  + K  EI+ AYE+LSD
Sbjct: 527 DYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSD 586

Query: 63  EDKRAHYDL 71
           E KR  YDL
Sbjct: 587 ETKRNEYDL 595

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 2   TDLYAVLGVAS---NATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYE 58
            DLYA +G++     AT++ I KA+RK  L+HHPDK   S   +++     FK I  AYE
Sbjct: 95  ADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGF---FKIIQKAYE 151

Query: 59  ILSDEDKRAHYD 70
            L+D +KRA YD
Sbjct: 152 TLTDSNKRAQYD 163

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y+VLG+  +ATD+ I+K+Y KLA + HPDK     S    A+E+ FK ++ A+ IL+
Sbjct: 11 TTYYSVLGLPFDATDAQIRKSYMKLARELHPDK-----SKSEVAAEL-FKVVAHAHSILT 64

Query: 62 DEDKRAHYD 70
          D +KR  YD
Sbjct: 65 DREKRLKYD 73

>Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa]
          {ON} YJL162C (REAL)
          Length = 560

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 6/69 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y++LG+ASNAT S++ K+Y KLA   HPDK  +      +  E  FK +  A+ IL+
Sbjct: 12 TTYYSILGLASNATSSEVHKSYLKLARLLHPDKTKS------DKCEELFKAVVHAHSILT 65

Query: 62 DEDKRAHYD 70
          DE+++  YD
Sbjct: 66 DENQKLRYD 74

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (58%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           + Y VL V   AT  DI+K+Y  +  ++HPDK    +   +  ++ +  EI+ AYEILSD
Sbjct: 503 NYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSD 562

Query: 63  EDKRAHYD 70
           E KR  YD
Sbjct: 563 EGKRKEYD 570

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y VLG++  A+  +I+KAY  L  ++HPDK    +  ++E    K  +++ AYEILSD
Sbjct: 522 DYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSD 581

Query: 63  EDKRAHYD 70
           E K+  YD
Sbjct: 582 EGKKRDYD 589

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y+VLG+   A+ +DIKK+Y+KLA + HPDK     S   E+SE+ FK +  AY ILS
Sbjct: 6  TTHYSVLGLTPTASLNDIKKSYKKLARELHPDK-----SKSNESSEL-FKIVVDAYSILS 59

Query: 62 DEDKRAHYDL 71
          D  +R  Y++
Sbjct: 60 DVKEREEYNI 69

>Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..5743)
           [1299 nt, 433 aa]
          Length = 432

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 52/95 (54%), Gaps = 8/95 (8%)

Query: 2   TDLYAVLGVAS---NATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYE 58
            DLYA +G++     A+D+ I KA+RK  L+HHPDK+  S   +++     FK I  A+E
Sbjct: 96  ADLYAAMGLSKLRFKASDAQIIKAHRKQVLKHHPDKISASGGLNQDGF---FKIIQKAFE 152

Query: 59  ILSDEDKRAHYDL--YGSXXXXXXXXXXYDPFESF 91
            L+D  KR+ YD   + +          YD FES+
Sbjct: 153 TLTDSTKRSQYDSCDFEADVLPPKKGDSYDFFESW 187

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
           D Y +L +  NA   +I+KAY      +HPDK    + + ++ ++ K  EI+ AYE LSD
Sbjct: 475 DYYKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSD 534

Query: 63  EDKRAHYDL 71
           E KR  YD+
Sbjct: 535 EGKRREYDM 543

>TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON}
          Anc_1.113 YJR097W
          Length = 170

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 10/76 (13%)

Query: 5  YAVLGVASNATDSDIKKAYRKLALQHHPDKV-------VNSNSD---DREASEIKFKEIS 54
          Y +LG+ S+AT+SDIK+AY++  L  HPDK+        N+N +   +   S I    I 
Sbjct: 7  YEILGIDSDATESDIKRAYKEKLLAIHPDKIKNNAKAKANTNENITGNENKSPISVNHIQ 66

Query: 55 AAYEILSDEDKRAHYD 70
           AY+IL D   R  YD
Sbjct: 67 DAYKILVDSKSRQQYD 82

>KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 428

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 2   TDLYAVLGVA---SNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYE 58
            DLYA +G++     ATD+ + KA+RK  L+HHPDK   S   +++     FK I  AYE
Sbjct: 95  ADLYAAMGLSKLRHKATDAQVIKAHRKQVLKHHPDKKSASGGLEQDGF---FKIIQKAYE 151

Query: 59  ILSDEDKRAHYDL--YGSXXXXXXXXXXYDPFESF 91
            L+D  KR  YD   Y +          YD FE++
Sbjct: 152 TLTDPTKRKQYDSCDYNADVEPPKKGSKYDFFEAW 186

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (66%), Gaps = 4/72 (5%)

Query: 3  DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62
          D YA L ++++A DS +KK+YR+L L++HPDK+  SN   +E ++ +F ++  +YE+L+ 
Sbjct: 12 DPYATLELSNDAEDSQVKKSYRRLMLRYHPDKL--SNDLAKEEAQDRFHKVQLSYEVLT- 68

Query: 63 EDKRAHYDLYGS 74
             R  YD  GS
Sbjct: 69 -KFREIYDKSGS 79

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSD-DREASEIKFKEISAAYEILS 61
           D Y +L V S ATD +I+ AYRKL+++ HPDK+     D +R   E ++  I+ AY+ L+
Sbjct: 115 DPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALT 174

Query: 62  DEDKRAHYDLYG 73
           D+  R ++  YG
Sbjct: 175 DDATRDNFLRYG 186

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61
          T  Y+ LG+++NA+D +I K+Y KLA + HPDK   S SD   A+E+ FK IS A+ +L 
Sbjct: 12 TTYYSTLGLSTNASDKEIHKSYVKLARELHPDK---SKSDG--AAEL-FKLISHAHSVLM 65

Query: 62 DEDKRAHYD 70
          D++K+  YD
Sbjct: 66 DKEKKDAYD 74

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 4  LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63
           Y +L V   A DS+IKKAYRKLA++ HPDK  N +    EA    FK I+ A+E+L + 
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDK--NPHPKAAEA----FKLINRAFEVLGNS 76

Query: 64 DKRAHYDLYG 73
          +KR  ++  G
Sbjct: 77 EKREIFNRIG 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,945,892
Number of extensions: 2283507
Number of successful extensions: 6248
Number of sequences better than 10.0: 387
Number of HSP's gapped: 5690
Number of HSP's successfully gapped: 435
Length of query: 433
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 321
Effective length of database: 40,638,807
Effective search space: 13045057047
Effective search space used: 13045057047
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)