Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050208.263ON56856829740.0
NDAI0B019908.263ON58858222340.0
TDEL0F039008.263ON55955421350.0
KNAG0G020408.263ON59155121300.0
YLR089C (ALT1)8.263ON59249221300.0
Skud_12.1578.263ON59249121250.0
Smik_12.1488.263ON59249221190.0
Suva_10.1738.263ON59249121000.0
ZYRO0C01628g8.263ON53448620170.0
CAGL0L12254g8.263ON57449420170.0
SAKL0H17006g8.263ON53148820020.0
KLLA0F19162g8.263ON52848619750.0
KAFR0B027308.263ON53949019470.0
Kpol_392.58.263ON51249019290.0
TPHA0J007508.263ON52249118540.0
Skud_4.3728.263ON50748918190.0
NCAS0B038408.263ON49749118170.0
Smik_4.3578.263ON50748918160.0
KAFR0B055308.263ON51449118140.0
YDR111C (ALT2)8.263ON50748918130.0
Suva_2.2718.263ON50748917940.0
Kwal_56.237918.263ON51848117760.0
KLTH0G13662g8.263ON51948117700.0
KNAG0M012108.263ON52148917700.0
KAFR0B05520singletonON51049317230.0
Kpol_543.398.263ON49249017160.0
NDAI0J013608.263ON50149016970.0
TBLA0E044408.263ON56248417000.0
AGR085W8.263ON52149216930.0
Ecym_43078.263ON53448816750.0
TPHA0A018008.263ON49849216590.0
TBLA0F030608.263ON50049815680.0
TBLA0G01630singletonON50049414960.0
Kwal_34.160181.472ON3791741383e-08
KLLA0F10021g3.511ON4973211278e-07
Kpol_1039.222.252ON3861951242e-06
ADL249W2.252ON3871811189e-06
TPHA0O014501.321ON4431731162e-05
KLTH0G09614g2.252ON3891801152e-05
TPHA0F012602.252ON3921781125e-05
SAKL0E08492g2.252ON3841341108e-05
Kwal_23.48882.252ON3891961081e-04
NDAI0B045502.102ON5651611091e-04
Suva_6.1361.321ON4441721082e-04
KLTH0G19646g1.472ON3791221072e-04
KLLA0F03509g2.252ON3871361062e-04
Kwal_47.17462na 1ON4921281073e-04
TDEL0D019001.321ON4431711053e-04
ZYRO0A01672g2.252ON3861321044e-04
NDAI0G057601.321ON4481751036e-04
Ecym_32902.252ON3861271036e-04
SAKL0D11528g1.472ON3831521027e-04
Skud_10.1561.321ON4601401037e-04
YJL060W (BNA3)1.321ON4441401028e-04
SAKL0H21824gna 1ON4991281029e-04
KLTH0G19624gsingletonON4681841029e-04
KLTH0E07678gna 1ON4921251020.001
ZYRO0G20636g1.321ON4531671010.001
KNAG0B053201.321ON4331651010.001
SAKL0F02156g3.511ON4981221010.001
KNAG0B006603.511ON4961251000.001
KNAG0E018502.252ON384127990.002
NCAS0E006703.511ON4971451000.002
Kpol_278.23.511ON498122990.002
Kwal_14.25741.321ON44368980.003
Kpol_1035.231.321ON444137980.003
KLLA0F01617g1.321ON444170980.003
Smik_10.1801.321ON444140970.003
TPHA0D033703.511ON497122970.003
NCAS0A092001.321ON445175970.003
TDEL0A016008.204ON475184960.005
NDAI0B037302.252ON386133950.006
NCAS0G040501.472ON384166950.006
KAFR0B023808.204ON443182950.006
CAGL0J05126g1.321ON433349950.006
Kpol_1032.398.204ON453243950.007
KAFR0A017101.321ON435171940.008
KLTH0B00176g8.204ON448184930.009
TBLA0B009902.102ON546159940.009
KAFR0J015802.252ON383127930.010
Ecym_7228na 1ON488125920.012
NCAS0B064402.252ON385123920.014
Kwal_47.189823.511ON496188920.015
YGL202W (ARO8)3.511ON500145910.017
Ecym_62921.321ON430135910.017
Ecym_55428.204ON446189910.019
KLTH0G02002g3.511ON496124910.021
Ecym_6319singletonON354217900.021
AFR548C3.511ON497124890.032
YIL116W (HIS5)2.252ON385129880.036
TDEL0C040902.252ON383127880.038
Smik_9.532.252ON388129880.042
NDAI0I028303.511ON500145870.056
Smik_7.693.511ON500145870.062
SAKL0D06886g1.321ON447139860.065
KAFR0D014203.511ON492125860.075
CAGL0C01243g2.252ON383126850.077
KLTH0H10648g1.321ON443184860.079
Kwal_8.5858.204ON44656850.089
KNAG0G005501.472ON387160850.095
CAGL0G01254g3.511ON504122850.097
TDEL0D057903.511ON49760850.11
KLLA0E00969g8.204ON445236850.11
Suva_9.782.252ON386123840.12
Suva_7.613.511ON500148840.12
Smik_5.3198.204ON443180840.13
Suva_5.2818.204ON450190840.14
Skud_9.552.252ON385127830.16
Kpol_480.11.472ON380161830.17
SAKL0E12188g2.102ON530162820.21
ZYRO0C06028g3.511ON496122820.21
Skud_7.693.511ON500145820.25
KNAG0G016808.204ON452188810.25
NCAS0A038308.204ON446186810.32
TPHA0O015202.102ON50349810.33
ZYRO0B11088g8.204ON450188790.46
AEL170C1.321ON45846780.58
ZYRO0G05346g2.102ON504160780.73
KLLA0A04906gna 1ON480125770.87
Skud_5.2908.204ON44362770.99
KLLA0F13640g2.475ON418119741.8
CAGL0G06028g2.102ON537162733.0
Suva_15.3342.102ON56044723.5
YER152C8.204ON44362714.2
NDAI0C059608.204ON47848714.7
SAKL0A06974g6.121ON62374715.2
CAGL0F01177g7.121ON81842706.6
TBLA0A087308.172ON16843678.0
Kpol_431.132.475ON443321698.2
TPHA0J024306.221ON587101699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05020
         (568 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...  1150   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   865   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   827   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   825   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   825   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   823   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   820   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   813   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   781   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   781   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   775   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   765   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   754   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   747   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   718   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   705   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   704   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   704   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            703   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   702   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   695   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   688   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   686   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   686   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   668   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   665   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   658   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   659   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   656   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   649   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   643   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   608   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              580   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    58   3e-08
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    54   8e-07
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    52   2e-06
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    50   9e-06
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    49   2e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    49   2e-05
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    48   5e-05
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    47   8e-05
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    46   1e-04
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    47   1e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    46   2e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    46   2e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    45   2e-04
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    46   3e-04
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    45   3e-04
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    45   4e-04
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    44   6e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    44   6e-04
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    44   7e-04
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    44   7e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    44   8e-04
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    44   9e-04
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    44   9e-04
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    44   0.001
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    44   0.001
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    44   0.001
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    44   0.001
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    43   0.001
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    43   0.002
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     43   0.002
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    43   0.002
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    42   0.003
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    42   0.003
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    42   0.003
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    42   0.003
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    42   0.003
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    42   0.003
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    42   0.005
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    41   0.006
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    41   0.006
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    41   0.006
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    41   0.006
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    41   0.007
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    41   0.008
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    40   0.009
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    41   0.009
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    40   0.010
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    40   0.012
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    40   0.014
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    40   0.015
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    40   0.017
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    40   0.017
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    40   0.019
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.021
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    39   0.021
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    39   0.032
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    39   0.036
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    39   0.038
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    39   0.042
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    38   0.056
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    38   0.062
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    38   0.065
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    38   0.075
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    37   0.077
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    38   0.079
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    37   0.089
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       37   0.095
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    37   0.097
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    37   0.11 
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    37   0.11 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    37   0.12 
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.12 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.13 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    37   0.14 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    37   0.16 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    37   0.17 
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    36   0.21 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    36   0.21 
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    36   0.25 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    36   0.25 
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     36   0.32 
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    36   0.33 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    35   0.46 
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    35   0.58 
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    35   0.73 
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    34   0.87 
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    34   0.99 
KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]...    33   1.8  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    33   3.0  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    32   3.5  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    32   4.2  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   4.7  
SAKL0A06974g Chr1 (620230..622101) [1872 bp, 623 aa] {ON} simila...    32   5.2  
CAGL0F01177g Chr6 complement(121015..123471) [2457 bp, 818 aa] {...    32   6.6  
TBLA0A08730 Chr1 (2141012..2141518) [507 bp, 168 aa] {ON} Anc_8....    30   8.0  
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    31   8.2  
TPHA0J02430 Chr10 complement(535317..537080) [1764 bp, 587 aa] {...    31   9.4  

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/568 (97%), Positives = 555/568 (97%)

Query: 1   MMHSTPLLSSSKFASRQLRILTRTYSVNLTNNKFNNKMPHFMEPSTSPQYPYFETKRTIS 60
           MMHSTPLLSSSKFASRQLRILTRTYSVNLTNNKFNNKMPHFMEPSTSPQYPYFETKRTIS
Sbjct: 1   MMHSTPLLSSSKFASRQLRILTRTYSVNLTNNKFNNKMPHFMEPSTSPQYPYFETKRTIS 60

Query: 61  SAAXXXXXXXXXXXXXNHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQE 120
           SAA             NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQE
Sbjct: 61  SAATKLKTKPKPTTKKNHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQE 120

Query: 121 DPSSLPFDHIVNANIGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDAL 180
           DPSSLPFDHIVNANIGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDAL
Sbjct: 121 DPSSLPFDHIVNANIGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDAL 180

Query: 181 ERAKTLLHEIGGTVGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMY 240
           ERAKTLLHEIGGTVGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMY
Sbjct: 181 ERAKTLLHEIGGTVGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMY 240

Query: 241 LLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAK 300
           LLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAK
Sbjct: 241 LLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAK 300

Query: 301 DKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSM 360
           DKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSM
Sbjct: 301 DKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSM 360

Query: 361 KKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASI 420
           KKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASI
Sbjct: 361 KKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASI 420

Query: 421 SLCPVVTGQALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQ 480
           SLCPVVTGQALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQ
Sbjct: 421 SLCPVVTGQALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQ 480

Query: 481 KPQGAMYLFPRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHL 540
           KPQGAMYLFPRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHL
Sbjct: 481 KPQGAMYLFPRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHL 540

Query: 541 RTTFLAPGTEWIEKWKIFHQDFYNTYRD 568
           RTTFLAPGTEWIEKWKIFHQDFYNTYRD
Sbjct: 541 RTTFLAPGTEWIEKWKIFHQDFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/582 (72%), Positives = 484/582 (83%), Gaps = 20/582 (3%)

Query: 3   HSTPLLSSSKFAS-RQL-RILTRTYSVN------------LTNNKFNNKMPHFMEPSTS- 47
            ST    ++ FA+ +QL ++ T TYS+               N+    K P  ++ +T+ 
Sbjct: 11  RSTSTAVTTNFANLKQLNKMATCTYSIKANVSNSNSNNIKTINSNQVKKSPLIIKATTTA 70

Query: 48  -PQYPYFETKRTISSAAXXXXXXXXXXXXXNHNNFLPADQLTLAELNDNVLKAKYAVRGA 106
            P+Y +F+ KR + + +                +F PA+QLTLA+LN+NVLKAKYAVRG+
Sbjct: 71  IPEYQFFDAKRALMTRSISHHSLKVA----KGKDFAPAEQLTLADLNENVLKAKYAVRGS 126

Query: 107 IPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLSFYRQVLSLLQYPEILKQDE 166
           IPMRAEELK+QL+ +PS+LPF  IVNANIGNPQQL QKPLSFYRQVLS+LQYP+ILK++E
Sbjct: 127 IPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENE 186

Query: 167 SKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGVYGIRKTVANFITKRDNGEPAYPE 226
             L+ + ++K+DA++RAK LL EIGG+VGAYSASQGVYGIRKTVANFIT+RD GEPAYPE
Sbjct: 187 QNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPE 246

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           DIFLT        YLLSILC+GP+TGVLIPIPQYPLYTA+LALNNSHALPYYLDEKSGWS
Sbjct: 247 DIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWS 306

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEV 346
           TNPKEIEEVV  A ++ I PSVLVVINPGNPTGAVL+E+SIEHIFEIAAKYGIVVIADEV
Sbjct: 307 TNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEV 366

Query: 347 YQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGF 406
           YQEN+ + VKF+SMKKVLR LQK HPG +D VQLASLHSTSKGVSGECGQRGGYMEL GF
Sbjct: 367 YQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGF 426

Query: 407 THEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQ 466
           THEVR VILKLASISLCPVVTGQALVDLMVSPPKKGD S+EQDQAER+HIKSEL  RA Q
Sbjct: 427 THEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQ 486

Query: 467 LYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTV 526
           LY+ F  LEGIECQKPQGAMYLFP+LDLPFKAVQ+AQHLEM+PDEFYCKSLL+ATGICTV
Sbjct: 487 LYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTV 546

Query: 527 PGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFYNTYRD 568
           PGSGFGQEPGTYHLRTTFLAPGTEWI+KW+ FH++FY+ YRD
Sbjct: 547 PGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/554 (71%), Positives = 461/554 (83%), Gaps = 7/554 (1%)

Query: 19  RILTRTYSVNLTNNKFNNKMPHFMEPSTSPQ----YPYFETKRTISSAAXXXXXXXXXXX 74
           R   R+ SV L +    + MPH +  +   +      Y   KR  S+++           
Sbjct: 9   RCYMRSTSVGLISRA--SAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHK 66

Query: 75  XXNHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNAN 134
              H +F PA+ LT+ +LN+NVLKAKYAVRG+IPMRAEEL+ QL+ DPSSLPFD IVNAN
Sbjct: 67  KC-HQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNAN 125

Query: 135 IGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTV 194
           IGNPQQLNQKPLSFYRQVLS+LQYPE+L+Q E +L++ G+FK+DA+ERAK +L ++GG+V
Sbjct: 126 IGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSV 185

Query: 195 GAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVL 254
           GAYS+SQGVYGIRKTVA+FIT+RD+GEPAYPEDIFLTAGASAAV YLLSILC+G ETGVL
Sbjct: 186 GAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVL 245

Query: 255 IPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINP 314
           IPIPQYPLYTA+LALNNSH LPYYLDE+SGWSTN  EIE VV  + +  IRPSVLVVINP
Sbjct: 246 IPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINP 305

Query: 315 GNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGV 374
           GNPTG+VLS ++IE IF++AAKYGIVVIADEVYQEN+F   +FHSMKKVLR LQK+HPG+
Sbjct: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGI 365

Query: 375 YDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDL 434
           YD VQL SLHSTSKGVSGECGQRGGYMELTGFTHE+R V+LKLASISLCPVVTGQALVDL
Sbjct: 366 YDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDL 425

Query: 435 MVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDL 494
           MV PPK GDES+EQD+ ER+ I  EL  RA  L+  FN+LEGIECQKP+GAMYLFP++ L
Sbjct: 426 MVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKL 485

Query: 495 PFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEK 554
           P+KA+Q AQHLE +PDEFYC+ LLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI+K
Sbjct: 486 PYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKK 545

Query: 555 WKIFHQDFYNTYRD 568
           W+ FH+ FY+ YRD
Sbjct: 546 WEDFHKKFYDQYRD 559

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/551 (72%), Positives = 457/551 (82%), Gaps = 27/551 (4%)

Query: 20  ILTRTYSVNLTNNKFNNKMPHFMEPSTSPQYPYFETKRTISSAAXXXXXXXXXXXXXNHN 79
           I++R +S +      N KMPH ++    P      +K                    +H 
Sbjct: 66  IISRKFSASE-----NIKMPHAVKRQRKPAKDQLHSK--------------------SHY 100

Query: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139
            F PA Q+ +A+LN+NVLKAKYAVRG+IPMRAE+L+ QLQEDP SLPFD I+NANIGNPQ
Sbjct: 101 KFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQ 160

Query: 140 QLNQKPLSFYRQVLSLLQYPEILKQ-DESKLVASGLFKKDALERAKTLLHEIGGTVGAYS 198
           QLNQKPLSFYRQVLSLLQ+PE+L    E+   A+ L+K DA+ RA+ LL +IGG+VGAYS
Sbjct: 161 QLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYS 220

Query: 199 ASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIP 258
            SQGV GIRKTVA+FIT+RDN EPAYPEDIFLTAGASAAV YLLSI CKG +TGVLIPIP
Sbjct: 221 TSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIP 280

Query: 259 QYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPT 318
           QYPLYTA+LALNNSH LPYYLDEKSGWSTN KEI+ VVL A D+ I+PSVLVVINPGNPT
Sbjct: 281 QYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPT 340

Query: 319 GAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE-VKFHSMKKVLRNLQKKHPGVYDM 377
           GAVLSEK+I  IFEIAAKYGIVVIADEVYQEN+F+E VKFHSMKKVLR LQ++HPG +D 
Sbjct: 341 GAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDE 400

Query: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437
           VQLASLHSTSKGVSGECGQRGG+MELTGF+HE+R VILKLASISLCPVVTGQALVDLMV 
Sbjct: 401 VQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVH 460

Query: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497
           PP++G+ES+E DQAER HI SELH RA +L++ FN LEGI+CQKPQGAMYLFPRL+LPFK
Sbjct: 461 PPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFK 520

Query: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557
           AVQKAQH+EM+ DEFYCK LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWI+ W+ 
Sbjct: 521 AVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEK 580

Query: 558 FHQDFYNTYRD 568
           FH++FYN YRD
Sbjct: 581 FHKEFYNKYRD 591

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/492 (78%), Positives = 441/492 (89%)

Query: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136
           ++N F PA+QLTL ++N+NVLKAKYAVRGAIPMRAEELK QL++DP SLPFD I+NANIG
Sbjct: 101 SNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIG 160

Query: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196
           NPQQL QKPL++YRQVLSLLQYPE+L Q+E +LV S LFK DA++RAK+L+ +IGG+VGA
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGA 220

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           YS+SQGV GIRK+VA FITKRD GE +YPEDIFLTAGASAAV YLLSI C+GPETGVLIP
Sbjct: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
           IPQYPLYTA+LALNNS ALPYYLDE SGWSTNP+EIE VV  A   +I+P+VLVVINPGN
Sbjct: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTGAVLS +SI  IFE+AAKYG VVIADEVYQEN+F   KFHSMKK+LR+LQ++HPG +D
Sbjct: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFD 400

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV
Sbjct: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
            PP +G+ESFE DQAER  I  +L TRAM LY+ FN+LEGIECQKPQGAMYLFP++DLPF
Sbjct: 461 RPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPF 520

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
           KAVQ+A+HLE++PDEFYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI+KW+
Sbjct: 521 KAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE 580

Query: 557 IFHQDFYNTYRD 568
            FH++F++ YRD
Sbjct: 581 SFHKEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/491 (78%), Positives = 442/491 (90%)

Query: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137
           +++F PA+QLTL ++N+NVLKAKYAVRGAIPMRAEELK QL++DP SLPFD I+NANIGN
Sbjct: 102 NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 161

Query: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197
           PQQL QKPL++YRQVLSLLQYPE+L Q+E +LV S LFK DA++RAK+L+ +IGG+VGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257
           S+SQGV GIRK+VA FITKRD+GE +YPEDIFLTAGASAAV YLLSI C+GPETGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317
           PQYPLYTA+LALNNS ALPYYLDE+SGWSTNP+EIE VV  A   +I+P+VLVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377
           TGAVLS +S+  IFE+AAKYG VVIADEVYQEN+F   KFHSMKK+LR LQ++HPG +D 
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437
           VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497
           PP +G+ESFE DQAER  I  +L TRAM LY  FN+LEGIECQKPQGAMYLFP++DLPFK
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557
           AVQ+A+HLE++PDEFYCKSLLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI+KW+ 
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 558 FHQDFYNTYRD 568
           FH++F++ YRD
Sbjct: 582 FHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/492 (77%), Positives = 441/492 (89%)

Query: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136
           ++N F PA+QLTL ++N+NVLKAKYAVRGAIPMRAEELK QL++DP SLPF+ I+NANIG
Sbjct: 101 SNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIG 160

Query: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196
           NPQQL QKPL++YRQVLSLLQYPE+L Q+E +LV S LFK DA++RAK+L+ EIGG+VGA
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGA 220

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           YS+SQGV GIR++VA FITKRD GE +YPEDIFLTAGASAAV YLLSI C+GPETGVLIP
Sbjct: 221 YSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
           IPQYPLYTA+LALNNS ALPYYLDE SGWSTNP+EIE VV  A + +I+ +VLVVINPGN
Sbjct: 281 IPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGN 340

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTGAVLS +SI  IFE+AAKYG VVIADEVYQEN+F   KFHSMKK+LR+LQ++HPG +D
Sbjct: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFD 400

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV
Sbjct: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
            PP +G+ESFE DQAER  I  +L TRAM LYK FN+LEGIECQKPQGAMYLFP++DLPF
Sbjct: 461 RPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPF 520

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
           +AVQ+A+HLE++PDEFYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI+KW+
Sbjct: 521 RAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE 580

Query: 557 IFHQDFYNTYRD 568
            FH++F++ YRD
Sbjct: 581 TFHKEFFDHYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/491 (76%), Positives = 439/491 (89%)

Query: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137
           +N F PA+QLTL ++N+NVLKA+YAVRGAIPMRAEELK QL++DP SLPF+ I+NANIGN
Sbjct: 102 NNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGN 161

Query: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197
           PQQL QKPL++YRQVLSLLQYPE+L  +E +LV S LFK DA++RAK+L+ +IGG+VGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAY 221

Query: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257
           S+SQGV GIRK+VA+FITKRD GE AYPEDIFLTAGASAAV YLLSI C+GPETGVLIPI
Sbjct: 222 SSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPI 281

Query: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317
           PQYPLYTA+LALNNS  LPYYLDE SGWSTNP+EIE VV  A   +I+P+VLVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377
           TGAVLS +SI  IFE+AAKYG VVIADEVYQEN+F   +F+SMKKVLR+LQ+ HPG +D 
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDN 401

Query: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437
           VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497
           PP +G+ESFE DQ+ER  I  +L+TRAM LY+ FN+LEGIECQKPQGAMYLFP++D+PFK
Sbjct: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521

Query: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557
           A+Q+A HLE++PDEFYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EW++KW+I
Sbjct: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581

Query: 558 FHQDFYNTYRD 568
           FH++F++ YRD
Sbjct: 582 FHKEFFDQYRD 592

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/486 (76%), Positives = 423/486 (87%)

Query: 83  PADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLN 142
           PA++L L+E+N+NVLKAKYAVRGAIPM A EL  +L++DP SLPFD+IV+ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 143 QKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQG 202
           QKPL+FYRQVLSLLQYP +L+++E  L+ S L++KDA+ RA+ LL++IG +VGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 203 VYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPL 262
           + GIR+TVA FIT+RD GE AY EDIFLTAGAS+AV YLLSILCKG ETGVLIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 263 YTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVL 322
           YTASLALNNSH LPYYLDEKSGWSTNP EIE+VV  A ++ I+PSVLVVINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 323 SEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLAS 382
           SE+ I  IF IAAKYGIVVIADEVYQENVF+  +FHSMKK+LR LQK +PGV+D VQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 383 LHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKG 442
           LHSTSKGVSGECGQRGGYME+TGF +++R VILKLASISLCPVVTGQALVDLMVSPPK G
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 443 DESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKA 502
           DES+E DQ ERK I   L  RA +L+  FN+LEGIECQKP+GAMYLFPRL LPFKA+Q A
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 503 QHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDF 562
           +H  M+PD FYCK LLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIE+W+ FH+ F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 563 YNTYRD 568
           Y  YRD
Sbjct: 529 YEEYRD 534

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/494 (74%), Positives = 430/494 (87%), Gaps = 4/494 (0%)

Query: 77  NHNN--FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNAN 134
           +HNN  FLPA+Q TL ++N+ VL AKYAVRGAIPMRAEELK QL E+P SLPF+ I+NAN
Sbjct: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142

Query: 135 IGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTV 194
           IGNPQQL QKPLSFYRQVLSLLQYPE++   E+      + K+DA++RAK LL +IGG+V
Sbjct: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN--PQTMIKQDAIDRAKRLLDDIGGSV 200

Query: 195 GAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVL 254
           GAYS+SQGV GIRKTVA+FIT RD+G  AYPEDIFLTAGAS+AV YLLSI C+G ETGVL
Sbjct: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260

Query: 255 IPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINP 314
           IPIPQYPLYTA+LAL NSHALPYYL+E++GWST+P+E+E ++L + +  I+PSVLVVINP
Sbjct: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINP 320

Query: 315 GNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGV 374
           GNPTGAVLSE++IE IF +AAKYGI+VIADEVYQENVF +VKFHSMKKVLR LQ K PG+
Sbjct: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380

Query: 375 YDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDL 434
           YD VQLASLHSTSKGVSGECGQRGGYMEL GFTH++R V+LKLASISLCPVVTGQALVDL
Sbjct: 381 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDL 440

Query: 435 MVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDL 494
           MV PP+KG+ES+EQDQ ER++I  ELH RA  L+  F  L+GI CQKPQGAMYLFP+L+L
Sbjct: 441 MVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLEL 500

Query: 495 PFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEK 554
           P+KA+Q+A H +MSPDEFYCKSLLE TGICTVPGSGFGQEPGTYHLRTTFLAPGT+WIE 
Sbjct: 501 PYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIED 560

Query: 555 WKIFHQDFYNTYRD 568
           W  FHQ+FYN +++
Sbjct: 561 WVDFHQEFYNKFKN 574

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/488 (75%), Positives = 419/488 (85%), Gaps = 1/488 (0%)

Query: 81  FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQ 140
           F PAD+L+L +LN+NVL+AKYAVRG IP +AEELK QL  DP SLPFD I+NANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 141 LNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200
           L+QKPL+FYRQVLSLLQ P++L++   + + S ++K DA++RA  LL  IGG+VGAYS S
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 201 QGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQY 260
           QGVYG RKTVA+FITKRD GE AY EDIFLTAGASAAV Y+LSILC+GP+TGVLIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 261 PLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGA 320
           PLYTASLALNNSHALPYYLDE+S WSTNP+EIE+VV  +  K + P  LVVINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 321 VLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQL 380
           +LS +SIE IFE+AAKYGIVVIADEVYQENVFN  +FHSM+KVL++LQ+KH G +D +QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 381 ASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPK 440
           ASLHSTSKGVSGECGQRGGYMEL GF+H+VR V LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 441 KGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQ 500
            GD S+EQDQ ER  I   L  RA  LY+ FN LEGIECQKPQGAMYLFPRLDL +KAVQ
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 501 KAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQ 560
           KA+HL +SPDEFYC+ LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WI+ W+ FH+
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 561 DFYNTYRD 568
            FYN YRD
Sbjct: 524 KFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/486 (73%), Positives = 423/486 (87%), Gaps = 2/486 (0%)

Query: 83  PADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLN 142
           PA +L+L ++N+NVLKAKYAVRG IPMRAEEL+ QL++DPSSLPF  I++ANIGNPQQL+
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 143 QKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQG 202
           QKPL+FYR+VLSLLQ+PE+L++ +  L    L+K D+++RAK LL E+GG+VGAYS SQG
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 203 VYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPL 262
           V GIR+TVA+FITKRD+GE +YPEDI+LTAGASAAV Y+LSILCKGP TGVLIPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 263 YTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVL 322
           YTASLALNNS  LPYYL E+  WST+P+EIE+VVL A  K I+P+ LVVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 323 SEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLAS 382
           SE+SI+ IFE+AAKYGIVVIADEVYQENVF   KF+SMKKVLRNLQK + G YD +QLAS
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 383 LHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKG 442
           LHSTSKGVSGECGQRGGYMEL GF H++R V LKLASISLCPVVTGQALVDLMVSPP+ G
Sbjct: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 443 DESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKA 502
           DES+EQDQ ER+ I   L  RA +L++ F+ LEGIEC+KPQGAMYL+P+LDLP+K +Q+A
Sbjct: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 503 QHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDF 562
           QHLEM PDEFYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E W+ FH+ F
Sbjct: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 563 YNTYRD 568
           ++ YRD
Sbjct: 523 FDKYRD 528

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/490 (75%), Positives = 421/490 (85%), Gaps = 1/490 (0%)

Query: 78  HN-NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136
           HN NF PA QLT+ +LN+NVLKAKYAVRG IP RAEELK QL E P+SLPFD I+NANIG
Sbjct: 48  HNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIG 107

Query: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196
           NPQQL Q+PLSFYRQVLSLLQYP +L   E+K  +S ++KKDA+ RAK +L +IGG+VGA
Sbjct: 108 NPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGA 167

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           YS SQGVYGIR+TVANFIT+RD GEPAYPEDIFLTAGASAAV YLLSILCKG +TGVLIP
Sbjct: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
           IPQYPLYTA+LALNNSHALPY+LDE +GWS NP EIE V+  A    I+P VLVVINPGN
Sbjct: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTGAVLS+++I  I EIAAKYGIVVIADEVYQEN+F+ +KFHS+K VLR LQ++ PG +D
Sbjct: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFD 347

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHSTSKGVSGECGQRGGYME+ GFTHEVR VILKLASISLCPVVTGQALVDLMV
Sbjct: 348 NVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMV 407

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
           SPPK+G+ESF  DQA+RK I S+L  RA  L+K FN+L+GIECQKP GAMYLFP+L+LP+
Sbjct: 408 SPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPY 467

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
           +A+Q+AQ LE+SPDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI+ WK
Sbjct: 468 RAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWK 527

Query: 557 IFHQDFYNTY 566
            FH +F   Y
Sbjct: 528 QFHIEFMEKY 537

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/490 (71%), Positives = 418/490 (85%), Gaps = 8/490 (1%)

Query: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNP 138
           +N  PA +L + +LN NVLKAKYAVRG+IP+RAEELK+ L E    LPFD ++NANIGNP
Sbjct: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANIGNP 89

Query: 139 QQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYS 198
           QQL QKPL+FYRQVLS+LQYPE+L+        S +FKKDA+ERA+ LL EIG +VG+YS
Sbjct: 90  QQLKQKPLTFYRQVLSILQYPELLES------GSNIFKKDAIERARKLLKEIG-SVGSYS 142

Query: 199 ASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIP 258
           +SQG+  IRKTVANFITKRD+GE + P DIFLTAGAS+AV YLLSILCK  ++GVLIPIP
Sbjct: 143 SSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIP 202

Query: 259 QYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPT 318
           QYPLYTA+LALNN+HALPYYLDE  GWST+  EIEEV+  + DK I+P+ LV+INPGNPT
Sbjct: 203 QYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPT 262

Query: 319 GAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMV 378
           G++LS +S+E I E+AA +GIV+IADEVYQENVFN  KFHSMKKVLRNLQK  PG YD V
Sbjct: 263 GSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTV 322

Query: 379 QLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSP 438
           QLASLHSTSKGVSGECGQRGGYMELTGF  E++ VILKL SISLCPVVTGQALVDLMVSP
Sbjct: 323 QLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSP 382

Query: 439 PKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKA 498
           P+KGDES+EQDQ ER  I ++L  RA+ L++ FN++EG+ CQKP+GAMYLFP++DLPFK 
Sbjct: 383 PQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKV 442

Query: 499 VQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIF 558
           +QK+Q L+++PDEFYCK+LLEATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI++W  F
Sbjct: 443 LQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKF 502

Query: 559 HQDFYNTYRD 568
           H +FY+ YRD
Sbjct: 503 HAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/491 (71%), Positives = 419/491 (85%), Gaps = 1/491 (0%)

Query: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137
           H NF PAD+LT+ +LN+NVLKAKYAVRG IP RAE LK QL ++PSSLPF  ++NANIGN
Sbjct: 33  HKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGN 92

Query: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197
           PQQLNQKPL+FYRQVLSLLQYP +L +  S    + L+K+DA+ERAK +L++IG +VG+Y
Sbjct: 93  PQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIGSSVGSY 151

Query: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257
           S+SQGV+G+RKTVA +I++RD GE AY EDIFLTAGAS+AV YLL+ILCKG E+GVLIPI
Sbjct: 152 SSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPI 211

Query: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317
           PQYPLYTA+LALNN++ALPYYL+E SGWSTN +EIE VV  A  +KI P VLVVINPGNP
Sbjct: 212 PQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNP 271

Query: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377
           TGA+LS +SIE IF++AA +GIVVIADEVYQEN+F   +FHSMKKVLR+LQ++ PG Y+ 
Sbjct: 272 TGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYEN 331

Query: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437
           VQLASLHSTSKGVSGECGQRGGYMELTGF+ E++  ILKL SISLCPVVTGQALVDLM  
Sbjct: 332 VQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTC 391

Query: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497
           PPKKG+ S+EQDQ ER  I SEL+ RA  L+K FN +EG+ CQKPQG+MYLFP++D+P K
Sbjct: 392 PPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHK 451

Query: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557
           A++KAQ L+++PDE YC  LLEATGICTVPGSGFGQ+PGT+HLRTTFLAPGT WI++W+ 
Sbjct: 452 ALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWRE 511

Query: 558 FHQDFYNTYRD 568
           FHQ F N YRD
Sbjct: 512 FHQIFCNKYRD 522

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/489 (68%), Positives = 400/489 (81%)

Query: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139
           +F PA ++T  +LN +V KA+YAVRG+IP RA+ELK +L+++P  LPFD I+NANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199
           QL+QKPL+F RQVLS+L+YPEIL+ D  KL +  LF KDAL+RA+ LL +IGG+VGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259
           SQGV GIR+TVA+FIT RD GEPA PEDI+LT GAS+A   LLS+LCK   TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319
           YPLYTAS +L N+  LPYYLDE+  WST   EIE+VV  A +K IRPSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379
           AVL+E++I  I  IAAKYGI VI+DEVYQENVFN+ KFHSMKKVLR LQ  +PG +D VQ
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439
           LASLHS SKG  GECGQRGGYME+ GF+ ++R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499
           + GDES+EQD+ ER  I +E+ TRA  LY+ FN LEGIECQ PQGAMYLFPRL LP KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559
           ++++ L + PDEFYC SLLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ WK FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 560 QDFYNTYRD 568
           Q F+N YRD
Sbjct: 499 QSFFNEYRD 507

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/491 (66%), Positives = 406/491 (82%), Gaps = 1/491 (0%)

Query: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137
           +N+F PA +L+L ++N+NV+ AK+A+RG+I ++AE+L++QL ++P  LPFD I  ANIGN
Sbjct: 8   NNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGN 67

Query: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197
           PQ+LNQKPL+F RQV+S+LQYPE+L  +   L    +F  D+ +RA+ LL +IGG+VGAY
Sbjct: 68  PQELNQKPLTFARQVVSILQYPELL-NNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126

Query: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257
           SASQGVYGIRKT A +ITKRD GEP+YPEDIFLT GA++A  YLLS+LC+GP+TGVLIPI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317
           PQYPLYTA+LALN S  +PYYLDE+S WSTN  EIE++VL +  K I+PSV+VVINPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377
           TGAVLSE +I  IF+IAAKYGIVV+ADEVYQEN+F+ V+FHS KKVLR LQK++PG +D 
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437
           +QLAS+HSTSKGV GECGQRGGYMEL GFT EVR ++LKLA +++C VVTGQA+VDLM+ 
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497
           PPKKGD S+E D+ ER+ I   ++ RA +LY  F+ L+GIECQKPQGAMYL+P L L  K
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557
           A+ KA+ L ++PDEFYC  LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI KW+ 
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 558 FHQDFYNTYRD 568
           FH+ FY  Y+D
Sbjct: 487 FHKHFYEKYQD 497

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/489 (68%), Positives = 400/489 (81%)

Query: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139
           NF PA ++T  +LN  V KA+YAVRGAIP RA+ELK +L+  P  LPFD I+NANIGNPQ
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78

Query: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199
           QL+QKPL+F RQVLS+L+YPEIL+    KL +  LF+KDAL RA+ LL +IGG++GAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138

Query: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259
           SQGV GIR++VA FITKRD+GEPA PE+I+LT GAS+A   LLS+LCK  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQ 198

Query: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319
           YPLYTAS +L N+  LPYYLDE S WST   EIE+VV  A +K I+PSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258

Query: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379
           AVLSE +I  I  IAAKYGI +I+DEVYQENVFN VKFHSMKKVLR LQ+ +PG +D VQ
Sbjct: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318

Query: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439
           LASLHS SKG  GECGQRGGYME+ GF+ ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499
           + GDES++QD +ER  I  E++TRA  L++ FN LEGIECQKPQGAMYLFPRL LP KA+
Sbjct: 379 QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438

Query: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559
           ++++ L + PDEFYC SLLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ WK FH
Sbjct: 439 RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498

Query: 560 QDFYNTYRD 568
           QDF+N YRD
Sbjct: 499 QDFFNKYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/491 (68%), Positives = 407/491 (82%), Gaps = 4/491 (0%)

Query: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSS--LPFDHIVNANIG 136
           +NF PA ++TL +LN NVLK++YAVRG+IP RAEEL+ +L  + SS  L F++IV+ANIG
Sbjct: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85

Query: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196
           NPQQL+QKPL+F RQV+S+LQYPE+L Q  + LV++G+FK DA+ERA+TLL  IGG+VGA
Sbjct: 86  NPQQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGA 144

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           YS+SQGVYGIR+TVAN+IT RDNGE A P+DIFLT GAS A  YLLS+LCK   TGVLIP
Sbjct: 145 YSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIP 204

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
           IPQYPLYTA++ L ++  LPYYL+E+SGWSTN  EIE+VVL A    ++PSV+VVINPGN
Sbjct: 205 IPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGN 264

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTG+VLS+  I HI  I AKYGIV+IADEVYQEN+F+  +FHSMKKVLR+LQK++PG YD
Sbjct: 265 PTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYD 323

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHSTSKGVSGECGQRGGYMEL GF  E+R  ILKLASISLC V+TGQALVDLMV
Sbjct: 324 AVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMV 383

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
           +PPKKGDES+E D  ERK+I   L  RA +LY  F  L+G+ECQKPQGAMYLFP+L  P 
Sbjct: 384 NPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQ 443

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
             + +A +  MSPDEFYC +LLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W EKWK
Sbjct: 444 TLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWK 503

Query: 557 IFHQDFYNTYR 567
           +FH++F++ Y+
Sbjct: 504 LFHEEFFSKYQ 514

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/489 (67%), Positives = 401/489 (82%)

Query: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139
           +F PA ++T  +LN  V KA+YAVRGAIP RA+ELK +L+++P  LPFD I+NANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199
           QL+QKPL+F RQVL++L+YPEIL+   ++L +  LF +DALERA+ LL++IGG++GAYS 
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259
           SQGV GIR+TVA+FIT+RD GEPA PEDI+LT GAS+A   LLS+LCK  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319
           YPLYTAS +L N+  LPYYLDE+S WSTN  EIE+VV  A  K+IRPSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379
           AVLSE++I  I  IAAKYGI +I+DEVYQEN+FN+VKFHSMKKVLR LQ  +PG +D VQ
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439
           LASLHS SKG   ECGQRGGYME+ GF+ E+R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499
           + GDES+EQD  ER  I  E+ TRA  LY+ F  LEGIECQKPQGAMYLFPRL LP KA+
Sbjct: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559
            +++ L + PDEFYC SLLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI+ WK FH
Sbjct: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 560 QDFYNTYRD 568
           QDF++ YR+
Sbjct: 499 QDFFSKYRN 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/489 (66%), Positives = 397/489 (81%)

Query: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139
           +F PA +LT  +LN +V KA+YAVRGAIP RAEELK +L+   +SLPF+ I+NANIGNPQ
Sbjct: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78

Query: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199
           QL+QKPL+F RQVLS+L+YPEIL+ D  KL +  LF KDAL+RA+ LL +IGG+VGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138

Query: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259
           SQGV GIR+TVA+FIT+RD GEPA PEDI+LT GAS+A   LLS+LCK  +TG+L+PIPQ
Sbjct: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQ 198

Query: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319
           YPLYTAS +L N+  LPYYLDE++ WST   EIE VVL A  K IRPSVLVVINPGNPTG
Sbjct: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258

Query: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379
           AVL+E +I  I  IAAKYGI +I+DEVYQEN+F +VKFHSMKK+LR LQ  HPG +D VQ
Sbjct: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318

Query: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439
           LASLHS SKG  GECGQRGGYME+ GF+ ++R  + KL SIS+C V TGQA++DLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378

Query: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499
           + GDES++QD+ ER  I +E+ TRA  LY+ FN LEGI+CQKPQGAMYLFP+L LP KA+
Sbjct: 379 QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438

Query: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559
           ++++ L + PD  YC SLLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+ W+ FH
Sbjct: 439 RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498

Query: 560 QDFYNTYRD 568
           QDF+N YRD
Sbjct: 499 QDFFNKYRD 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 392/481 (81%), Gaps = 2/481 (0%)

Query: 88  TLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLS 147
           TL ++N+ VL AKYAVRG IP+RAEELK +L E+P SLPFD I+NANIGNPQQL+QKPL+
Sbjct: 40  TLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLT 99

Query: 148 FYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGVYGIR 207
           FYRQVL+LLQ P+++  D S       FK DA+ERAK +L ++GG+VGAYS SQGV G R
Sbjct: 100 FYRQVLALLQNPDLIS-DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFR 158

Query: 208 KTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASL 267
           ++VA FI +RD GEPA  +DIFLT GAS AV Y+LS+ C GPE G LIPIPQYPLYTASL
Sbjct: 159 ESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASL 217

Query: 268 ALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSI 327
           ALNNSHALPYYLDE+SGWS + ++IE+VV  +  K IRP+ LVVINPGNPTGA+L+  +I
Sbjct: 218 ALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTI 277

Query: 328 EHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTS 387
           E++ ++AAKY +V+IADEVYQEN FN+ +F SMKKVLR LQK  PG YD VQLASLHSTS
Sbjct: 278 ENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 337

Query: 388 KGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGDESFE 447
           KGVSGECGQRGGYMEL GF+ EV+ V LKLASISLCPVVTGQAL+DLMV PPKKGD S+E
Sbjct: 338 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYE 397

Query: 448 QDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQHLEM 507
           QD+ ER  I   LH R+  LY+ F ++EG+ CQ+PQGAMYLFP+L+L  KA+ KA+   +
Sbjct: 398 QDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGL 457

Query: 508 SPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFYNTYR 567
           +PDE+YCK LLEATGICTVPGSGFGQ PGT+HLRTTFLAPGTEWI+ WK FH+ F   +R
Sbjct: 458 APDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHR 517

Query: 568 D 568
           D
Sbjct: 518 D 518

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 391/481 (81%), Gaps = 2/481 (0%)

Query: 88  TLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLS 147
           TL ++N  VL AKYAVRG IP+RAEEL+ +L E+P SLPF+ I+NANIGNPQQL+QKPL+
Sbjct: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100

Query: 148 FYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGVYGIR 207
           FYRQVLSLLQ P +++   +  +   LFK DA+ERAK +L ++GG+VGAYSASQGV G R
Sbjct: 101 FYRQVLSLLQNPALIESLPTGELHK-LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159

Query: 208 KTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASL 267
           ++VA FI +RD GEPA   DIFLTAGAS+AV  +LS+ C G E G LIPIPQYPLYTA+L
Sbjct: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218

Query: 268 ALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSI 327
           ALN++HALPYYLDE SGWS + +++E+VV  A  K +RP+ LVVINPGNPTGA+LS ++I
Sbjct: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278

Query: 328 EHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTS 387
           E I  +AAKY +VVIADEVYQEN F++  F SMKKVLR LQK  PG YD VQLASLHSTS
Sbjct: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338

Query: 388 KGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGDESFE 447
           KGVSGECGQRGGYMEL GF+ EV+ V LKLASISLCPVVTGQALVDLMV PPKKGD S+E
Sbjct: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398

Query: 448 QDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQHLEM 507
            D+ ER  I + LH ++  LY+ F +LEG+ CQKPQGAMYLFP+LDL  KA++KA+ L M
Sbjct: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458

Query: 508 SPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFYNTYR 567
           +PDE+YCK LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW++ WK FHQ F + +R
Sbjct: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518

Query: 568 D 568
           D
Sbjct: 519 D 519

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 396/489 (80%), Gaps = 2/489 (0%)

Query: 81  FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQ 140
           F PA +L   +LN N++ A+YAVRGAIPM+AEEL+IQL + P  LPF+ I  ANIGNPQQ
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 141 LNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200
           L+QKPL+F RQV+S+LQYP +L  +E +LV SG +K+DA +RA  LL +IGG+VGAYS +
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEE-QLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLA 152

Query: 201 QGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQY 260
           QGVYGIR++VA+FIT+RD GE A P+DIFLT GAS A  YLLSILC+   TG++IPIPQY
Sbjct: 153 QGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQY 212

Query: 261 PLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGA 320
           PLYTAS+ + NS  LPYYLDE+SGWST  +EIE+ V+ +  + + P V+VVINPGNPTGA
Sbjct: 213 PLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272

Query: 321 VLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHP-GVYDMVQ 379
           VLS  +I  I  IAAKYGIVV+ADEVYQ N++  VKFHSMKKVLR+LQ+ HP G YD VQ
Sbjct: 273 VLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQ 332

Query: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439
           LAS+HSTSKGVSGECGQRGGYMEL GF++EVR VILKLASIS+C VVTGQALVDLM++PP
Sbjct: 333 LASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPP 392

Query: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499
           ++GD+S+E D  ERK I + + TR   LY  F  LEGIECQ+PQGAMYLFP+L L  KA+
Sbjct: 393 REGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAI 452

Query: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559
           ++A+ L + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI+ W+ FH
Sbjct: 453 EEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFH 512

Query: 560 QDFYNTYRD 568
           + FY+ YRD
Sbjct: 513 KAFYDKYRD 521

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/493 (64%), Positives = 394/493 (79%), Gaps = 4/493 (0%)

Query: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQL--QEDPSSLPFDHIVNAN 134
           N ++F PA ++++A+LN  ++ A+YAVRG+I MRAEEL+ +L  +  P S PF+ I+ AN
Sbjct: 20  NTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYAN 79

Query: 135 IGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTV 194
           IGNPQQL+QKPL+F RQV+S+L+YP +LK  +  L++ G++KKDALERA+ L  +IG +V
Sbjct: 80  IGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQIGASV 138

Query: 195 GAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVL 254
           GAYS +QGVYGIR+T A FI+KRDN E A  +DIFLT GAS AV YL+  LC+   TG+L
Sbjct: 139 GAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGIL 198

Query: 255 IPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINP 314
           IPIPQYPLYTAS+ ++N+  LPYYLDE+SGWST  +EIE  V+ A +  I+PS +VVINP
Sbjct: 199 IPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINP 258

Query: 315 GNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGV 374
           GNPTGAVLS   I+ I  +AAKYGIV+IADEVYQ+N+FN  +FHSMKK+LR LQKK+PG 
Sbjct: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGK 317

Query: 375 YDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDL 434
           YD VQLASLHSTSKGVSGECGQRGGYME+ GF+ EVR ++LKLASI++C VVTGQALVDL
Sbjct: 318 YDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDL 377

Query: 435 MVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDL 494
           MV PP  GDES+E+DQ ER  I S L  RA +LY  F+ LEGIECQKPQGAMYLFPRL L
Sbjct: 378 MVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLIL 437

Query: 495 PFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEK 554
           P +A+++A+ L+M  DEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI+ 
Sbjct: 438 PDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDD 497

Query: 555 WKIFHQDFYNTYR 567
           WK FH+ F   Y+
Sbjct: 498 WKKFHEKFMKEYQ 510

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/490 (64%), Positives = 386/490 (78%), Gaps = 3/490 (0%)

Query: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139
           +F+PA++L++ +LN + + A YAVRG+IPMRAE+L  Q+  DP SLPFD I+ ANIGNPQ
Sbjct: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQ 61

Query: 140 QLNQKPLSFYRQVLSLLQYPEILKQDE--SKLVASGLFKKDALERAKTLLHEIGGTVGAY 197
           Q+ QKPL+F RQVLS+L+YP IL   E   KLV  G++++D +ERA+ +L  IGG+VGAY
Sbjct: 62  QVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121

Query: 198 SASQGVYGIRKTVANFITKRDNGEP-AYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           SASQGV G R+TVA+FI KRD  +  A P DIFLT GAS+AV YLLSILC GPE GVLIP
Sbjct: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
           IPQYPLYTA+L L+NS A+PYYL E + WSTN KEIE  +  +    ++P  +V+INPGN
Sbjct: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTGA+LSE  +  I  I+AKYGI +IADEVYQEN+F   +FHSM+KVL NLQ + PG YD
Sbjct: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHSTSKG  GECGQRGGYMEL GF  EV +++LKLASIS+C VVTGQAL+DL+ 
Sbjct: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
            PP+ GD S++ DQ ER  IK +L  RA +LY  F +LEG+ECQ+PQGAMYLFP+L LP 
Sbjct: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
           KA++KA  LE+ PDE+YC+ LL+ATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWIE+W+
Sbjct: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481

Query: 557 IFHQDFYNTY 566
            FHQ FY  +
Sbjct: 482 EFHQQFYERF 491

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 395/490 (80%), Gaps = 2/490 (0%)

Query: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNP 138
           ++F PA +L++ +LN NV+KA++AVRG IPM+A+EL+ QL ++P SLPF+ I  ANIGNP
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70

Query: 139 QQLNQKPLSFYRQVLSLLQYPEIL-KQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197
           Q+L+QKPL+F RQV+S+LQYPE+L +++E       ++  D+ +RA+ LL+EIGG+VGAY
Sbjct: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257
           SASQGVYGIRKT+AN+IT+RD GE A P DIF+T GA+AA  YLLSIL  GP+TGVL+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLA-AKDKKIRPSVLVVINPGN 316
           PQYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE+ +   A  K I+P V+V+INPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTG++LSE S+  IF IAAKYGIV+IADEVYQEN+FN  KFHS KKVLR+LQK+ P  Y+
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHSTSKG+ GECGQRGGYME+ GF ++VR++ILKLA I +CPVVTGQA++DLM+
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
            PPK+GD+S++ D  ER+ I +++  RA +LY  F+ +EGI+CQKPQGAMYLFPRL L  
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
           K + +A+  EM PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI KW+
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 557 IFHQDFYNTY 566
            FH+ F   Y
Sbjct: 491 KFHKAFLKRY 500

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 396/484 (81%), Gaps = 2/484 (0%)

Query: 84  ADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQ 143
           A++L   +LN NV+KAKYAVRGAIP  A++LKIQL + P +LPF+ ++N+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 144 KPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGV 203
           KPLSF RQVLS+L+YP +L   E  LV S  +  D++ERAKTLL +IG ++GAYS SQGV
Sbjct: 141 KPLSFGRQVLSILEYPALLDH-ERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGV 198

Query: 204 YGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLY 263
           +GIR+TVA+FIT RD+GE AYP+DIFLTAGAS+AV  +LSILCKG +TGVLIPIPQYPLY
Sbjct: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLY 258

Query: 264 TASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLS 323
           TA+L LN++ ALPYYLDE +GWST+  EI +V   + +  I+P+ LVVINPGNPTG+VL+
Sbjct: 259 TATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318

Query: 324 EKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASL 383
            ++I+++F++AAKYG+VVIADEVYQ+N+F   +FHSMKK+LR LQK+ P  YD +QLASL
Sbjct: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378

Query: 384 HSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGD 443
           HS SKG+ GECG RGGY E  GFT EV+ VI KL+SISLC  V GQALVDLM  PPKKG+
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 444 ESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQ 503
            S+E DQ ER+ I++    R+ +LY+ FN+LEG+ CQKPQGAMY+FP + LPF A++ AQ
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 504 HLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFY 563
           +L+++PDEFYC+ LL+ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW+++W+ FH +F+
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 564 NTYR 567
             YR
Sbjct: 559 EKYR 562

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/492 (64%), Positives = 387/492 (78%), Gaps = 3/492 (0%)

Query: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136
           + + F+PA+ +TLA++N+NV+KAKYAVRG IP RAEEL+ +L+E P SLPF  I+ ANIG
Sbjct: 33  DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIG 92

Query: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196
           NPQQL QKPL+FYRQV+SL+Q P++L+     L  +  FK D + RA+ +L + GG+VGA
Sbjct: 93  NPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA--FKADVVVRARRMLQDAGGSVGA 150

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           YSASQGV G R+TVA FI +RD G PA P++++LTAGAS+AV  LLS  CKGPETGVLIP
Sbjct: 151 YSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
           IPQYPLYTA++  NN+ ALPYYL+E  GWSTNP E+E V+L +K + I P  LVVINPGN
Sbjct: 210 IPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376
           PTG+VLS K +E I  +AAKYGIVVIADEVYQ+NVF + KFHSM+KVL+NLQ + P +Y 
Sbjct: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYK 329

Query: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436
            VQLASLHS SKG+SGECGQRGGYMEL GF  E+R V +KLASISLCPVVTGQALVDLMV
Sbjct: 330 NVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMV 389

Query: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496
            PP +GD S+EQ   E + I  EL  R+  L+K F +LEGIEC  PQGA+YLFP+L LP 
Sbjct: 390 GPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQ 449

Query: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556
           KA++ AQ L +  DE YC  LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WIE WK
Sbjct: 450 KAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWK 509

Query: 557 IFHQDFYNTYRD 568
            FH+ FY+ YRD
Sbjct: 510 DFHKKFYDKYRD 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/488 (62%), Positives = 382/488 (78%), Gaps = 3/488 (0%)

Query: 81  FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQ 140
           F P D L L +LN NVL+AKYAVRG IP RA EL+ QL  DP SLPF  I+ ANIGNPQQ
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 141 LNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200
           L QKPLSF R+VLSLL+ P +L+      V + ++K DA+ RAK ++ ++  ++GAYS S
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPME--VLNLIYKPDAVRRAKRMMRDLQTSIGAYSHS 167

Query: 201 QGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQY 260
           QGV G RKTVA +++ RD GEPA  EDIFLT GAS     ++ +LCKG E+GVLIPIPQY
Sbjct: 168 QGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQY 226

Query: 261 PLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGA 320
           PLYTA++ LNN+ ALPYYLDE+SGWS N  ++E +++ + +K ++P+ LVVINPGNPTGA
Sbjct: 227 PLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGA 286

Query: 321 VLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQL 380
           +L  +S+E IF IAAKY IVVIADEVYQENVF  +KF+SMKKVLR+LQ+++  ++  VQL
Sbjct: 287 ILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQL 346

Query: 381 ASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPK 440
            SLHSTSKG+SGECGQRGGYMEL GF+ ++R VILK+ASI LC  V GQALVDLM+S PK
Sbjct: 347 VSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPK 406

Query: 441 KGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQ 500
            GDES+E+D +ER  I++ L  R+  L++ FN LEG+EC+KPQG+MYLFPRL LP KA++
Sbjct: 407 PGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIK 466

Query: 501 KAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQ 560
            A+ L+M PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTFL PGTEWIE W++FH+
Sbjct: 467 AAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHK 526

Query: 561 DFYNTYRD 568
            FY+ YRD
Sbjct: 527 SFYDKYRD 534

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/492 (60%), Positives = 386/492 (78%), Gaps = 4/492 (0%)

Query: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNP 138
            +F P  ++TL +LN  ++K +YAVRG IP RAEELK+QL++DP SLPF+ I+NANIGNP
Sbjct: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66

Query: 139 QQLNQKPLSFYRQVLSLLQYPEILKQDESKL---VASGLFKKDALERAKTLLHEIGGTVG 195
           QQL QKPLSF R+VLS+LQYP+IL +DESKL   +   +++KD + RA+ LL EIGG+VG
Sbjct: 67  QQLGQKPLSFIRKVLSILQYPDIL-EDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125

Query: 196 AYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLI 255
           AYS SQGV GI++TVA++ITKRD+GE AYPEDIFLT GAS+AV ++L + C GP TGVLI
Sbjct: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185

Query: 256 PIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPG 315
           PIPQYPLYTA++ L  + A+ YYL+E+  WS N  E+E  +  +    I+P+ +V+INPG
Sbjct: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245

Query: 316 NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVY 375
           NPTG++L+EK I +I  I+AKYG+++IADEVYQENVF+  +FHS+KKVLR LQ+K+ G Y
Sbjct: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305

Query: 376 DMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLM 435
           + VQLASLHSTSKG+ GECGQRGGYMEL G T +VR  ++KL SIS+C VVTGQAL+D++
Sbjct: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365

Query: 436 VSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLP 495
           VSPP+ GDES+E DQ ER +IK++L +R+ +L++ F +LEG+EC +PQGAMYLFP+   P
Sbjct: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425

Query: 496 FKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKW 555
            K +  AQ L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI+ W
Sbjct: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485

Query: 556 KIFHQDFYNTYR 567
           + FH +F   YR
Sbjct: 486 RKFHTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/498 (60%), Positives = 376/498 (75%), Gaps = 8/498 (1%)

Query: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136
           N   FLPA + +L ++N+++LKA+YA+RG IP RAEEL IQL E+  SLPF  IV ANIG
Sbjct: 4   NQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIG 63

Query: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196
           NPQQL+Q+PL+F RQV+SL+Q+P++LK  +  L+A  ++ KD++ERA  LL+ IGG+VGA
Sbjct: 64  NPQQLDQQPLTFQRQVMSLVQFPDLLKSKDI-LLAQKIYSKDSIERATKLLNSIGGSVGA 122

Query: 197 YSASQGVYGIRKTVANFITKRD-NGEPAY------PEDIFLTAGASAAVMYLLSILCKGP 249
           YS+SQGV  IRK VA FI KRD + +P          ++FLTAGAS AV ++L +  K  
Sbjct: 123 YSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDE 182

Query: 250 ETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVL 309
             GVL+PIPQYPLYTA++ L  S  LPYYL+E + WST+PK+IE++V+ A  + I+P+ L
Sbjct: 183 SCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTL 242

Query: 310 VVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQK 369
           VVINPGNPTGA+L++ SI  I +IAA+YGIV+IADEVYQENV+   +FHS KKVL  L+K
Sbjct: 243 VVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRK 302

Query: 370 KHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQ 429
            +P  YD VQLASLHS SKGV+GECGQRGGYME+TGF+++V+ V+LK+ASIS+C VVTGQ
Sbjct: 303 NYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ 362

Query: 430 ALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLF 489
            LVDLMV+PP+ GDES+E DQ ER  I S L  ++  LY  F  L GI CQKPQGAMYLF
Sbjct: 363 ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF 422

Query: 490 PRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 549
           PRL L   A+  A  L + PDEFYC  LLE TGICTVPGSGFGQ PGTYHLRTTFL PG 
Sbjct: 423 PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI 482

Query: 550 EWIEKWKIFHQDFYNTYR 567
           EWI  W+ FH +F   Y+
Sbjct: 483 EWINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/494 (56%), Positives = 362/494 (73%), Gaps = 10/494 (2%)

Query: 83  PADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLN 142
           PA + +L +++ ++L  +YA+RG IP RA+EL+ QL   P+ LPF  I+ ANIGNPQQL 
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 143 QKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQG 202
           Q+PL+F RQVLSL++YP ++   ++ LV + ++  DA++RA+T+L+ IGG+VGAYS+SQG
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNS-KNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQG 126

Query: 203 VYGIRKTVANFITKRDNGEPAYPED---------IFLTAGASAAVMYLLSILCKGPETGV 253
           +  IRK VA  I +RDN E    ++         IFLT GA+ AV Y+L +  K    GV
Sbjct: 127 ILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGV 186

Query: 254 LIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVIN 313
           L+PIPQYPLYTA++ L NS  LPYYL+E   WST+P+EIE ++  A  + I+P+ LV+IN
Sbjct: 187 LLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIIN 246

Query: 314 PGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPG 373
           PGNPTGA+LS +SI  I  IAAKYGIV+IADEVYQ N++ + KFHS KK+L +L+ ++P 
Sbjct: 247 PGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPK 306

Query: 374 VYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVD 433
            YD VQLASLHS SKGV+GECGQRGGY EL GF+ E++ +ILKLASI +C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVD 366

Query: 434 LMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLD 493
           LM  PP+KGD S++ DQ ER +I+S L  ++  LY  F+ L GI CQKPQGAMYLFPRL 
Sbjct: 367 LMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLH 426

Query: 494 LPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIE 553
           L    + +A+   + PDEFYC  LLE TGICTVPGSGFGQ+ GTYH+RTTFL  G EWI+
Sbjct: 427 LTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIK 486

Query: 554 KWKIFHQDFYNTYR 567
            W+ FH +F N Y+
Sbjct: 487 LWEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 80/174 (45%), Gaps = 31/174 (17%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAA---VMYLLS-----ILCKG 248
           Y A QG + +RK +A   +  D       E++ LT GA AA     Y L+      +C  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 249 PETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSV 308
           P    L  IPQ  ++ A + L        +L +++ +  N  E+E ++      K     
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMI------KPNTKC 157

Query: 309 LVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKK 362
           +V+  P NP  +V+  +++  I E+A K+GIVV  DEVY         FHS +K
Sbjct: 158 IVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 138/321 (42%), Gaps = 29/321 (9%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  T G + A   +L I C   +T +L     +    ++      +  P  LDE     
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT-ILAEQFAFSSSISAAEAQGVNVFPIPLDEHG--- 189

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIAD- 344
             P ++E ++    +   +P +L  +  G NPTG+ LS    E I+ IA K+  ++I D 
Sbjct: 190 IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDE 249

Query: 345 -------EVYQENVFNEV--KFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECG 395
                  E Y+++  N V   +   K+ ++NL+K    +    ++  L S SK ++   G
Sbjct: 250 PYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA--PG 307

Query: 396 QRGGYMELTGFTHEVRSVILKLASISL-CPVVTGQALVDLMVSPPKKGDESFEQDQAERK 454
            R G+  + G   ++ + IL L  +++  P    Q+++   ++  + G E +       +
Sbjct: 308 TRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGYLDWLIGLR 362

Query: 455 HIKSELHTRAMQ-LYKNFNTLEGIECQKPQGAMYLFPRLDL---PFKAVQKAQHLEMSPD 510
           H  ++     +  LYK    ++ I+   P   M+    +D    P  A +     E    
Sbjct: 363 HEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSDPEKVEK 422

Query: 511 EFYCKSLLEATGICTVPGSGF 531
             + +S+  A+G+  VPG+ F
Sbjct: 423 AIFDRSI--ASGVLVVPGNWF 441

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 89/195 (45%), Gaps = 21/195 (10%)

Query: 221 EPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPY-YL 279
           EP   +++ L  G+   +  L+   C+     +L   P Y +Y+    +N+   +    +
Sbjct: 80  EPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLI 139

Query: 280 DEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGI 339
            E + +  N  E+   +    D KI+  +L + +PGNPTG ++++K IE I E     G+
Sbjct: 140 TEDNSFQMNVPEVLSTL--KNDPKIK--LLFITSPGNPTGKLVNKKDIEFILENWTN-GL 194

Query: 340 VVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGG 399
           VV+ DE Y +    E   +SM K    L  K+P       L  L + SK   G  G R G
Sbjct: 195 VVV-DEAYIDFADAEGTTYSMAK----LVTKYP------NLTVLQTLSKSF-GLAGIRLG 242

Query: 400 YMELTGFTHEVRSVI 414
              +T  + E  SV+
Sbjct: 243 ---VTFASEEFSSVL 254

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 80/181 (44%), Gaps = 23/181 (12%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSH--ALPYYL 279
           P   ++I L  G+  ++  ++   C   E  V++  P Y +Y     +N+     +P   
Sbjct: 84  PLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLIS 143

Query: 280 DEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGI 339
            + S      + +E++ L   DK I+  V+ + +PGNPTGA +    +E +       GI
Sbjct: 144 SDNSFQIDEDRILEQLNL---DKSIK--VVFITSPGNPTGACIEVGRVEKLLR-NWTAGI 197

Query: 340 VVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGG 399
           VV+ DE Y       + F + K  L  L  KHP       L  L + SK  SG  G R G
Sbjct: 198 VVV-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLG 242

Query: 400 Y 400
           +
Sbjct: 243 F 243

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 79/173 (45%), Gaps = 26/173 (15%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDNGEPAY-----PEDIFLTAGASAAVM-YLLSILCK 247
           V  YS ++G    R T+   +T  D   P Y     PE++ +T GA+  ++  L+ IL +
Sbjct: 84  VNQYSPTRG----RPTLIKSLT--DLYSPLYKLTLKPENVLVTTGANEGILACLMGILNQ 137

Query: 248 GPETGVLIP-----IPQYPLYTASLA---LNNSHALPYYLDEKSGWSTNPKEIEEVVLAA 299
             E  V  P     IP   L    +    +N    L   + + + W+ + ++ E V+   
Sbjct: 138 NDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN- 196

Query: 300 KDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVF 352
                +   +++  P NP G V + + ++ I +I  K+ +++I+DEVY    F
Sbjct: 197 -----KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 78/180 (43%), Gaps = 23/180 (12%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL--PYYL 279
           P   +++ L  G+  ++  L+   C   +  +LI  P Y +Y+    +N+   +  P  +
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 280 DEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGI 339
           ++ S      K IE +     D  I+  +  V +PGNPTGA++   SIE I     + GI
Sbjct: 144 EDNSFQMNTDKVIETL---QGDSNIK--IAFVTSPGNPTGALIDIASIEKILS-QWQSGI 197

Query: 340 VVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGG 399
           V I DE Y       + F S       L  K+P       LA L + SK   G  G R G
Sbjct: 198 VAI-DEAY-------IDFCSTGGSAAPLVNKYP------NLAVLQTLSKSF-GLAGVRLG 242

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 18/178 (10%)

Query: 226 EDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL--PYYLDEKS 283
           +++ L  G+   +  L+   CK     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 284 GWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIA 343
                 + +E +    KD  IR  +L + +PGNPTG +++ K I ++ E   K G+VV+ 
Sbjct: 145 FQMDVKRTLETL---KKDDLIR--LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 344 DEVYQE--NVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECGQRGG 399
           DE Y +    FNE    +    +  L  K+P       L  L + SK   G  G R G
Sbjct: 198 DEAYVDFSTYFNEETKKTEYFSVAKLVTKYP------NLTVLQTLSKSF-GLAGIRLG 248

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 63/134 (47%), Gaps = 9/134 (6%)

Query: 216 KRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHA- 274
           K  N  P   E+I L  G+  ++  L+ + C   +  ++I  P Y +Y+    +N+    
Sbjct: 78  KDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCV 137

Query: 275 -LPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEI 333
            +P   ++ S      K +E +   A+D  I+  ++ + +PGNPT A++    IE +   
Sbjct: 138 KVPLVAEDNSFQMDTSKVLETL---AQDPTIK--LIFITSPGNPTAALIDTAEIEKVLN- 191

Query: 334 AAKYGIVVIADEVY 347
               G +V+ DE Y
Sbjct: 192 -NWTGGLVVVDEAY 204

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 87/196 (44%), Gaps = 25/196 (12%)

Query: 206 IRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTA 265
           +R T + F  K  N  P   E++ L  G+   +  L+   C   +  +LI  P Y +Y+ 
Sbjct: 70  LRNTDSVF--KDQNLPPLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSI 127

Query: 266 SLALNNSH--ALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLS 323
              +N+     +P  +++ S      K IE +     D  I+  ++ + +PGNPTGA++ 
Sbjct: 128 CTDINDVEYVKVPLVVEDNSFQMDTEKVIETL---QNDPSIK--LVFITSPGNPTGALIK 182

Query: 324 EKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASL 383
            ++IE +     + G VV+ DE Y       + F +    +  L  K+P       LA L
Sbjct: 183 PENIEKLLS-QWQSGFVVV-DEAY-------IDFCTTGGSVAPLVNKYP------NLAVL 227

Query: 384 HSTSKGVSGECGQRGG 399
            + SK   G  G R G
Sbjct: 228 QTLSKSF-GLAGIRLG 242

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 12/161 (7%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPE---DIFLTAGASAAVMYLLSILCKGPETGV 253
           YS +QG+  +   +  FITK +N  P Y E   DI L  G+S ++  +   LC    T +
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNT-PPYNETLYDIMLANGSSDSMFKVFETLCDESTTVL 195

Query: 254 LIPIPQYPLYTASLALNNSHALPYYLD---EKSGWSTNPKE--IEEVVLAAKDKKI-RPS 307
           +      P+ +  +A   +  +P  L+   E  G      E  ++     +  K + +P 
Sbjct: 196 MEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKPK 254

Query: 308 VLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
           +L  I+ G NP G  LS +    I+ IA ++ ++++ D+ Y
Sbjct: 255 ILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 81/172 (47%), Gaps = 20/172 (11%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVM-YLLSILCKGPETG 252
           V  YS ++G   +  ++ +  T   N E    E++ +T GA+  ++  L+ +L  G E  
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKE-LKAENVVVTTGANEGILSCLMGLLNSGDE-- 141

Query: 253 VLIPIPQYPLYTASLALNNSHAL------PYYLDEKSG----WSTNPKEIEEVVLAAKDK 302
           V++  P +  Y  ++ L     +      P  LD+++     W+ + ++ E+ + +    
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS---- 197

Query: 303 KIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
             +   +++  P NP G V +   +  +  I  K+ +V+I+DEVY+   F +
Sbjct: 198 --KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTD 247

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 226 EDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGW 285
           +++ +T GA  A  +L+     GP   ++   P Y   ++  ++  +     +L+ + G+
Sbjct: 82  DNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDGY 140

Query: 286 STNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
           + N ++++  V A          +V+ NP NP G+V+S + +  I + A +  I ++ DE
Sbjct: 141 TPNIQKLKSKVRA------NTKYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCDE 194

Query: 346 VY 347
           VY
Sbjct: 195 VY 196

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 65/136 (47%), Gaps = 8/136 (5%)

Query: 214 ITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSH 273
           I K  N +P   +++ L  G+  ++  L+   C   +  +LI    Y +YT    +N+  
Sbjct: 76  IFKDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVE 135

Query: 274 --ALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIF 331
              +P  L E+  +  + ++I E +    D  I+  ++ + +PGNPTG  +    IE I 
Sbjct: 136 YVTVPLLLSEEDKFQIDEEKILETL--QNDPSIK--LVFITSPGNPTGTFIDVNRIEKIL 191

Query: 332 EIAAKYGIVVIADEVY 347
               + G+VV+ DE Y
Sbjct: 192 S-QWQTGLVVV-DEAY 205

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 14/128 (10%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL---PYYLDEKS 283
           DI  T G++      L I C   +T +L    +Y  Y++S+   ++  L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184

Query: 284 GWSTNPKEIEEVVLAAKD---KKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGI 339
           G    P+++EE+++   D       P +L  I  G NPTG  LS+    +I+ +A KY +
Sbjct: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 340 VVIADEVY 347
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 18/171 (10%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVM-YLLSILCKGPETG 252
           V  YS ++G   + +++    +   N E    E++ +T GA+  ++  L+ IL  G E  
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAE-LKAENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 253 VLIP-----IPQYPLYTASLA---LNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKI 304
           V  P     IP   L    +    +N    +   + + + W+    + E+   A  DK  
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTV---DYEQFANAITDK-- 197

Query: 305 RPSVLVVIN-PGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
             +  V+IN P NP G V + + +  I EI  K  +V+I+DEVY+   F +
Sbjct: 198 --TKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTD 246

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 64/132 (48%), Gaps = 7/132 (5%)

Query: 217 RDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALP 276
           +D  +P   E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   + 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 277 Y-YLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAA 335
              +   + +  N  E+  +  A  D  I+  ++ + +PGNPTGA +    IE I +   
Sbjct: 138 CPLITSDNSFQANTDEV--IKTAQNDPSIK--LIFITSPGNPTGAKVETSRIEKILQNWD 193

Query: 336 KYGIVVIADEVY 347
           + G+VV+ DE Y
Sbjct: 194 R-GMVVV-DEAY 203

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 85/175 (48%), Gaps = 26/175 (14%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDN---GEPAYPEDIFLTAGASAAVM-YLLSILCKGP 249
           V  YS ++G    R ++ N + K  +   G+    E+I +T GA+  ++  L+ +L  G 
Sbjct: 89  VNQYSPTRG----RASLLNSLIKLYSPFYGKELKQENITITTGANEGILSCLMGLLNAGD 144

Query: 250 ETGVLIPIPQYPLYTASLALNNSHAL------PYYLDEK----SGWSTNPKEIEEVVLAA 299
           E  V++  P +  Y +++ L     +      P  LD++    + W+ + ++    +   
Sbjct: 145 E--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDFEQFRNAITP- 201

Query: 300 KDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
                +   ++V +P NP G V +++ +  + EI  +  +++I+DEVY+   FN+
Sbjct: 202 -----KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYEFLYFND 251

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPY-YLD 280
           P   ++I L  G+   V  L+   C      VL+  P Y +Y+    +N++  +    + 
Sbjct: 84  PISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 281 EKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIV 340
           E + +  +   + E +  + D  I+  +L +  PGNPTGA +S + IE +       GIV
Sbjct: 144 EDNSFDMDLDNVLETL--SNDDSIK--LLFITTPGNPTGASISTQKIEMLLN-NWSAGIV 198

Query: 341 VIADEVY 347
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 68/152 (44%), Gaps = 9/152 (5%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           Y A +G   +R  VA+  + +   E    +D  L    +    +L+S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDK---EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316
            P Y   ++   +  +      L+ ++ +  +  +++ ++      K     +V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI------KGNTKCIVLNNPNN 165

Query: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
           P G+V+   ++E I  +A K  I VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 68/140 (48%), Gaps = 19/140 (13%)

Query: 226 EDIFLTAGASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL------PYY 278
           E++ +T GA+  ++  L+ +L  G E  V++  P +  Y  ++ L     +      P  
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 279 LDEKSG----WSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIA 334
           LD+++     W+ + ++ E  + +      +   +++  P NP G V + + +  +  I 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 335 AKYGIVVIADEVYQENVFNE 354
            K+ +V+I+DEVY+   F +
Sbjct: 244 VKHNVVIISDEVYEHLFFTD 263

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 69/140 (49%), Gaps = 19/140 (13%)

Query: 226 EDIFLTAGASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL------PYY 278
           E++ +T GA+  ++  L+ +L  G E  V++  P +  Y  ++ L     +      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 279 LDEKSG----WSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIA 334
           LD+++     W+ + ++ E+ + +      +   +++  P NP G V + + +  +  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 335 AKYGIVVIADEVYQENVFNE 354
            K+ +V+I+DEVY+   F +
Sbjct: 228 VKHNVVIISDEVYEHLYFTD 247

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 62/128 (48%), Gaps = 14/128 (10%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL---PYYLDEKS 283
           DI  T G++ A    L I C   +T +L    +   Y++S+   ++  L   P  +D + 
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 284 GWSTNPKEIEEVVLAAKDKKI---RPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGI 339
                P+++EE++    D+      P +L  I  G NPTG  LSE     I+ +A KY I
Sbjct: 189 ---IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDI 245

Query: 340 VVIADEVY 347
           +++ D+ Y
Sbjct: 246 LIVEDDPY 253

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 75/184 (40%), Gaps = 33/184 (17%)

Query: 197 YSASQGVYGIRKTVANFITKR-----DNGEPAYPEDIFLTAGASAAVMYLLSILCKGPET 251
           Y +  G   +R  +A F  +       +     PE + LT+GAS  +M +L +    P T
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNIL-LQTTLPHT 106

Query: 252 G----VLIPIPQYPLYTASLALNNSHALPYYLDEK--------------------SGWST 287
           G      I  P Y L   +            ++EK                    +G S 
Sbjct: 107 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESG 166

Query: 288 NPKEIEEVVLAAKD--KKI-RPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIAD 344
              E    ++ A+D  KKI R  + +V    NPTGA+ S  S   + E+A KY I++I+D
Sbjct: 167 QKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 226

Query: 345 EVYQ 348
           +VY 
Sbjct: 227 DVYD 230

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           DI  T G++      L I C   +T VL+    Y     +      + +P  LD   G  
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLD---GEG 187

Query: 287 TNPKEIEEVVL---AAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVI 342
             P ++EE++    +   +   P +L  I  G NPTG  LS+    HI+ +A +Y I++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 343 ADEVY 347
            D+ Y
Sbjct: 248 EDDPY 252

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 22/167 (13%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDN---GEPAYPEDIFLTAGASAAVMY-LLSILCKGP 249
           V  YS ++G    R +V N + K  +   G+    E++ +T GA+  ++  L+ IL  G 
Sbjct: 92  VNQYSPTKG----RPSVINSLKKLYSPLYGQELKDENVTITTGANEGILSSLMGILNPGD 147

Query: 250 ETGVLIP-----IPQYPLYTASLA---LNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKD 301
           E  V  P     IP   L    +    +N    +   + E   W+ + +E+      AK 
Sbjct: 148 EVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEEL------AKA 201

Query: 302 KKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
              +   L++  P NP G V +++ +  I  +  +  +V+I+DEVY+
Sbjct: 202 FTSKTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYE 248

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 79/165 (47%), Gaps = 12/165 (7%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVM-YLLSILCKGPETGVLI 255
           YS ++G   + K +A+  T    G+    ++I +  GA+ A+   L+ +L KG E  V++
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 256 PIPQYPLYTASLALNNSHAL------PYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVL 309
             P +  Y +++ L            P  LD++    T   EI+  +L  K    R   +
Sbjct: 134 FEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTE-WEIDWDILE-KTINSRTKCV 191

Query: 310 VVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
           ++  P NP G V + + +  + +I     IV+I+DEVY+   F++
Sbjct: 192 IINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYFSD 236

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  TAG + A    L + C   +T +L     +     +      +  P  LDE   + 
Sbjct: 135 DVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVPLDE---FG 190

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++E ++     +  +P +L  I  G NPTG+ LS+     I+ IA K+  ++I DE
Sbjct: 191 IIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDE 250

Query: 346 VY 347
            Y
Sbjct: 251 PY 252

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL---PYYLDEKS 283
           D+  T G + A    L + C   + G +I + +   +++ LA   +  +   P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 284 GWSTNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVI 342
                P+++E+++    +   +P +L  I  G NPTG+ LS+   E I+++A K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 343 ADEVY 347
            DE Y
Sbjct: 245 EDEPY 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPY-YLD 280
           P    +I L  G+  ++  ++   C      +L+  P Y +Y+    +N+   +    + 
Sbjct: 84  PLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLIT 143

Query: 281 EKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIV 340
           E + +  +  ++ +++    D++I+  +L + +PGNPTGA +    IE + +   + G+V
Sbjct: 144 EDNSFQMDSDKVLDIL--NNDQEIK--LLFITSPGNPTGAQIETARIEKVLQNWDR-GLV 198

Query: 341 VIADEVY 347
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 61/145 (42%), Gaps = 13/145 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  TAG + A    L + C   +  +L     +    A+         P  +D+K    
Sbjct: 133 DVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPVPIDDKG--- 188

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P ++E ++        +P +L  I  G NPTG  L+++    IF IA K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 346 VYQENVFNEVKFHSMKKVLRNLQKK 370
            Y         F  M K  R+LQK+
Sbjct: 249 PYY--------FLQMDKYERDLQKR 265

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           DI LT G +      L + C   +  +L     +    AS         P  +DE     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHG--- 187

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++EE++        +P +L  I  G NPTG  L+++    I+ IA K+  ++I DE
Sbjct: 188 IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 346 VY 347
            Y
Sbjct: 248 PY 249

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 285 WSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIAD 344
           W+ N  E+E  +        +   L++  P NP G V + + +  I EI  K+ +V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 345 EVYQENVF 352
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 60/137 (43%), Gaps = 15/137 (10%)

Query: 225 PEDIFLTAGASAAVM-YLLSILCKGPETGVLIP-----IPQYPLYTASLA---LNNSHAL 275
           PE++ +T GA+  ++  L+ I+  G E  V  P     IP   L    +    +N    L
Sbjct: 115 PENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 174

Query: 276 PYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAA 335
              + + + W+ +  E    +        +   +++  P NP G V + + +  +  I  
Sbjct: 175 DNRVTKGTEWTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNICV 228

Query: 336 KYGIVVIADEVYQENVF 352
           +  +++IADEVY+   F
Sbjct: 229 ENNVIIIADEVYEHLYF 245

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 76/170 (44%), Gaps = 22/170 (12%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMY-LLSILCKGPETGVLI 255
           YS ++G   + K++ +F +   N E     ++ +T GA+  ++  L+ +L  G E  V++
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYN-ETLNESNVTITTGANEGILASLVGLLNPGDE--VIV 144

Query: 256 PIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKI----------- 304
             P +  Y +++ +         L         PKE+ E V    + KI           
Sbjct: 145 FEPFFDQYISNIEIPGGKVRYVPL-------VAPKELSERVTIGAEWKIDFDILNKTINE 197

Query: 305 RPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
           R   +++  P NP G V + + +  + +I  K  I +I+DEVY+   F +
Sbjct: 198 RTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGD 247

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 68/140 (48%), Gaps = 19/140 (13%)

Query: 226 EDIFLTAGASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL------PYY 278
           E++ +T GA+  ++  L+ +L  G E  V++  P +  Y +++ L     +      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPKE 173

Query: 279 LDEKSG----WSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIA 334
           LD ++     W+ + ++ E+ +        +   +++  P NP G V + + +  +  I 
Sbjct: 174 LDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 335 AKYGIVVIADEVYQENVFNE 354
            K+ +++I+DEVY+   F +
Sbjct: 228 VKHNVIIISDEVYEHLYFTD 247

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D  LT G +      L I C   +  +L     +    AS         P  +D      
Sbjct: 132 DSILTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDSDG--- 187

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++E ++        +P +L  I  G NPTG+ LS++  E I++IA K+  ++I DE
Sbjct: 188 IIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDE 247

Query: 346 VY 347
            Y
Sbjct: 248 PY 249

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 82/175 (46%), Gaps = 26/175 (14%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDN---GEPAYPEDIFLTAGASAAVM-YLLSILCKGP 249
           V  YS ++G    R ++ N + K+     G     E++ +T GA+  ++  L+ +L  G 
Sbjct: 86  VNQYSPTRG----RVSLLNALIKQYTPIYGSELKQENVTITTGANEGILSCLMGLLNAGD 141

Query: 250 ETGVLIPIPQYPLYTASLALNNSHAL------PYYLDEK----SGWSTNPKEIEEVVLAA 299
           E  V++  P +  Y +++ L     +      P  LD++    + W+ + ++ +  + + 
Sbjct: 142 E--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVDMEQFKNAITS- 198

Query: 300 KDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
                +   +++  P NP G V + + +  I  I  +  +++I+DEVY+   F +
Sbjct: 199 -----KTKAVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHLYFTD 248

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 74/184 (40%), Gaps = 32/184 (17%)

Query: 197 YSASQGVYGIRKTVANFITK------RDNGEPAYPEDIFLTAGASAAVMYLL---SILCK 247
           Y + +G   +R+ +  F         RD+   + PE + L++GAS  V+ +L   ++   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 248 GPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTN----------------PKE 291
           G      I  P Y L           +    +DE    S +                 +E
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 292 IEEVVLAAKD------KKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIAD 344
            +E + A  D      KKI   V+  I    NPTG   S ++   + EIA KY +++IAD
Sbjct: 171 DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 345 EVYQ 348
           +VY 
Sbjct: 231 DVYD 234

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 216 KRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL 275
           K +N  P   E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +
Sbjct: 79  KAENLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIV 138

Query: 276 PYYLDEKSGWSTNPKEIE-EVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIA 334
              L     +  N  +++ E VL          +L + +PGNPTGA +  + IE + +  
Sbjct: 139 ECPL----LYKNNSFQMDTESVLTVLQNDPLIKLLFITSPGNPTGARIETERIETVLQNW 194

Query: 335 AKYGIVVIADEVY 347
              G+VV+ DE Y
Sbjct: 195 TD-GLVVV-DEAY 205

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 20/166 (12%)

Query: 196 AYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLI 255
            Y + +G   +R  +A+         P + +D  L    + A  +L+     GP   V+ 
Sbjct: 54  TYGSIKGSDKLRSLIASMYG------PEFNKDNVLVTNGAIAANFLIYYTLVGPGDHVIC 107

Query: 256 PIPQYP-LYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINP 314
             P Y  LY+         +L   L ++ G+  N + +++++      K    ++++ NP
Sbjct: 108 VDPTYAQLYSVPKMFGAEVSL-LKLQKEDGFIPNIETLKKMI------KSNTKLIIINNP 160

Query: 315 GNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSM 360
            NP G+ +S +++  I ++  +  I +  DEVY+        FHSM
Sbjct: 161 NNPLGSAISTETLNDICQLCEENNIYLHCDEVYKP------IFHSM 200

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 74/182 (40%), Gaps = 30/182 (16%)

Query: 196 AYSASQGVYGIRKTVANFITKR------DNGEPAYPEDIFLTAGASAAVMYLLSILCKGP 249
            Y +++G + +R T+  F  +       + G  + PE + LT+GAS  V+ +L + C  P
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLP 110

Query: 250 ETG----VLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS-------TNPKEIEEVVLA 298
                    I  P Y L          H     ++E    S       +N  E++ +   
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 299 -----------AKDKKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEV 346
                      +K KKI   VL  +    NP+G   S  +   + E+A KY I++I D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 347 YQ 348
           Y 
Sbjct: 231 YD 232

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 70/349 (20%), Positives = 140/349 (40%), Gaps = 38/349 (10%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVM-YLLSILCKGPETG 252
           V  YS ++G   + K++   + K   G+    +++ +T GA+  ++  L+ IL  G E  
Sbjct: 74  VNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDEVI 132

Query: 253 VLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKI--RPSVLV 310
           V  P     +    L       +P +  ++        +  ++   A +K    +   ++
Sbjct: 133 VFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKAVI 192

Query: 311 VINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKK 370
           +  P NP G V +E+ +  + ++  ++  VVI+DEVY+   F E    S  ++  N+ + 
Sbjct: 193 INTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTE----SFPRI-ANINE- 246

Query: 371 HPGVYDMVQLASLHSTSKGVSGECGQRGGYM-----ELTGFTHEVRSVILKLASISLCPV 425
                D+  L     ++       G R G++     +L  +  +  + I   +   L   
Sbjct: 247 -----DIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLNYVSKAHTRICFASPSPLQEA 301

Query: 426 VTGQALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGA 485
             G     L +    K  E + +        K E+ T A      F+ L G+   +P+G 
Sbjct: 302 CAGSIEHALKIDYFPKMREEYRK--------KFEILTTA------FDKL-GLNYTQPEGT 346

Query: 486 MYL---FPRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGF 531
            ++   F ++ +P   V   + LE + D      L+   GI  +P + F
Sbjct: 347 YFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 97/243 (39%), Gaps = 50/243 (20%)

Query: 145 PLSFYRQ--VLSLLQYPEILKQDESKLVASGL-FKKDALERAKTLLHEIGGTVGAYSASQ 201
           P++F++      LL   EI K  E  L+     +  D L R     H +      Y +++
Sbjct: 6   PINFFKGHPSFRLLPNKEITKATEQLLLGENRDYDDDPLNR-----HPL-----TYGSNE 55

Query: 202 GVYGIRKTVANFITK------RDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGV-- 253
           G   +R  +  F+ +      RD+   + PE + LT+GAS  V+ +L +    P TGV  
Sbjct: 56  GALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNIL-LQATLPHTGVTK 114

Query: 254 --LIPIPQYPLYTASLALNNSHALPYYLDEKSGWST----------------------NP 289
              I  P Y L                +DEK   S                       N 
Sbjct: 115 QAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPNPVNENG 174

Query: 290 KE---IEEVVLAAKDKKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
           KE   I+  +  +  KK+   V+ VI    NP+G   + ++   + E+A KY +++I D+
Sbjct: 175 KELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDMLIITDD 234

Query: 346 VYQ 348
           VY 
Sbjct: 235 VYD 237

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 72/171 (42%), Gaps = 18/171 (10%)

Query: 194 VGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGV 253
           V  YS ++G   +  ++  F T   N +         T    A    L+ +L  G E  V
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIFSILIGLLNPGDE--V 133

Query: 254 LIPIPQYPLYTASLALNNSHAL------PYYLDEK----SGWSTNPKEIEEVVLAAKDKK 303
           ++  P +  Y  ++ L+    +      P  LD +      W  +   ++    AA + K
Sbjct: 134 IVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQ----AAMNSK 189

Query: 304 IRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
            +   +++  P NP G V +E  +  + +I  K  +V+I+DEVY+   F +
Sbjct: 190 TK--AIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKD 238

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 73/184 (39%), Gaps = 33/184 (17%)

Query: 197 YSASQGVYGIRKTVANFITKR-----DNGEPAYPEDIFLTAGASAAVMYLLSILCKGPET 251
           Y +  G   +R  +A F  K       +     P+ + LT+GAS  +M +L +    P T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 252 G----VLIPIPQYPLY-------------TASLALNNSHALPYY-----LDEKSGWSTNP 289
           G      I  P Y L              TA     +   L +      L E S      
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 290 KEIEEVV-----LAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIAD 344
           ++ EE +        + K  R  + +V    NPTGA+ S  S   + E+A KY I++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 345 EVYQ 348
           +VY 
Sbjct: 228 DVYD 231

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 72/159 (45%), Gaps = 10/159 (6%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256
           YS +QG+  I   +   I    N  P    D+ L  G+S ++  L   L     T VL+ 
Sbjct: 112 YSQTQGLAPILDFLK-LIVANCNNPPYQNWDLLLANGSSDSMFKLFDTLTD-ETTTVLVE 169

Query: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWS------TNPKEIEEVVLAAKDKKI-RPSVL 309
              +    +++    +  +P  L+  S  S      T  + + E   +   K + RPS+L
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 310 VVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
             I+ G NPTG  +S ++   I+++A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPY-YLD 280
           P   E+  L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +    + 
Sbjct: 83  PLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLIT 142

Query: 281 EKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIV 340
           E + +  +  EI  ++  A D  I+  ++ + +PGNPTGA +    IE++ +     G+V
Sbjct: 143 EDNSFQIDATEILNIL--ANDPLIK--LVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLV 197

Query: 341 VIADEVY 347
           ++ DE Y
Sbjct: 198 IV-DEAY 203

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+ +TAG++ A    L + C  P   VL+   +   Y++S+    +  +     E  G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCN-PGDSVLL---ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 287 TNPKEIEEVVLAAKD---KKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVI 342
             P+++E ++    D    +  P +L VI  G NP G  L+++    I+ I  KY +V+I
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 343 ADEVY 347
            D+ Y
Sbjct: 245 EDDPY 249

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 226 EDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPY-YLDEKSG 284
           E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +    + E + 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 285 WSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIAD 344
           +  N  ++ +++    D  I+  ++ + +PGNPTG  +  K IE + +     G+VV+ D
Sbjct: 148 FQLNSDKVLDIL--KNDPLIK--LVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-D 201

Query: 345 EVY 347
           E Y
Sbjct: 202 EAY 204

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 79/188 (42%), Gaps = 21/188 (11%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNS--HALPYYLDEKSG 284
           ++  T G + +    L I C   +T   I   QY   ++  A      +  P  LD    
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDADG- 190

Query: 285 WSTNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIA 343
               P+ +E ++        +P +L  I  G NPTG+ LS+     I+ IA K+ +++I 
Sbjct: 191 --LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 344 DE--------VYQENVFN--EVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGE 393
           DE         YQ++V    E  F S +  + +L K    +    ++  L S SK +   
Sbjct: 249 DEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG-- 306

Query: 394 CGQRGGYM 401
            G R G++
Sbjct: 307 PGTRLGWI 314

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 13/145 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  TAG + A    L + C   +  +L+    +    AS         P  +D      
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPIDADG--- 189

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++ +V+        +P +L  I  G NPTG  +++   E I++IA KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 346 VYQENVFNEVKFHSMKKVLRNLQKK 370
            Y         F  M   +++L+++
Sbjct: 250 PYY--------FLQMNPYIKDLKER 266

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 21/135 (15%)

Query: 226 EDIFLTAGASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSG 284
           E+I +T GA  A++  L++++  G E  V+ P     ++   +A      +P        
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPL------- 151

Query: 285 WSTNPKEIEEVVLAAKDKKI-----------RPSVLVVINPGNPTGAVLSEKSIEHIFEI 333
             TNP + ++ +L A D  +           +  ++++ NP NP G V +   +  +  +
Sbjct: 152 --TNPNQGKKRILEANDWILDRETLRAAFTDKTKLMIINNPNNPLGKVFNRDELLEMATL 209

Query: 334 AAKYGIVVIADEVYQ 348
               G  +IADEVY+
Sbjct: 210 CVNNGAYIIADEVYE 224

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 31/189 (16%)

Query: 196 AYSASQGVYGIRKTVANFITKRDNG-EPAYPEDIFLTAGASAAVMYLLSILCKGPETG-- 252
           +Y   +G   +R  ++ F+ K      P  PE I LT GAS  +M +L   C  P TG  
Sbjct: 50  SYGPKEGSLWVRCVISQFVNKCFKPLMPTKPEYINLTGGASYGIMNILE-QCTLPHTGYT 108

Query: 253 --VLIPIPQYPLYTASL----------ALNNSHA------LPYYLDE-KSGWSTNPKEIE 293
               +  P Y L   +           A+N +        L   L E +     NP+  E
Sbjct: 109 RQAFLISPTYFLINETFIDAGFGGKLTAVNETQNGLDVEFLEAKLAEFEYDALLNPQHGE 168

Query: 294 EVVL-------AAKDKKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
           E  L        ++ KK+   V+ ++    NP+G   S  +   + E+A KY I++I+D+
Sbjct: 169 ERGLNLINMSGRSRTKKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDD 228

Query: 346 VYQENVFNE 354
           VY   V+++
Sbjct: 229 VYDLLVYDQ 237

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLAL--NNSHALPYYLDEKSG 284
           D+  T G + +    L I C   +T   I   +Y   ++  A      +  P  LD    
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDADG- 190

Query: 285 WSTNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIA 343
               P+ +E ++     +  +P +L  I  G NPTG+ LS+   + I+ IA K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 344 DEVY 347
           DE Y
Sbjct: 249 DEPY 252

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 87/217 (40%), Gaps = 47/217 (21%)

Query: 225 PEDIFLTAGASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASL--------ALNNSHAL 275
           PE+I +T GA+  +   L+S+L  G E  VL P     +Y   +         L     L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 276 PYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAA 335
                + S W+ +  +    + + K K +     ++ +P NPTG V + + +  +  I  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAI-SEKTKAV-----IINSPHNPTGKVFTREELLTLGNICV 212

Query: 336 KYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTSKGVSGECG 395
           +  + +I+DEVY+   F                       + V+LASL      ++   G
Sbjct: 213 EKNVYIISDEVYENLYFTP---------------------ECVKLASLSPEISNITLTIG 251

Query: 396 QRGGYMELTGF------THEVRSVILKLAS---ISLC 423
             G    +TG+      +  V   +LKLAS   I +C
Sbjct: 252 SAGKIFAVTGWRIGWIISENVE--LLKLASSAHIKIC 286

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 6/124 (4%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLAL--NNSHALPYYLDEKSG 284
           D+  T G ++A    L + C   +T   I   +Y   ++ +A       A P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVPLDENGM 188

Query: 285 WSTNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIA 343
                 E+ +      D   RP +L  +  G NPTG  LS    + ++ +A ++ ++++ 
Sbjct: 189 VPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVE 248

Query: 344 DEVY 347
           DE Y
Sbjct: 249 DEPY 252

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 5/129 (3%)

Query: 221 EPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLD 280
           +P   +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +   L 
Sbjct: 83  KPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLT 142

Query: 281 EKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIV 340
              G  +   + E V+   K+  +   ++ V +PGNPTGA +    IE + +     G+V
Sbjct: 143 VSDG--SFQMDTEAVLTILKNDSL-IKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLV 198

Query: 341 VIADEVYQE 349
           V+ DE Y +
Sbjct: 199 VV-DEAYVD 206

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDE 281
           P   E++ L  G+  ++  ++   C   +  ++   P Y +Y+   ++N+   +   L  
Sbjct: 81  PLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPL-- 138

Query: 282 KSGWSTNPKEIE-EVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIV 340
               S N  +++ E VL    K     ++ + +PGNPTGA +    IE I +     GI+
Sbjct: 139 --VTSDNSFQVDTEAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGIL 195

Query: 341 VIADEVY 347
           V+ DE Y
Sbjct: 196 VV-DEAY 201

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 221 EPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL--PYY 278
           +P   +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +  P  
Sbjct: 83  KPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 279 LDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYG 338
           + + S +  N     E VL   +      ++   +PGNPTGA +    IE + +     G
Sbjct: 143 VSDNS-FQMNT----EAVLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNG 196

Query: 339 IVVIADEVY 347
           IVV+ DE Y
Sbjct: 197 IVVV-DEAY 204

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 61/145 (42%), Gaps = 13/145 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           DI  TAG + A    L + C   +  +L     +    A+         P  +D+     
Sbjct: 133 DIIATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPIPIDDNG--- 188

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++E+++        +P +L  I  G NPTG  L    +E I+ IA K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 346 VYQENVFNEVKFHSMKKVLRNLQKK 370
            Y         F  M K ++++ ++
Sbjct: 249 PYY--------FLQMDKYVKDVNER 265

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 67/145 (46%), Gaps = 13/145 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+F TAG + A    L + C     G +I + +   +++SLA   +  +  +        
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++ +++        +P +L  I  G NPTG  ++    E I++IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 346 VYQENVFNEVKFHSMKKVLRNLQKK 370
            Y         F  M   +++L+++
Sbjct: 250 PYY--------FLQMNPYIKDLKER 266

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 65/139 (46%), Gaps = 19/139 (13%)

Query: 225 PEDIFLTAGASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL------PY 277
           P ++ +T GA+ A++  L+ +L +G E  V++  P +  Y +++ +            P 
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 278 YLDEK----SGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEI 333
            L+ +    + W+ +  E+   +        +   L++  P NP G V + + +  I  I
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 334 AAKYGIVVIADEVYQENVF 352
             +  +V+I+DEVY+   F
Sbjct: 230 CVENNVVIISDEVYEHLYF 248

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL---PYYLDEKS 283
           ++ +TAG ++A    L I C   +T     + +   +++SL+   +  +   P  +D+K 
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG 187

Query: 284 GWSTNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVI 342
                P+++  ++     +  +P +L  I  G NPTG+ L  +    +++IA K+  +++
Sbjct: 188 ---IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIV 244

Query: 343 ADEVY 347
            DE Y
Sbjct: 245 EDEPY 249

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 5/126 (3%)

Query: 222 PAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDE 281
           P   +++ L  G+  ++  ++   C   +  +L   P Y +Y+    +N+   L   L  
Sbjct: 83  PLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIY 142

Query: 282 KSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVV 341
           +   S  P   + + + + D  I+  ++ + +PGNPTGA +    I  I E  +  G  V
Sbjct: 143 EDN-SFQPDSQKVISILSSDPLIK--LVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFV 197

Query: 342 IADEVY 347
           + DE Y
Sbjct: 198 VVDEAY 203

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 83/184 (45%), Gaps = 20/184 (10%)

Query: 179 ALERAKTLLHEIGGTVGAYSASQGVYGIRKTVANFITKRDNGEPAY-----PEDIFLTAG 233
            +E A+  L +    V  YS ++G    R ++ N + K+ +  P Y       +I +T G
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKG----RMSLINSLIKQYS--PLYNTQLQANNIQVTTG 122

Query: 234 ASAAVM-YLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEI 292
           A+  ++  L+ +L  G E  V++  P +  Y +++ +         L      S  P E 
Sbjct: 123 ANEGILACLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEG 180

Query: 293 EEVVLAAKDKK--IRPSV--LVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
            E  +   + +  I P    L++  P NP G V + + +  I +I  +  +V+I+DEVY+
Sbjct: 181 TEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYE 240

Query: 349 ENVF 352
              F
Sbjct: 241 HLYF 244

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 295 VVLAAKDKK--IRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
           ++ AA DKK   R  + +V    NP+GA  S++    + ++A +Y I++I+D+VY 
Sbjct: 177 IINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYD 232

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 67/160 (41%), Gaps = 28/160 (17%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLL--------SILCKG 248
           Y A +G   +R  +A        G     +++ +T GA  A   L          ++C  
Sbjct: 56  YGAIKGSKDLRTLIAGLY-----GVQFSADNVLVTNGAIGANFLLYYTLVGKGDHVICVH 110

Query: 249 PETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSV 308
           P    L  +P+  ++ A + L         L EK  +  N   +++ +      K    +
Sbjct: 111 PTYSQLYSVPK--MFGAEVTL-------LELSEKDSFLPNLDTLKKAI------KSNTKL 155

Query: 309 LVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
           +++ NP NP G V+S++ +  I E+  +  + +  DEVY+
Sbjct: 156 IIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  T G + A    L + C     G +I + +   +++SLA   +  +  +        
Sbjct: 132 DVVATTGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++E ++    +   +P +L  I  G NPTG+ L+ +  + I+ IA K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 346 VY 347
            Y
Sbjct: 248 PY 249

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 289 PKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
           P+++E+++        RP +L  I  G NPTG  L++   + I+ IA K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 92/236 (38%), Gaps = 41/236 (17%)

Query: 142 NQKPLSFYRQVLSLLQYP-EILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200
           NQ+P++F++   S    P E + +  S+L+       D ++  +  L         Y   
Sbjct: 4   NQRPINFFKGHPSFRLLPREAIVEATSQLLLPECRDYDDIDEDRHPL--------TYGPD 55

Query: 201 QGVYGIRKTVANFITKR----DNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETG---- 252
           +G   +R  +A F               PE I LTAGAS  VM +L      P TG    
Sbjct: 56  EGSKWVRTAIAAFSNDCFQLPSEEMKTKPEHINLTAGASYGVMNILEQTTL-PHTGYTRQ 114

Query: 253 VLIPIPQYPLYTAS--------------------LALNNSHALPYYLDEKSGWSTNPKEI 292
             I  P Y L   +                    +  +       Y D  S  + N  E+
Sbjct: 115 AFIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYFDSIS--NDNSSEL 172

Query: 293 EEVVLAAKDKKI-RPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
           + +     +KK+ R  + +V    NP G   S ++   + E+A K+ +++++D+VY
Sbjct: 173 QLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVY 228

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 226 EDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGW 285
           +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +   L      
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPL----VV 143

Query: 286 STNPKEIE-EVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIAD 344
           S N  +++ E VL   +      ++ V +PGNPTGA +    IE + +   + G+VV+ D
Sbjct: 144 SDNSFQMDVEAVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV-D 201

Query: 345 EVY 347
           E Y
Sbjct: 202 EAY 204

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 19/148 (12%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSH---ALPYYLDEKS 283
           D+  TAG + A    L + C     G +I + +   +++SLA   +    A P  +D   
Sbjct: 134 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDADG 189

Query: 284 GWSTNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVI 342
                P+++ +++        +P +L  I  G NPTG  +++   E I++IA K+  +++
Sbjct: 190 ---IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIV 246

Query: 343 ADEVYQENVFNEVKFHSMKKVLRNLQKK 370
            DE Y         F  M   +++L+++
Sbjct: 247 EDEPYY--------FLQMNAYIKDLKER 266

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 76/180 (42%), Gaps = 29/180 (16%)

Query: 197 YSASQGVYGIRKTVANFIT----KRDNGEPAYP--EDIFLTAGASAAVMYLL---SILCK 247
           Y + +G   +R+ +  F+     K D+G       + + L +GAS  ++ +L   ++   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 248 GPETGVLIPIPQYPLYTASL----------ALN-NSH------ALPYYLDEKSGWSTNPK 290
           G      I  P Y L               A+N  SH      +L   LD   G S  P 
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGES-QPD 168

Query: 291 EIEEVVLA-AKDKKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
              E++   A  KKI   VL  I    NP+G   S ++   + +IA KY ++VI+D+VY 
Sbjct: 169 STTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVYD 228

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 74/190 (38%), Gaps = 42/190 (22%)

Query: 197 YSASQGVYGIRKTVANFITKR----DNGEPAY--PEDIFLTAGASAAVMYLL---SILCK 247
           Y + +G   +R+ +  F+  +    D G PA   PE + L  GAS  ++ +L   ++   
Sbjct: 50  YGSDEGALWVREQICEFLNDQVFRFDGGSPARTRPEYLNLDNGASYGMLNILLQTTLPHN 109

Query: 248 GPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKD------ 301
           G      I  P Y L    L     +     ++EK   S +     E +LAA D      
Sbjct: 110 GYTRQAFIITPTYFLINDCLTDAGFNGKLTAINEKGHDSID----FESLLAALDQHEASA 165

Query: 302 ----------------------KKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYG 338
                                 KKI   V+  I    NP+G   S ++   + EIA KY 
Sbjct: 166 AAATNSAAGSDPTAMIQGSKLTKKIYKYVMYCIPTFANPSGNTYSLETRRRLIEIARKYD 225

Query: 339 IVVIADEVYQ 348
           ++VI D+VY 
Sbjct: 226 MLVITDDVYD 235

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 221 EPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLD 280
           +P   +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +   L 
Sbjct: 83  KPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 281 EKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIV 340
                     E    +L   D  I+  ++ V +PGNPTGA +    IE I +   + G+V
Sbjct: 143 VSDNSFQMDTEAALTILK-NDPLIK--LIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLV 198

Query: 341 VIADEVY 347
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 73/161 (45%), Gaps = 28/161 (17%)

Query: 196 AYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAA---VMYLL-----SILCK 247
           +Y A +G   +R ++A+       G     +DI LT GA  A     Y L      ++C 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICV 108

Query: 248 GPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPS 307
            P    L  +P+  ++ A + L         L ++  +  N + ++ ++      K    
Sbjct: 109 EPTYSQLYSVPE--MFGAEVDL-------LTLKKEDDFLPNLQTLKSMI------KNNTK 153

Query: 308 VLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
           ++++ NP NP G+V+ +  ++ I ++  +  I + +DEVY+
Sbjct: 154 LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 75/162 (46%), Gaps = 16/162 (9%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPE-DIFLTAGASAAVMYLLSILCKGPETGVLI 255
           YS ++G+  + +  +  I KR N  PAY   D+ L  G+S ++  +   LC   + GV +
Sbjct: 132 YSETRGLPSVVE-FSKKIVKRFN-PPAYDNWDVLLANGSSDSLFKIFETLC---DEGVTV 186

Query: 256 PIPQYPLYTASLALNNS--HALPYYLDEKSGWSTNPKEIEEVVLAAKDKKI-------RP 306
            + ++        +  S    +P  ++      T   +++ +    ++ ++       +P
Sbjct: 187 LMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKHLSKP 246

Query: 307 SVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
            VL  I  G NPTG  LS +  + I+E+A  +  +++ D+ Y
Sbjct: 247 RVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           ++  + G + A    L I C   + G ++   +Y  +++ LA   +  +         + 
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFG 186

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++E+++        +P +L  I  G NPTG  L     E I+ IA K+  +++ DE
Sbjct: 187 IVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDE 246

Query: 346 VY 347
            Y
Sbjct: 247 PY 248

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  TAG +      L + C     G +I + +   +++SLA   +  +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 287 TNPKEIEEVVLAAKDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADE 345
             P+++ +++        +P +L  I  G NPTG  +++   E I++IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 346 VYQENVFNEVKFHSMKKVLRNLQKK 370
            Y         F  M   +++L+++
Sbjct: 250 PYY--------FLQMNPYIKDLKER 266

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 72/188 (38%), Gaps = 36/188 (19%)

Query: 196 AYSASQGVYGIRKTVANFIT----KRDNGEP--AYPEDIFLTAGASAAVMYLLSILCKGP 249
            Y + +G + +R T+  F      K  NG P  + PE + L +GAS  V+ +L +    P
Sbjct: 52  TYGSDEGAFWVRDTICQFNNGKAFKFPNGSPYRSKPEYLNLNSGASYGVLSIL-LQTTLP 110

Query: 250 ETG----VLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVL------AA 299
            TG      I  P Y L                + E+   S +   +EE +         
Sbjct: 111 HTGYTRQAFIISPTYFLINDCFIDAGFGGKLTAVSEEGEDSIDFDFLEERLAHFESEARR 170

Query: 300 KDKKIRPSVLVVINP-------------------GNPTGAVLSEKSIEHIFEIAAKYGIV 340
            D  +      V NP                    NP+G   S ++ + + ++A KY ++
Sbjct: 171 NDGDVGNDTSCVTNPTKNPNKKVYRYVLYCVPTYANPSGMSFSLETKKKLLDLARKYDML 230

Query: 341 VIADEVYQ 348
           +IAD+VY 
Sbjct: 231 IIADDVYD 238

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 72/186 (38%), Gaps = 39/186 (20%)

Query: 196 AYSASQGVYGIRKTVANFITKRDNGEPAY------PEDIFLTAGASAAVMYLLSILCKGP 249
            Y +  G   +R+ +A F     N E  +      PE + LT+GAS  ++ +L +    P
Sbjct: 52  TYGSDLGALWVREQIARF-----NNEKIFHVNHTKPEFLNLTSGASYGILNVL-LQTSLP 105

Query: 250 ETG----VLIPIPQYPLYTASLALNNSHALPYYLDEKSG----------------WSTNP 289
            TG      I  P Y L                +DE  G                ++   
Sbjct: 106 HTGYTKQAFIVTPTYFLINDCFIDAGFGGKLTAIDETMGDEYDLNLELLETNLKSFAEEE 165

Query: 290 KEIEEVVLAAKDK------KIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVI 342
            E E +    +DK      KI   V+  +    NP+G   S K+   + E+A +Y +++I
Sbjct: 166 DEKESISCIQRDKIGVENKKIYRFVMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLII 225

Query: 343 ADEVYQ 348
           +D+VY 
Sbjct: 226 SDDVYD 231

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 300 KDKKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
           KDK  +P +L  I  G NPTG  LS +    I+EI  K+ I+++ D+ Y
Sbjct: 204 KDKP-KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 78/188 (41%), Gaps = 42/188 (22%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAY-----------PEDIFLTAGASAAVMYLL--- 242
           Y + +G   +R+T+ +F     N + A+           PE + L +GAS  V+ +L   
Sbjct: 54  YGSDEGALWVRETICHF-----NNDEAFRLSPGDRARSKPEHLNLNSGASYGVLSILLET 108

Query: 243 SILCKGPETGVLIPIPQYPL----YTASLALNNSHALPYYLDEKSGWST----------- 287
           ++   G      +  P Y L    +  +   N + A+    D K    +           
Sbjct: 109 TLAHTGYTRQAFVITPTYFLINDCFIDAGFANKTTAIDELGDGKVDLDSLEKKLEELEKQ 168

Query: 288 -----NPKEIEEVVLAAKD--KKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGI 339
                + K++E +    K   KK+   VL  I    NP+G   + ++   + EIA KY +
Sbjct: 169 HEGQDDSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDM 228

Query: 340 VVIADEVY 347
           +++AD+VY
Sbjct: 229 LILADDVY 236

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 310 VVIN-PGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE 354
           V+IN P NP G V + + +  +  I  + GI +I+DEVY+   F +
Sbjct: 216 VIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTD 261

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 72/160 (45%), Gaps = 12/160 (7%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYP-EDIFLTAGASAAVMYLLSILCKGPETGVLI 255
           Y+ ++G+ G   + A  + +R N  PAY   ++ +  G+S A+  +  +LC    T +L 
Sbjct: 94  YTNTEGM-GPLVSFAKKMIERIN-PPAYGGWNVCMANGSSDAMYKVFEVLCDEDSTVMLE 151

Query: 256 PIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKI-------RPSV 308
                P+  +++ L  +  +P  +   +       +++ +     +  +       +P  
Sbjct: 152 EFTFSPV-ISNIKLQGASVVPVKMQLSADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKA 210

Query: 309 LVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
           L  +  G NPTG  LS      I+EIA K+  +++ D+ Y
Sbjct: 211 LYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPY 250

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 9/125 (7%)

Query: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286
           D+  TAG++ A    L + C   ET   + + +Y  Y++SL    +  L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 287 TNPKEIEEVVLAAKDKKIR---PSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVI 342
               ++ E+ L   D  ++   P +L  I N  NPTG  L E+    +  +A++Y  ++I
Sbjct: 184 IKVDKLSEM-LRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIII 242

Query: 343 ADEVY 347
            D+ Y
Sbjct: 243 EDDPY 247

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 289 PKEIEEVVLAAK-DKKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEV 346
           P+   E++  +K  KKI   V+  I    NP+G   S ++   + +IA +Y ++VI D+V
Sbjct: 167 PRGTTEIIQGSKLSKKIFKYVMYCIPTFANPSGNTYSLETRRRLIDIARQYDMLVITDDV 226

Query: 347 YQ 348
           Y 
Sbjct: 227 YD 228

>KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 418

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 50/119 (42%), Gaps = 5/119 (4%)

Query: 232 AGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKE 291
            GA A    LL+         V IP P +  ++     N  + + YY   + G  +  K 
Sbjct: 120 TGALAVASKLLATFV---SKTVWIPNPSWANHSNVFQWNGFNQIKYYTYYEDGKLSIDKW 176

Query: 292 IEEV--VLAAKDKKIRPSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
           ++E+    +++D    PS+++     NPTG   + +  + I  +    GI  I D  YQ
Sbjct: 177 LKELKESCSSRDPDWPPSIVLHACCHNPTGVDPTLEQWQQILPVIHDLGITPIIDMAYQ 235

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 70/162 (43%), Gaps = 14/162 (8%)

Query: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPED---IFLTAGASAAVMYLLSILCKGPETGV 253
           Y+   G+  IR   A ++  + N +PAY  D   + L++G+  ++       C    T +
Sbjct: 125 YNEVPGLPQIR-NFAKYLVNKIN-KPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVL 182

Query: 254 LIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKI-------RP 306
           +      P+  + +    +  +P  ++     ST   +++ +     +          +P
Sbjct: 183 MEEFTFTPV-ISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKP 241

Query: 307 SVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
            +L  I  G NPTG  +  ++   I+E+A K+  +++ D+ Y
Sbjct: 242 RILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 305 RPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVY 347
           +P VL  I  G NPTG  + +   E I+E+A ++  +++ D+ Y
Sbjct: 268 KPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPY 311

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 289 PKEIEEVVLAAK-DKKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEV 346
           P    E++   K  KK+   V+  I    NP+G   S ++   + +IA KY +++I D+V
Sbjct: 167 PHSTTEMIQGPKLTKKVYRYVMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDV 226

Query: 347 YQ 348
           Y 
Sbjct: 227 YD 228

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 302 KKIRPSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQ 348
           KKI   VL  + +  NP+G   S K+   + ++A  Y I++I D+VY+
Sbjct: 211 KKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

>SAKL0A06974g Chr1 (620230..622101) [1872 bp, 623 aa] {ON} similar
           to uniprot|P38319 Saccharomyces cerevisiae YBR223C TDP1
           Tyrosine-DNA Phosphodiesterase
          Length = 623

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 301 DKKIRPSVLVVINPGNPTGAV----LSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVK 356
           D + R  V+  +   NP G++    L E+  EH+     +Y   +I  E+Y  N  +   
Sbjct: 105 DTEDRIEVVKHVRTSNPAGSIEQRCLEEEQAEHV-----QYPFRLIRSEIYDRNTPSSPH 159

Query: 357 FHSMKKVLRNLQKK 370
           F SM+K+L + + K
Sbjct: 160 FISMEKILSDTKLK 173

>CAGL0F01177g Chr6 complement(121015..123471) [2457 bp, 818 aa] {ON}
           weakly similar to uniprot|Q08206 Saccharomyces
           cerevisiae YOL036w
          Length = 818

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 4   STPLLSSSKFASRQLRILTRTYSVNLTNNKFNNKMPHFMEPS 45
           STPL+ +S F+ +  R LTR  S N ++ + +NK P  + PS
Sbjct: 554 STPLMRTSSFSHKMKRGLTRIMSTNGSSARISNKPPAEVVPS 595

>TBLA0A08730 Chr1 (2141012..2141518) [507 bp, 168 aa] {ON} Anc_8.172
           YBL025W
          Length = 168

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 140 QLNQKPLSFYRQVLSLLQYPEIL-KQDESKLVASGLFKKDALE 181
           Q++ K L +Y   L LL+YPE+  + DE+ L+  GL  +  +E
Sbjct: 70  QVDLKVLHYYASQLCLLKYPELSNRMDETALITLGLLVEQWVE 112

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 62/321 (19%), Positives = 116/321 (36%), Gaps = 37/321 (11%)

Query: 196 AYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFL--------TAGASAAVMYLLSILCK 247
           +Y    G    R  V NF+ +  +  P Y + +          +   + A+     +L  
Sbjct: 93  SYLPISGCPNYRDNVLNFLFR--DSVPKYGDKLIADNRVSFIQSLSGTGAIAVASKLLSS 150

Query: 248 GPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIE--EVVLAAKDKKIR 305
                V IP P +P +     +N    L YY     G  T  + +E  E  + + + K+ 
Sbjct: 151 FISDTVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLESTETEVRSSNSKLP 210

Query: 306 PSVLVVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLR 365
            S+++     NPTG   +      I +   +  ++ I D  YQ         +    +LR
Sbjct: 211 QSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQG--LESGSLYDDAYLLR 268

Query: 366 NL--QKKHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELT----------GFTHEVRSV 413
           +   + ++ G    + L    + + G+ GE   R G + +               +++ +
Sbjct: 269 HCLDESRYKGWKHGLFLCQSFAKNMGLYGE---RVGSLSIVVPPNLEKAKLSIDSQLKKI 325

Query: 414 ILKLASISLCPVVTGQALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNT 473
           +  + S    P   G  + +L++S P    E   Q   +   I   L     Q+Y     
Sbjct: 326 VRGIYS---SPPGYGCRIANLVLSQP----ELRNQWHQDVHSIVGRLTNVRKQMYDKLG- 377

Query: 474 LEGIECQKPQGAMYLFPRLDL 494
             G+     Q  M+ F RLD+
Sbjct: 378 WSGLVDSSQQHGMFYFTRLDI 398

>TPHA0J02430 Chr10 complement(535317..537080) [1764 bp, 587 aa] {ON}
           Anc_6.221 YPL208W
          Length = 587

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 8/101 (7%)

Query: 93  NDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLSFYRQV 152
           NDNV K     R  + +  +E+   L  +PS L F  +VN N+GN   +  K  S Y++ 
Sbjct: 93  NDNVRKLSMKFRPYLDLLPKEMHSPLIWNPSELQF--LVNTNLGN--SIKNKLQSIYKEW 148

Query: 153 LSLLQYPE-ILKQDESK---LVASGLFKKDALERAKTLLHE 189
             + ++ E +   +E K   ++     +   LE  + LLH+
Sbjct: 149 YQITKFNESLFNHNEIKEEFIIYESFDELSELELYERLLHK 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,086,599
Number of extensions: 2569226
Number of successful extensions: 7248
Number of sequences better than 10.0: 134
Number of HSP's gapped: 7411
Number of HSP's successfully gapped: 134
Length of query: 568
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 453
Effective length of database: 40,294,809
Effective search space: 18253548477
Effective search space used: 18253548477
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)