Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050108.260ON29522952151550.0
NDAI0B019808.260ON2959297096400.0
Suva_10.1718.260ON2958297789440.0
YLR087C (CSF1)8.260ON2958297089240.0
Skud_12.1558.260ON2959297289090.0
Smik_12.1468.260ON2958297189000.0
KAFR0B027208.260ON2982300285740.0
KNAG0G020308.260ON2998302080270.0
CAGL0L12210g8.260ON2981299878480.0
TDEL0F038708.260ON2942297877670.0
ZYRO0C01694g8.260ON3006304170330.0
Kpol_392.78.260ON2995301667350.0
TBLA0E044208.260ON3148257159630.0
TPHA0J007308.260ON3046307159050.0
SAKL0H17072g8.260ON2997303756570.0
KLTH0G13728g8.260ON2966303148010.0
Kwal_YGOB_56.238088.260ON2941301646800.0
Kwal_56.23810singletonOFF2763281043170.0
Ecym_43108.260ON2943304340320.0
AGR088W8.260ON2887301335440.0
KLLA0F19096g8.260ON2923158519630.0
Kwal_56.23808singletonOFF62601442e-10
ZYRO0E06534g2.576ON38288821.5
NDAI0C051708.478ON19045746.1
KLLA0B03894g4.373ON155890767.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05010
         (2952 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  5842   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3717   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  3449   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  3442   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  3436   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  3432   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3307   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3096   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  3027   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2996   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2713   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2598   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2301   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2279   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2183   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1853   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1807   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1667   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  1557   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  1369   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   760   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    60   2e-10
ZYRO0E06534g Chr5 complement(493175..494323) [1149 bp, 382 aa] {...    36   1.5  
NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa] {...    33   6.1  
KLLA0B03894g Chr2 complement(352195..356871) [4677 bp, 1558 aa] ...    34   7.8  

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 5842 bits (15155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2845/2952 (96%), Positives = 2845/2952 (96%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180
            TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180

Query: 181  DSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSSFLRFLPIQFLVTRGSLI 240
            DSATVKSMDDSQF              ATNDRVFQEEETDTSSFLRFLPIQFLVTRGSLI
Sbjct: 181  DSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDTSSFLRFLPIQFLVTRGSLI 240

Query: 241  LGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSM 300
            LGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSM
Sbjct: 241  LGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSM 300

Query: 301  KFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGLGE 360
            KFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGLGE
Sbjct: 301  KFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGLGE 360

Query: 361  RRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDVGNS 420
            RRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDVGNS
Sbjct: 361  RRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDVGNS 420

Query: 421  GAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTYGQ 480
            GAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTYGQ
Sbjct: 421  GAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTYGQ 480

Query: 481  VLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALCPT 540
            VLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALCPT
Sbjct: 481  VLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALCPT 540

Query: 541  VDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQME 600
            VDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQME
Sbjct: 541  VDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQME 600

Query: 601  AFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLD 660
            AFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLD
Sbjct: 601  AFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLD 660

Query: 661  FNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXEFMKHK 720
            FNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFR            EFMKHK
Sbjct: 661  FNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNEFMKHK 720

Query: 721  EVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDF 780
            EVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDF
Sbjct: 721  EVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDF 780

Query: 781  FHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTELQRSDLK 840
            FHFVTSEEYTGAIRANEDDMQYA              TMQGNDAPGRRRLHTELQRSDLK
Sbjct: 781  FHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLHTELQRSDLK 840

Query: 841  RTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVS 900
            RTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVS
Sbjct: 841  RTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVS 900

Query: 901  IKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGT 960
            IKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGT
Sbjct: 901  IKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGT 960

Query: 961  LDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQEPKL 1020
            LDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQEPKL
Sbjct: 961  LDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQEPKL 1020

Query: 1021 NMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLETKVKIT 1080
            NMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLETKVKIT
Sbjct: 1021 NMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLETKVKIT 1080

Query: 1081 NFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXXXXXXX 1140
            NFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIA         
Sbjct: 1081 NFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSSLPPLP 1140

Query: 1141 XXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTPS 1200
                  TTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTPS
Sbjct: 1141 VPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTPS 1200

Query: 1201 EAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDDIEIATVNRLS 1260
            EAIQNDKCER              CPDILDSIGTFLMLFSTENIVQIIDDIEIATVNRLS
Sbjct: 1201 EAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQIIDDIEIATVNRLS 1260

Query: 1261 NLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENKEKKLIELTV 1320
            NLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENKEKKLIELTV
Sbjct: 1261 NLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENKEKKLIELTV 1320

Query: 1321 LNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEA 1380
            LNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEA
Sbjct: 1321 LNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEA 1380

Query: 1381 QLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKP 1440
            QLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKP
Sbjct: 1381 QLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKP 1440

Query: 1441 AFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFIS 1500
            AFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFIS
Sbjct: 1441 AFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFIS 1500

Query: 1501 VFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTVYSAGYEVEHN 1560
            VFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIH          ASFFVTVYSAGYEVEHN
Sbjct: 1501 VFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTVYSAGYEVEHN 1560

Query: 1561 FIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLLPSLKITDGG 1620
            FIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLLPSLKITDGG
Sbjct: 1561 FIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLLPSLKITDGG 1620

Query: 1621 KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSL 1680
            KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSL
Sbjct: 1621 KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSL 1680

Query: 1681 AVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLHLMAMTATDI 1740
            AVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLHLMAMTATDI
Sbjct: 1681 AVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLHLMAMTATDI 1740

Query: 1741 LVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFTNISFELMPISP 1800
            LVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFTNISFELMPISP
Sbjct: 1741 LVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFTNISFELMPISP 1800

Query: 1801 FFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDP 1860
            FFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDP
Sbjct: 1801 FFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDP 1860

Query: 1861 YHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDN 1920
            YHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDN
Sbjct: 1861 YHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDN 1920

Query: 1921 NKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPNQSDISGQFSVENVLF 1980
            NKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPNQSDISGQFSVENVLF
Sbjct: 1921 NKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPNQSDISGQFSVENVLF 1980

Query: 1981 FIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQV 2040
            FIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQV
Sbjct: 1981 FIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQV 2040

Query: 2041 STSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVGWLFSVDSKSEPG 2100
            STSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVGWLFSVDSKSEPG
Sbjct: 2041 STSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVGWLFSVDSKSEPG 2100

Query: 2101 LILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYW 2160
            LILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYW
Sbjct: 2101 LILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYW 2160

Query: 2161 FKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVND 2220
            FKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVND
Sbjct: 2161 FKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVND 2220

Query: 2221 DKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYK 2280
            DKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYK
Sbjct: 2221 DKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYK 2280

Query: 2281 HLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXXXXXXXXXXQ 2340
            HLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMV                Q
Sbjct: 2281 HLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKKHSSSEESTLSKPSSQ 2340

Query: 2341 NLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSF 2400
            NLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSF
Sbjct: 2341 NLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSF 2400

Query: 2401 SLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQL 2460
            SLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQL
Sbjct: 2401 SLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQL 2460

Query: 2461 QNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDV 2520
            QNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDV
Sbjct: 2461 QNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDV 2520

Query: 2521 DLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEV 2580
            DLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEV
Sbjct: 2521 DLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEV 2580

Query: 2581 NWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLL 2640
            NWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLL
Sbjct: 2581 NWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLL 2640

Query: 2641 KVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDI 2700
            KVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDI
Sbjct: 2641 KVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDI 2700

Query: 2701 LRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQV 2760
            LRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQV
Sbjct: 2701 LRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQV 2760

Query: 2761 YDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDIL 2820
            YDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDIL
Sbjct: 2761 YDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDIL 2820

Query: 2821 EYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXXXXXXXXXX 2880
            EYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQS          
Sbjct: 2821 EYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSEEDVEKRIKE 2880

Query: 2881 XXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYS 2940
              NFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYS
Sbjct: 2881 EENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYS 2940

Query: 2941 AEREYANILGSS 2952
            AEREYANILGSS
Sbjct: 2941 AEREYANILGSS 2952

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3717 bits (9640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1804/2970 (60%), Positives = 2245/2970 (75%), Gaps = 35/2970 (1%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            MDA+SQFQ +PLT+Q++FSW+FLV WIL +I++L  IFYL RT+AY I+FILEW LWK +
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
             VK+NI+S+RIS LGGR+FFKNV IIH+D TIS LE N+TWRYWL N RK  +    + +
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180
             +    S+K   LPCRF +  EGLEIF+YN+ VAYDNII  FSKEER QFEKFLNEQ+ +
Sbjct: 121  -KASANSVK---LPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFT 176

Query: 181  DSAT--VKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSSFLRFLPIQFLVTRGS 238
            DS      S  +S+                TNDRVFQEE ++   FL FLPI F V+ GS
Sbjct: 177  DSKAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGS 236

Query: 239  LILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDV 298
            LI+GNKFTPSL+I S  S   ++D  QP EKLDLYK +   +       +KQNIGF+E+ 
Sbjct: 237  LIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEF 296

Query: 299  SMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGL 358
            SMKFK+DR +VS++W  F ++L   Y  ++ +H+   K   ED F  KWRGL+LY+GT  
Sbjct: 297  SMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIF 356

Query: 359  GERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDVG 418
            G+  +DI+DI+FDFANHEYAKFSSI+++P+  FT + D+PGIVPHGAHPT++  DGPDVG
Sbjct: 357  GKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVG 416

Query: 419  NSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTY 478
            NSGAPP++SL+IQI GGS+CFGPWAQRQ + L +LLSP+ SR AKP KRLTPGC RIYT 
Sbjct: 417  NSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQ 476

Query: 479  GQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALC 538
             +  ++  ++ TWRIPTRESSKD EFLQHYRETN EYRPFGWIDLKFSK+T + +T A C
Sbjct: 477  FKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQC 536

Query: 539  PTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQ 598
            PT +GFKN + IHL +NE RSSVNHDILLKCK F+F +D  FPLGWN+EATWTI+L S+Q
Sbjct: 537  PTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQ 596

Query: 599  MEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNP 658
            +EAFILREHITLIADTLTDFSSGEPTPYELFRPF+Y INWKI+GYSLYLNVNDHNIVNNP
Sbjct: 597  LEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNP 656

Query: 659  LDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXEFMK 718
            LDFNENCYLSFHGD L +D ++PK  ++A  T++SYTI TPMFR            EFMK
Sbjct: 657  LDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMK 716

Query: 719  HKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFG 778
            +KEVGRS+DFK+ GSYLIYS+LDIDNVDTI+++C+S+ T LQCYGFV+RYL NVKMNYFG
Sbjct: 717  NKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFG 776

Query: 779  DFFHFVTSEEYTGAIRANEDDMQYA-XXXXXXXXXXXXXXTMQGNDAPGRRRLHTELQRS 837
            DFFHFVTSEEYTG IRANE   Q+                +++ +     +   ++++RS
Sbjct: 777  DFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRS 836

Query: 838  DLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMN 897
            DLKR TNETDLWFTFTVWEGA+LLPETIYNCDPC+GLHFGEL+ID RSCNYYMDLLA+MN
Sbjct: 837  DLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMN 896

Query: 898  DVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFD 957
            D+S++RY+ K  +EI+E++ ++NG     +GSLS + IH HRMYGLPP+EPTYFCQWDF 
Sbjct: 897  DISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFS 956

Query: 958  LGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQE 1017
            LGTLD+  DI FL GF +SF +I FG VDLENILLYEKE  DDMTS+TV+++K+S+M++E
Sbjct: 957  LGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRE 1016

Query: 1018 PKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTK-KLFTLETK 1076
             +++ +       LYF+ I+FENEKY TRLDL IP   F+LF+   +G  K KLF  ETK
Sbjct: 1017 SEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPI--FNLFMYTMNGAKKEKLFEFETK 1074

Query: 1077 VKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXXX 1136
            V ++NF +  D   H+  Q+EYI LHDAPYHRC+FILP   QD+E YQ+LFG+IA     
Sbjct: 1075 VNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSL 1134

Query: 1137 XXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYAT-----DVSDDETEEDI 1191
                      T D+I++DLLG F ++LE+ +PFR+PFS           + SD E++E++
Sbjct: 1135 PPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEEL 1194

Query: 1192 DPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDDI 1251
            DPLEF T +    ++                   P +   +      F +++IVQI+DDI
Sbjct: 1195 DPLEFKTETSG-DSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDI 1253

Query: 1252 EIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENK 1311
            EI  VN LS+L+EG     N+K+ ILYLDLFWG R + G+ +YLDRID  MC+K +EEN 
Sbjct: 1254 EIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENN 1313

Query: 1312 EKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNIL 1371
            E K+ E+T LNKIRSVR T+N+ ++  K +ERPPALSLVIEG EIWS     QVNSLNIL
Sbjct: 1314 ETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNIL 1373

Query: 1372 STDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQIS 1431
            S DIT+DEAQ++WLF Y D Q    Q++     +IQ+ +  +RK+L+S L  ASEYYQIS
Sbjct: 1374 SADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQIS 1433

Query: 1432 HDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATT 1491
            HDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLP DW   I+    Q + + T 
Sbjct: 1434 HDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQ-QDSHTL 1492

Query: 1492 QDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTVY 1551
             D    FISVFSNWRNWEFSDIARSYIYR +F   HS ++ +          AS F TVY
Sbjct: 1493 PDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVY 1552

Query: 1552 SAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLL 1611
            S GYEVEHNFI+TRTN+++ET    SDSS+ +E I N+TG+LGT KGK S K+I +K LL
Sbjct: 1553 STGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLL 1612

Query: 1612 PSLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPK 1671
            P L +      K +  F++ FKLN L+L ER ELQ  +G ++++SRVFG +LSMLWESPK
Sbjct: 1613 PELSMKKN--LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPK 1670

Query: 1672 DLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLH 1731
            DL S+A+S+ VY QR+E+ +KH N  LAE Q+R+FS+I+T ESWSYKPT+LVN QC+D+H
Sbjct: 1671 DLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIH 1730

Query: 1732 LMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGP-KPKVNTILTCFFTN 1790
              AMTATD+L  S+ EI+ENI  +E+ L        I ++  +   + K+N +LTC+FTN
Sbjct: 1731 FRAMTATDVLAKSVGEIIENIKELEK-LFYSDSDSGIQQISQYPVMEQKINMVLTCYFTN 1789

Query: 1791 ISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDL 1850
            ++ E+MP+SPF  RH AKQLDIYFNR GSN+++LSVWD D++L SHLTK++YFRFSFG++
Sbjct: 1790 VNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNI 1849

Query: 1851 QLKGNMVNDP-YHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLS 1909
            QLKGN++ +P Y IN+ +SASI+KLT+ D+++LIPSFLQDEKIL ES+E F +L LF   
Sbjct: 1850 QLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLF--- 1906

Query: 1910 KNQKSKP----EKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPN 1965
              Q+ KP    EK     +WS+++NINYFGLL PI S YF+ EL MLL SL K+      
Sbjct: 1907 --QRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSK 1964

Query: 1966 QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCL 2025
             + +SGQFS++NV F +KE++LP  LSK+LDFSIKVS LQK K T  ++QIES HFRVCL
Sbjct: 1965 YNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCL 2024

Query: 2026 SPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNF 2085
            SP SL  +LW  NQ  T+I+YYK+ H    W+      N   + ++  + PSFH+LSYNF
Sbjct: 2025 SPGSLAHMLWRGNQALTNIRYYKE-HTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNF 2083

Query: 2086 CVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKD 2145
            CVGWLFS +  +EPGLI+GY+RLFSAYEKN GKLTL+D +FS+ANG +SD FFS+G EKD
Sbjct: 2084 CVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKD 2143

Query: 2146 KYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELK 2205
            +YNRSYLPNMQISYW K+ G +RD+++RFHGEALDV FL+S++DVIES+L S+Q FQELK
Sbjct: 2144 RYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELK 2203

Query: 2206 KDLIPGLPKKQKVNDDKTLE-LNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEP 2264
            +DL+      ++     T E +  +SPF   IRSI+CQF+YDGGVFK+FS  +A    +P
Sbjct: 2204 RDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKP 2263

Query: 2265 SFEVNSPNVVIDLNYKHLENRTKQ-HWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMV 2323
            SFE+ SPNV+ID+NYK+ E +T+   WIR+LI INSTHN L+AKCAPL+++F E IQ MV
Sbjct: 2264 SFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMV 2323

Query: 2324 XXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSF 2383
                            QN+DYKR+LDSFD+A+++ SAKQ LSL CEP+AKVQADIGFQSF
Sbjct: 2324 KRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSF 2383

Query: 2384 IFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVH 2443
             FTVTTND D  EPL F+LSVEKTEASIKHIFSRE STS GVDF+D+T+MFTHP+ IN+ 
Sbjct: 2384 TFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINIL 2443

Query: 2444 GTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQLSDPE 2502
            GT LIS++++FFNVKQLQNLYLFLDIW+LS+LL SKP N++VK++TD  SLS  Q  D +
Sbjct: 2444 GTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTD 2503

Query: 2503 SIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSK 2562
            S IPWCFTLIF+N+ GDVDLGP+LGV+S+  KRTWFATDHYK+ RKVLHA+T G +L+SK
Sbjct: 2504 STIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSK 2563

Query: 2563 GRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNT 2622
            GRLSGI EL GASWISEVNWP    IN +PLVSI++NID + TK AFDYHMFL+GAINN 
Sbjct: 2564 GRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNI 2623

Query: 2623 RVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIET 2682
             VH+HSEKD+NG+ PDLLKV  +CE+I LCSTALVAANILDIYNT MR+RQDNKISYIET
Sbjct: 2624 DVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIET 2683

Query: 2683 LRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISA 2742
            L+ESN +E +  ++Y DILRSLNL+QTDVSVDIYTLNIQISPI+LFD E+LV+ IE+ISA
Sbjct: 2684 LKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISA 2743

Query: 2743 RSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEI 2802
            RSETH+G KL TELEMQVYDASV+LSTSKEE+DE  ++ ISV++Y+ YA +I GG IIE 
Sbjct: 2744 RSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEA 2803

Query: 2803 PKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQV 2862
            P+LL++MTT+Q+EKSDILEYLYTC F DK+SVRWNLGP+NFIKEMW TH+RA+AVRRSQ+
Sbjct: 2804 PRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQI 2863

Query: 2863 VGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRF 2922
                   S             FSRF+YV LE PRIDMPQIRDLGDATPP+EWFG+NRKRF
Sbjct: 2864 DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRF 2923

Query: 2923 PAFTHQTAVFLVQKLVYSAEREYANILGSS 2952
            PAFTHQTAV LVQKLV++AE+EY +ILG S
Sbjct: 2924 PAFTHQTAVILVQKLVHTAEKEYGSILGHS 2953

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3449 bits (8944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1644/2977 (55%), Positives = 2189/2977 (73%), Gaps = 51/2977 (1%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M+AVSQ +GVPLT Q++FSW+FLV WILTVI  L+ IFY+GR  AY+++FILEWLLWK A
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            K+K+N+++LRISLLGGRI+FK++++IHKD TISILEG++TW+YWL N RK E  E     
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIE----- 115

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176
               K +S KN +LPC+F++  EGLE F+YN+T+AYDN+I + SK+ER +FEK+LNE    
Sbjct: 116  -NEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFP 174

Query: 177  QILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSSF---LRFLPIQFL 233
            +  SD ++   +D+                   NDR +QE  T+   +   L F PI+  
Sbjct: 175  EPFSDGSSADKLDED---LSESAYTTNSDSSIINDRDYQE--TNIGKYPKGLSFFPIELK 229

Query: 234  VTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIG 293
            + RGSL+LGNKFTPS++I+S ++ + ++D   PKE+LDLY+ K   EL N E ++KQNIG
Sbjct: 230  LNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIG 289

Query: 294  FDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALY 353
            +D+ + +KFKLD GKVS++W  F R+L ++ KP+      ++    +D F  KW+GL+LY
Sbjct: 290  YDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV-IPRRGKKAGPSDDAFFQKWKGLSLY 348

Query: 354  KGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLD 413
            K +    + +D+DDIEFDF +HEYAKF+SILK PKVT +   D+PG+VPHGAHPTI  +D
Sbjct: 349  KASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDID 408

Query: 414  GPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCR 473
            GPDVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRTAKP+K+L PG R
Sbjct: 409  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSR 468

Query: 474  RIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNT 533
            R+YT  ++ + IM+D TWRIPTRESSKD EFLQHY++T+ EYRPFGW+DL+F K+T  N 
Sbjct: 469  RVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANF 528

Query: 534  TFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTIN 593
              ++CPTV+GFKN+  +H  E E RSSVNHDILLK K FD D D  +PLGWN    W IN
Sbjct: 529  NISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIIN 588

Query: 594  LNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHN 653
            + S Q+EAF+LREHITL+ADTL+DFS+G+PTPYELFRPF+Y +NW++DGYS+YLNVNDHN
Sbjct: 589  MKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHN 648

Query: 654  IVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXX 713
            IVNNPLDFNENCYLS HGD+L++D  +P+ SI   +TD+SY I TPMFR           
Sbjct: 649  IVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTL 708

Query: 714  XEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVK 773
             EFMKHKEVGRSYDF + G YL+YS+LDIDNVD++ ++CTS  T L CYGFV+RYLINVK
Sbjct: 709  NEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVK 768

Query: 774  MNYFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQG---NDAPGRRRL 830
            MNYFG+FF+FVTSEEYTG + A E                       G   NDA      
Sbjct: 769  MNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAED---- 824

Query: 831  HTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYM 890
            +  ++RSDLKRTTNETD+WFTF+VW GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYM
Sbjct: 825  NGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYM 884

Query: 891  DLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTY 950
            D++A +N  SIKR+VSK  +E+F+ I +NNG +   HG LS LTIHGHRMYGLPP EPTY
Sbjct: 885  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTY 944

Query: 951  FCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEK 1010
            FCQWD +LG L+I SDIEFL+GFF+SF ++GFGY DLENILLY+ ET +DMTS+TV+ E+
Sbjct: 945  FCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAER 1004

Query: 1011 LSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKL 1070
            +++ L +P +   +   + +L FT IDFENE+YS R+D+ +P L  SL     DGT    
Sbjct: 1005 INISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSF 1064

Query: 1071 FTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAI 1130
               ETK++ TNF Q +D D+ R  QR YI ++D+PYHRC F+LP  YQD++ YQ+L+GAI
Sbjct: 1065 LNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAI 1124

Query: 1131 AXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSD-----QDYATDVSDD 1185
            A               T D+IIED++GE+  LLE ++PF+  F++     +      ++D
Sbjct: 1125 APSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTED 1184

Query: 1186 ETEEDIDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIV 1245
            + EE  DPLEF  P    +    ER               P +     + L  F +E++V
Sbjct: 1185 DDEEAADPLEFK-PVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMV 1243

Query: 1246 QIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEK 1305
            Q++DDIEI  V RLSNL+EG   ++N+ I++ YL+L W    + G  +YLDRI++ M EK
Sbjct: 1244 QVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEK 1303

Query: 1306 TVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQV 1365
            ++E+N+  K +E+ VL K+++VR TVNQ      +E+RPPALSL +EG+E+WSST + QV
Sbjct: 1304 SLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQV 1363

Query: 1366 NSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAAS 1425
            NSLN+ S+DIT+DE+Q+EWLF Y  +QG  IQ++  + ++IQ  +  ++ ELIS LTAAS
Sbjct: 1364 NSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAAS 1423

Query: 1426 EYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQS 1485
            EYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW + I++ L + 
Sbjct: 1424 EYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKER 1483

Query: 1486 KTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXAS 1545
            K +   +DAK IF+SVFS WRNWEFSD+ARSYIY KLFL  H+  + +           S
Sbjct: 1484 KYSF-AKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGS 1542

Query: 1546 FFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKII 1605
            F++TVY  GYEVEHNF++   NL+++   P +  S +RE    ITG +G+ KGK SDK++
Sbjct: 1543 FYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLL 1602

Query: 1606 MIKNLLP-SLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLS 1664
             +++L+P  + +T+  KS    +  K FK+NT++L ++ E+Q+ +  T+++SR  G R+S
Sbjct: 1603 KLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVS 1662

Query: 1665 MLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVN 1724
            +LWE+ KD TSQA SL +++Q++E+ LKH +  L E Q+ DFS++ TTE+WS+KPTILVN
Sbjct: 1663 LLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVN 1722

Query: 1725 SQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTIL 1784
            +QC+DLH  AM+ T+ +V +I EI E++ ++++ +    + +  +K +S     ++NT+L
Sbjct: 1723 NQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQI----KFKPKSKNKSQFVGSRINTVL 1778

Query: 1785 TCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFR 1844
            +C+F+N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNEILLS+WD D ++TSH TK+QY R
Sbjct: 1779 SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLR 1838

Query: 1845 FSFGDLQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITL 1903
            FSFGD+++KG    + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I    +L
Sbjct: 1839 FSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSL 1898

Query: 1904 DLFGLSKN-QKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD 1962
            +   L+ +   +K E      +W++DTNI+YFG+L P+ S YF+FEL MLL SLT   + 
Sbjct: 1899 NSLFLTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNG 1958

Query: 1963 -IPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHF 2021
             +P Q+ ++GQ S+EN+LF IKER+LP+ LSKLLDFSIKVS LQ+  +T  ++Q+ESSHF
Sbjct: 1959 LLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHF 2018

Query: 2022 RVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHIL 2081
            RVCLSP+SL+RL+W   ++   +QYY   H  N W++R       K  ++P+N  S HIL
Sbjct: 2019 RVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHIL 2078

Query: 2082 SYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEG 2141
            SY FC+GWLF   +  +PGL+ GYNRLFSAYEK+ GK T+VD FFS++NGN+S  FFSEG
Sbjct: 2079 SYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEG 2138

Query: 2142 KEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTF 2201
             EK+KYNRS+LPNMQISYWFK  G ++D F RFHGEALDV FL S++DVI+S L S++ F
Sbjct: 2139 NEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAF 2198

Query: 2202 QELKKDLIPGLPKKQKVNDDKTLEL-------NTLSPFLANIRSISCQFKYDGGVFKIFS 2254
            QELKK+++  +P +  + +             N+L+PFL NIRS++C FKYDGGVF++++
Sbjct: 2199 QELKKNIL-DMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYT 2257

Query: 2255 LEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSD 2314
             +D E +SEPSFE+ SP V I+  YKH E++ K H IR+LI ++ THN LYA CAPLL +
Sbjct: 2258 YDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLME 2317

Query: 2315 FFERIQGMVXXXXXXXXXXX-XXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAK 2373
            F E +Q M+                 QN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAK
Sbjct: 2318 FSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAK 2377

Query: 2374 VQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLM 2433
            VQAD+GF+SF+F++TTN+ D+ +PL FSL++E+T+ASIKHIFSRE STS  V F+D+TL+
Sbjct: 2378 VQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLL 2437

Query: 2434 FTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SS 2492
            FTHPDVI+++GT+L+S++++FFNVKQLQNLYLFLDIWR S +L ++P       + + S+
Sbjct: 2438 FTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMST 2497

Query: 2493 LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHA 2552
            LS     D  + IPWCFTLIFTN+ GDVDLGPSLGVIS++ +RTW ATDHY   R++LHA
Sbjct: 2498 LSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHA 2557

Query: 2553 FTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYH 2612
            FTDG SL+S+GRLSG+FE+  ASW+SEV WP + + N HPLVS ++NID+++ KAAFDYH
Sbjct: 2558 FTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYH 2617

Query: 2613 MFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMR 2672
            MFLIG INN R HLH+EKD  G++PDLL+V+F  + ITL STALVAANILDIYNT +RMR
Sbjct: 2618 MFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMR 2677

Query: 2673 QDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEV 2732
            QDNKISY+ETLR+SN +ESK PI Y DILRSL LL+TD+SV+I +L +QISPI+LFDVEV
Sbjct: 2678 QDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEV 2737

Query: 2733 LVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYAS 2792
            LV+ I+ +S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YAS
Sbjct: 2738 LVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYAS 2797

Query: 2793 KIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHI 2852
            KIVGGTII+IPKL V MTT QEEK++ LEYL+ C F DK+SVRWNLGPINFIKEMWTTH+
Sbjct: 2798 KIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHV 2857

Query: 2853 RAIAVRRSQVVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPM 2912
            +A+AVRRSQ   +  GQ+            N S+F Y+ALE P+I++PQIRDLG+ATPPM
Sbjct: 2858 KALAVRRSQTANISFGQTEEELEESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPM 2917

Query: 2913 EWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949
            EWFGVNRKR P FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2918 EWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 3442 bits (8924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1643/2970 (55%), Positives = 2170/2970 (73%), Gaps = 37/2970 (1%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M+A+SQ +GVPLT Q++FSW+FLV WILTV++ L+ IFY+GR  AY+++FILEWLLWK A
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            K+K+N+++LR+SLLGGRI FKN+++IHKD TIS+LEG++TW+YWL N RK E  E     
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIE----- 115

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176
               K +S K  +LPC+  V  EGLEIF+YN+TVAYDN+I + SK+ER +FEK+LNE    
Sbjct: 116  -NNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFP 174

Query: 177  QILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDT-SSFLRFLPIQFLVT 235
            +  SD ++   +D+                   NDR +QE +       L FLPI+   +
Sbjct: 175  EPFSDGSSADKLDED---LSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFS 231

Query: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295
            RGSL+LGNKFTPS++I+S +S   ++D   PKE+LDLY+ K   E  N E ++KQNIG+D
Sbjct: 232  RGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYD 291

Query: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355
            + + +KFK+DRGKVS++W  F R+  I+ KP+      +     +D F  KW+GL+LYK 
Sbjct: 292  DAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKA 351

Query: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415
            +    + +D+DD+EFD  NHEYAKF+SILK PKVT     D+PG+VPHGAHPTI  +DGP
Sbjct: 352  SAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGP 411

Query: 416  DVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRI 475
            DVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRTAKP+K+L PG RRI
Sbjct: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRI 471

Query: 476  YTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTF 535
            YT  ++ ++IM+D TWRIPTRESSKD EFL+HY+ETN EYRPFGW+DL+F K+T  N   
Sbjct: 472  YTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNI 531

Query: 536  ALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLN 595
            ++CPTV GF+NN  +H  E E RSSVNHDILLK K FD D D  +PLGWN +A W IN+ 
Sbjct: 532  SVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMK 591

Query: 596  SSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIV 655
            S Q+EAF+LREHITL+ADTL+DFS+G+PTPYELFRPF+Y +NW+++GYS+YLNVNDHNIV
Sbjct: 592  SEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651

Query: 656  NNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXE 715
            NNPLDFNENCYLS HGD+LS+D  +P+ SI   +TD+SY I TPMFR            E
Sbjct: 652  NNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNE 711

Query: 716  FMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMN 775
            FMKHKEVGR+YDF + GSYL+YS+LDIDNVDT++++C SK T L CYGFV+RYL NVKMN
Sbjct: 712  FMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMN 771

Query: 776  YFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTELQ 835
            YFG+FF+FVTSEEYTG + A E                      Q +           ++
Sbjct: 772  YFGEFFNFVTSEEYTGVLGAREVG-DVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMK 830

Query: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895
            RSDLKRTTNETD+WFTF+VW+GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYMD++A 
Sbjct: 831  RSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAV 890

Query: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955
            +N  SIKR+VSK  +E+F+ I +NNG +   HG LS LTIHGHRMYGLPP EPTYFCQWD
Sbjct: 891  LNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWD 950

Query: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015
             +LG L I SDIEF++GFF+SF +IGFGY DLENILLY+ ET +DMTS+TV++EK+ + L
Sbjct: 951  INLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGL 1010

Query: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075
            ++P +   +     ++ FT IDFENEKYS R+D+ IP L  SL     DG        ET
Sbjct: 1011 KDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFET 1070

Query: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXX 1135
            K++ TNF Q +D D+ R  QR YI +HD+PYHRC F+LP  YQD++ YQ L+GAIA    
Sbjct: 1071 KLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSS 1130

Query: 1136 XXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSD-----QDYATDVSDDETEED 1190
                       T D+IIED++GE+  LLET++PF+  F++     +      S+D+ +E+
Sbjct: 1131 IPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEE 1190

Query: 1191 IDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDD 1250
             DP  F  P    ++   ER               P +     + L    +EN+VQ++DD
Sbjct: 1191 ADPSSFK-PVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDD 1249

Query: 1251 IEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEEN 1310
            IEI  V RLSNL+EG   ++N+ I+I YL+L W    + G  +YLDRID+ M EK++E+N
Sbjct: 1250 IEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKN 1309

Query: 1311 KEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNI 1370
            +  KL+E+  L K+++VR TVNQ      +E+RPPALSL IEG+E+WSST + QVNSLN+
Sbjct: 1310 RTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNL 1369

Query: 1371 LSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQI 1430
             S+DIT+DE+Q+EWLF Y  +QG  IQ++  + ++IQ  +  S+ ELIS LTAASEYYQI
Sbjct: 1370 TSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQI 1429

Query: 1431 SHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAAT 1490
            SHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW S I+  L + K   +
Sbjct: 1430 SHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKK-YTS 1488

Query: 1491 TQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTV 1550
             +DAK IF+SVFS WRNWEFSD+ARSYIY KLF  ++   + +           SF++TV
Sbjct: 1489 AKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTV 1548

Query: 1551 YSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNL 1610
            Y  GYEVEHNF++   NL+++   P +    +RE    ITG +G+ KGK SD+++ +++L
Sbjct: 1549 YGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDL 1608

Query: 1611 LPSLK-ITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWES 1669
            +P +  + +  KS    +  K FK+NT++L ++ ELQ+ +  T+L+SR  G R+S+LWE+
Sbjct: 1609 IPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWEN 1668

Query: 1670 PKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSD 1729
             KD TSQA SL +++Q++E+ LKH +  L E Q+RDFS++ TTE+WS+KPTIL+N+QC+D
Sbjct: 1669 LKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCAD 1728

Query: 1730 LHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFT 1789
            LH  AM++T+ LV +I EI E++  I++ +    +++K ++        K+NT+L+C+F+
Sbjct: 1729 LHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQFVDQ----KINTVLSCYFS 1784

Query: 1790 NISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGD 1849
            N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNEILLS+WD D ++TSH TK+QY RFSFGD
Sbjct: 1785 NVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGD 1844

Query: 1850 LQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLD-LFG 1907
            +++KG +  + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I    +L  LF 
Sbjct: 1845 IEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFF 1904

Query: 1908 LSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD-IPNQ 1966
             S   K + +  +   +W++DT+I YFG+L P+ S YF+FEL MLL SLT   +  +P +
Sbjct: 1905 SSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEE 1964

Query: 1967 SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLS 2026
            + ++GQFS+EN+LF IKER+LP+ LSKLLDFSIKVS LQ+  +T  ++Q+ESSHFRVCLS
Sbjct: 1965 TKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLS 2024

Query: 2027 PESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFC 2086
            P+SL+RL+W  +++     YY   H  N W+ +       K+ ++P+N  S HILSY FC
Sbjct: 2025 PDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFC 2084

Query: 2087 VGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDK 2146
            +GW+F   + S PGL+LGYNRLFSAYEK+ GK T+VD FFS+ANGN+S  FFSEG EKDK
Sbjct: 2085 IGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDK 2144

Query: 2147 YNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKK 2206
            YNRS+LPNMQISYWFK  G ++D F RFHGEALDV F+ S++DVIES L S++ FQELKK
Sbjct: 2145 YNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKK 2204

Query: 2207 DLIPGLPKKQKVNDDK------TLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAET 2260
            +++      +  ND+           ++L+PFL NIRS++  FKYDGGVF++++ ED ET
Sbjct: 2205 NILDVSESLRAENDNSYASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIET 2264

Query: 2261 QSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQ 2320
            +SEPSFE+ SP V I+  YKH E++ K H  R+LI ++ THN LYA CAPLL +F E +Q
Sbjct: 2265 KSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQ 2324

Query: 2321 GMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGF 2380
             M+                QN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAKVQAD+GF
Sbjct: 2325 KMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGF 2384

Query: 2381 QSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVI 2440
            +SF+F++ TN+ D+ +PL FSL++E T+ASIKHIFSRE STS  V F+D+TL+FTHPDVI
Sbjct: 2385 ESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVI 2444

Query: 2441 NVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQLS 2499
            +++GT L+S++++FFNVKQLQNLYLFLDIWR S +L ++P    V  + + SSL+    +
Sbjct: 2445 SMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYA 2504

Query: 2500 DPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSL 2559
            D  + IPWCFTLIFTNV GDVDLGPSLG+IS++ +RTW ATDHY   R++LHAFTDG SL
Sbjct: 2505 DAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISL 2564

Query: 2560 SSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAI 2619
            +S+GRLSG+FE+  ASW+SEV WP + + N HPLVS ++NID+I+ KAAFDYHMFLIG I
Sbjct: 2565 TSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTI 2624

Query: 2620 NNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISY 2679
            +N   HLH+EKD  GV+PDLL+V+F  + I L STALV ANILDIYNT +RMRQDNKISY
Sbjct: 2625 SNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISY 2684

Query: 2680 IETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIES 2739
            +ETLR+SN  ES+ PI Y DILRSL LL+TD+SV+I +  +QISPI+LFDVEVLVI I+ 
Sbjct: 2685 METLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDK 2744

Query: 2740 ISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTI 2799
            +S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YASKIVGGTI
Sbjct: 2745 VSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTI 2804

Query: 2800 IEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRR 2859
            I+IPKL V MTT QEEK++ LEYL+ C F DK+SVRWNLGP++FIKEMWTTH++A+AVRR
Sbjct: 2805 IDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRR 2864

Query: 2860 SQVVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNR 2919
            SQV  +  GQ+              S+F Y+ALE P+I++PQIRDLGDATPPMEWFGVNR
Sbjct: 2865 SQVANISFGQTEEELEESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNR 2924

Query: 2920 KRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949
            K+FP FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2925 KKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 3436 bits (8909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1643/2972 (55%), Positives = 2164/2972 (72%), Gaps = 40/2972 (1%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M+A+SQ +GVPLT Q++FSW+FLV WILTV++ L+ IFY+GR  AY++TFILEWLLWK A
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
             +K+N+++LR+SLLGGRI FK++++IHKD TIS+LEG++TW+YWL N RK E  E + D 
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176
                    KN +LPC+F +  EGLEIF+YN+TVAYDN+I + SK+ER +FEK+LNE    
Sbjct: 121  LS------KNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFP 174

Query: 177  QILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDT-SSFLRFLPIQFLVT 235
            +  SD ++   +D+                   NDR +QE +      FL+FLPI+    
Sbjct: 175  ESFSDGSSADKLDED---LSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFN 231

Query: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295
            RGSL+LGNKFTPS++I+S ++ + ++D   PKE+LDLY+ K   E  N E ++KQNIG+D
Sbjct: 232  RGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYD 291

Query: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355
            + + +KFKLD GKVS++W  F R+L I+ KP+      ++    +D F  KW+GL+LYK 
Sbjct: 292  DAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKA 351

Query: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415
                 + +D+DDIEFDF NHEYAKF+SILK PK+T     D+ G VPHGAHPTI  +DGP
Sbjct: 352  APGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGP 411

Query: 416  DVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRI 475
            DVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRT+KPVK+L PG RRI
Sbjct: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRI 471

Query: 476  YTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTF 535
            YT  ++ V IM+D TWRIPTRE+SKD EFLQHY+ET+ EYRPFGW+DL+F K+T  N   
Sbjct: 472  YTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNV 531

Query: 536  ALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLN 595
             LCPTV+GF+NN  +H  E E RSSVNHDILLK K F+ D D  +PLGWN +A W IN+ 
Sbjct: 532  VLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMK 591

Query: 596  SSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIV 655
            S Q+EAF+LREHITL+ADTL+DFS+GEPTPYELFRPF+Y +NW+++GYS+YLNVNDHNIV
Sbjct: 592  SQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651

Query: 656  NNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXE 715
            NNPLDFNENCYLS HGD L +D  +P+ SI   +TDISY I TPMFR            E
Sbjct: 652  NNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNE 711

Query: 716  FMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMN 775
            FMKHKEVGR+YDF V GSYL+YS+LDIDNVDT++++CTS  T L CYGFV+RYL NVKMN
Sbjct: 712  FMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMN 771

Query: 776  YFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTELQ 835
            YFG+FF+FVTSEEYTG + A E   +                  Q +           ++
Sbjct: 772  YFGEFFNFVTSEEYTGVLGAREVG-EIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVK 830

Query: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895
            RSDLKRTTNETD+WFTF+VW GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYMD++A 
Sbjct: 831  RSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAV 890

Query: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955
            +N  SIKR+VSK  +E+F+ I +NNG     HG+LS LTIHGHRM+GLPP EPTYFCQWD
Sbjct: 891  LNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWD 950

Query: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015
             +LG L I SDIEF++GFF+SF +IGFGY DLENILLY+ ET DDMTS+TV+ E++ +  
Sbjct: 951  INLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISF 1010

Query: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075
             +P +   +     +L FT IDFENE+YS R+D+ IP L  SL     DG        ET
Sbjct: 1011 NDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFET 1070

Query: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXX 1135
            K++ TNF Q +D D+ R  QR YI  HD+PYHRC F+LP  YQD++ YQ+L+GAIA    
Sbjct: 1071 KLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSS 1130

Query: 1136 XXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVS-----DDETEED 1190
                       T DFIIED++GE+  LLET++PF+  F++     + S     +D+ +E 
Sbjct: 1131 IPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDER 1190

Query: 1191 IDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDD 1250
             DPLEF  P    +    +R               P +     + L  F +E++VQ++DD
Sbjct: 1191 ADPLEFK-PIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDD 1249

Query: 1251 IEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEEN 1310
            IEI  V +LSNL+EG   ++N+ ++I Y++L W    + G  +YLDRID+ M EK++E+N
Sbjct: 1250 IEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKN 1309

Query: 1311 KEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNI 1370
            +  KL+E+  L +I++VR TVNQ      +E+RPPALSL +EG+E+WSST + QVNSLN+
Sbjct: 1310 RTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNL 1369

Query: 1371 LSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQI 1430
             S+DIT+DE+Q+EWLF Y  +QG  IQ+ + +  +IQ  +I S+ ELIS LTAASEYYQI
Sbjct: 1370 TSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQI 1429

Query: 1431 SHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAAT 1490
            SHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW   I + L + K   +
Sbjct: 1430 SHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERK-YTS 1488

Query: 1491 TQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTV 1550
             +DAK IF+SVFS WRNWEFSD+ARSYIY KLF   ++  + +           SF++TV
Sbjct: 1489 AKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTV 1548

Query: 1551 YSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNL 1610
            Y  GYEVEHNF+I   NL+++   P +  SL+RE    ITG +G+ KGK SD+++ +++L
Sbjct: 1549 YGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDL 1608

Query: 1611 LPSLKITDGG-KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWES 1669
            +P +    GG KS    +  K FK+NT++L ++ E+Q+ +  T+L+SR  G R+S+LWE+
Sbjct: 1609 IPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWEN 1668

Query: 1670 PKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSD 1729
             KD TSQA SL +++Q++E+ LKH +  L E Q+RDFS++ TTE+WS+KPTIL+N+QC+D
Sbjct: 1669 LKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCAD 1728

Query: 1730 LHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFT 1789
            LH  AM+ T+  V  I EI E++ +I+  +    +++K     S    PK+N +L+C+F+
Sbjct: 1729 LHFRAMSTTEQTVTVITEIRESVLKIKDRIKFKPKSKK----RSQFVGPKINIVLSCYFS 1784

Query: 1790 NISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGD 1849
            N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNE+LLS+WD D ++TSH TK+QY RFSFGD
Sbjct: 1785 NVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGD 1844

Query: 1850 LQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGL 1908
            +++KG +  + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I    +L     
Sbjct: 1845 IEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLF 1904

Query: 1909 SKN--QKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD-IPN 1965
            +    +K K +      +W++DT+I YFG+L P+ S YF+FEL MLL SLT   +  +P 
Sbjct: 1905 TSGLPKKKKKKAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPE 1964

Query: 1966 QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCL 2025
            ++ ++GQFS+EN+LF IKER+LP+ LSKLLDFSIKVS LQ+  +T  ++Q+ESSHFRVCL
Sbjct: 1965 EAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCL 2024

Query: 2026 SPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNF 2085
            SP+SL+RL+W  +++     YY   H  N WD++       K  ++P+N  S HILSY F
Sbjct: 2025 SPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKF 2084

Query: 2086 CVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKD 2145
            C+GWLF   + S+PGL+LGYNRLFSAYEK+ GK T+VD FFS+ANGN S  FFSEG EKD
Sbjct: 2085 CIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKD 2144

Query: 2146 KYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELK 2205
            KYNRS+LPNMQISYWFK  G ++D F RFHGEALDV F+ S++DVI+S L SV+ FQELK
Sbjct: 2145 KYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELK 2204

Query: 2206 KDLIPGLPKKQKVNDDKTLEL-------NTLSPFLANIRSISCQFKYDGGVFKIFSLEDA 2258
            K+++  + +   + DD            N+L+PFL NIRS++  FKYDGGVF++++ +D 
Sbjct: 2205 KNIL-DVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDI 2263

Query: 2259 ETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFER 2318
            E +SEPSFE+ SP V I+  YKH EN  K H IR LI ++ T N LYA CAPLL +F E 
Sbjct: 2264 EAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSES 2323

Query: 2319 IQGMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADI 2378
            +Q M+                QN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAKVQAD+
Sbjct: 2324 LQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADV 2383

Query: 2379 GFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPD 2438
            GF+SF+F++TTN+ D+ +PL FSL++++T+ASI+HIFSRE STS  V F+D+TL+FTHPD
Sbjct: 2384 GFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPD 2443

Query: 2439 VINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQ 2497
            VI+++GT+L+S++++FFNVKQLQNLYLFLDIWR S +L ++P    +  + D SSL+   
Sbjct: 2444 VISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTN 2503

Query: 2498 LSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGT 2557
              D  + IPWCFTLIFTNV GDVDLGPSLGVIS++ +RTW ATDHY   R++LHAFTDG 
Sbjct: 2504 YVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGV 2563

Query: 2558 SLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIG 2617
            SL+S+GRLSG+FE+  ASWISEV W  + + N+HPLVS ++NID+++ KAAFDYHMFLIG
Sbjct: 2564 SLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIG 2623

Query: 2618 AINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKI 2677
             INN +  LH+EKD  G++PDLL+V+F  + ITL STALVAANILDIYNT +RMRQDNKI
Sbjct: 2624 TINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKI 2683

Query: 2678 SYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITI 2737
            SY+ETLR+SN  ESK PI Y DILRSL LL+TD+S++I +L +QISPI+LFDVEVLV+ I
Sbjct: 2684 SYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRI 2743

Query: 2738 ESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGG 2797
            +++S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YASKIVGG
Sbjct: 2744 KNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGG 2803

Query: 2798 TIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAV 2857
            TII+IPKL V MTT QEEK++ +EYL+ C F DK+SV+WNLGP+NFIKEMWTTH++A+AV
Sbjct: 2804 TIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAV 2863

Query: 2858 RRSQVVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGV 2917
            R+SQ+  V  GQ+              S+F Y+ALE P+I +PQIRDLGDATPPMEWFGV
Sbjct: 2864 RQSQIANVSFGQTEEELEESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGV 2923

Query: 2918 NRKRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949
            NRKRFP FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2924 NRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3432 bits (8900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1632/2971 (54%), Positives = 2164/2971 (72%), Gaps = 39/2971 (1%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M+AVSQ +GVPLT Q++FSW+FLV WILT++  L+ +FY+GR  AY+++FILEWLLWK A
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            KVK+N+++LR+SLLGGRI FK++++IHKD TISILEG+ITW+YWL N RK E  +     
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELID----- 115

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176
               K  S  N +LPC+F +  EGLEIF+YN+TVAYDN+I + SK+ER +FEK+LNE    
Sbjct: 116  -NNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFP 174

Query: 177  QILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDT-SSFLRFLPIQFLVT 235
            +  SD ++   +D+                   NDR +QE +      FL+FLPI+   +
Sbjct: 175  EPFSDGSSADKLDED---LSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFS 231

Query: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295
            RGSL+LGNKFTPS++I+S +S + ++D   PKE++DLY+ K   E  N E ++KQNIG+D
Sbjct: 232  RGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYD 291

Query: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355
            + + +KFKLD GKVS++W  F R+L ++ KP+      +      D F  KW+GL+LYK 
Sbjct: 292  DAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKA 351

Query: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415
            T    + ND+DDIEFD  NHEYAKF+SILK PKVT +   D+PG+VPHGAHPTIS +DGP
Sbjct: 352  TSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGP 411

Query: 416  DVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRI 475
            DVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRTAKP+K+L PG RR+
Sbjct: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRV 471

Query: 476  YTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTF 535
            YT  ++ ++I +D TWRIPTRE+SKD EFLQHY+ET+ EYRPFGW+DL+F K+T  N   
Sbjct: 472  YTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNI 531

Query: 536  ALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLN 595
            ++CPTV+GF+NN  +H  E E RSSVNHDILLK K F+ D D  +PLGWN +A W IN+ 
Sbjct: 532  SVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMK 591

Query: 596  SSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIV 655
            S Q+EAF+LREHITL+ADTL+DFS+G+PTPYELFRPF+Y +NW+++GYS+YLNVNDHNIV
Sbjct: 592  SEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651

Query: 656  NNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXE 715
            NNPLDFNENCYLS HGD+L++D  +P+ SI   +TDISY I TPMFR            E
Sbjct: 652  NNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNE 711

Query: 716  FMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMN 775
            FMKHKEVGR+YDF + G+YL+YS+LDIDNVDT++++CTS  T L CYGFV+RYL NVKMN
Sbjct: 712  FMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMN 771

Query: 776  YFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTELQ 835
            YFG+FF+FVTSEEYTG + A  D                     Q +           ++
Sbjct: 772  YFGEFFNFVTSEEYTGVLGA-RDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMK 830

Query: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895
            RSDLKRTTNETD+WFTF+VW GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYMD++A 
Sbjct: 831  RSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAV 890

Query: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955
            ++  SIKR+VSK  +E+F+ I +NNG +   HGSLS LTIHGHRMYGLPP EPTYFCQWD
Sbjct: 891  LDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWD 950

Query: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015
             +LG L I SD+EF++GFFSSF +IGFGY DLENILLY+ ET DDMTS+TV+ E++ + L
Sbjct: 951  INLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISL 1010

Query: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075
            ++P +   +     ++ FT IDFENE YS R+D+ +P L+ SL     DG        ET
Sbjct: 1011 EDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFET 1070

Query: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXX 1135
            K++ TNF Q +D D+ R  QR+YI  HD+PYHRCSF+LP  YQD++ YQ+L+GAIA    
Sbjct: 1071 KLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSS 1130

Query: 1136 XXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVS-----DDETEED 1190
                       T DFIIED++GE+  LLE ++PF+  F++     + S     +D+ +E+
Sbjct: 1131 IPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEE 1190

Query: 1191 IDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDD 1250
                 F  P    ++   E+               P +     + L    +EN+VQ++DD
Sbjct: 1191 ASSSGFK-PGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDD 1249

Query: 1251 IEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEEN 1310
            IEI  V RLSNL+EG   ++N+ I+I YL+L W    + G  +YLDRID+ M EK++E+N
Sbjct: 1250 IEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKN 1309

Query: 1311 KEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNI 1370
            +  KL+E+  L ++++VR TVNQ      +E+RPPALSL +EG+EIWSST   QVNSLN+
Sbjct: 1310 RTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNL 1369

Query: 1371 LSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQI 1430
             S+DIT+DE+Q+EWLF Y  +Q   +Q++  +  +IQ  +  S+ ELIS LTAASEYYQI
Sbjct: 1370 TSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQI 1429

Query: 1431 SHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAAT 1490
            SHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW + I++ L + K   +
Sbjct: 1430 SHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERK-YTS 1488

Query: 1491 TQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTV 1550
              DAK IF+SVFS WRNWEFSD+ARSYIY KLF   +   + +           SF++TV
Sbjct: 1489 ANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTV 1548

Query: 1551 YSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNL 1610
            Y  GYEVEHNF++   NL+++   P +  SL+RE    ITG +G+ KGK SD+++ +++L
Sbjct: 1549 YGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDL 1608

Query: 1611 LPSL-KITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWES 1669
            +P +  + +  KS    +  K F++NT++L ++ ELQ+ +  T+L+SR  G R+S+LWE+
Sbjct: 1609 IPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWEN 1668

Query: 1670 PKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSD 1729
             KD TSQA S+ +++Q++E+ LKH +  L E Q+RDFS++ TTE+WS+KPTIL+N+QC+D
Sbjct: 1669 LKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCAD 1728

Query: 1730 LHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFT 1789
            LH  AM++T+  V +I EI E+  +I++ +    +++K ++        K+NT+LTC+F+
Sbjct: 1729 LHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQFVGQ----KINTVLTCYFS 1784

Query: 1790 NISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGD 1849
            N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNEIL+S+WD D ++TSH TK+QY RFSFGD
Sbjct: 1785 NVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGD 1844

Query: 1850 LQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITL-DLFG 1907
            +++KG +  + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I    +L  LF 
Sbjct: 1845 IEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFF 1904

Query: 1908 LSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD-IPNQ 1966
             S   K + +      +W++DT+I+YFG+L P+ S YF+FEL MLL SLT   +  +P +
Sbjct: 1905 SSNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEE 1964

Query: 1967 SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLS 2026
            + ++GQFS+EN+LF IKER+LP+ LSK+LDFSIKVS LQ+  +T  ++Q+ESSHFRVCLS
Sbjct: 1965 TKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLS 2024

Query: 2027 PESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFC 2086
            P+SL+RL+W  +++     YY  HH  N W+++       K  ++PLN  S HILSY FC
Sbjct: 2025 PDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFC 2084

Query: 2087 VGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDK 2146
            +GWLF   + S+PGL+LGYNRLFSAYE++ GK T+VD FFS+ANGN+S  FFSEG EKDK
Sbjct: 2085 IGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDK 2144

Query: 2147 YNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKK 2206
            YNRS+LPNMQISYWFK  G ++D F RFHGEALDV F+ S++DVI+S L S++ FQELK+
Sbjct: 2145 YNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKR 2204

Query: 2207 DLIPGLPKKQKVNDDKTLEL-------NTLSPFLANIRSISCQFKYDGGVFKIFSLEDAE 2259
            +++  + +     D             ++L+PFL NIRS++  FKYDGGVF++++ ED E
Sbjct: 2205 NIL-DVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIE 2263

Query: 2260 TQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERI 2319
             +SEPSFE+ SP V I+  YKH E++ + H IR+LI ++ THN LYA CAPLL +F E +
Sbjct: 2264 AKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESL 2323

Query: 2320 QGMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIG 2379
            Q M+                QN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAKVQAD+G
Sbjct: 2324 QKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVG 2383

Query: 2380 FQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDV 2439
            F+SF+F+VTTN+ D+  PL FSL++E T+ASIKHIFSRE STS  V F+D+T++FTHPDV
Sbjct: 2384 FESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDV 2443

Query: 2440 INVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQL 2498
            I+++G  L+S++N+FFNVKQLQNLYLFLDIWR S +L ++PA   V    D  SL+    
Sbjct: 2444 ISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSH 2503

Query: 2499 SDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTS 2558
             D  + IPWCFTLIFTNV GDVDLGPSLGVIS++ +RTW ATDHY   R++LHAFTDG S
Sbjct: 2504 VDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGIS 2563

Query: 2559 LSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGA 2618
            L+S+GRLSG+FE+  ASW+SEV W  +   N HPLVS ++NID+++ KAAFDYHMFLIG 
Sbjct: 2564 LTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGT 2623

Query: 2619 INNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKIS 2678
            INN    LH+EKD  GV+PDLL+V+F  + I L STALVAANILDIYNT +RMRQDNKIS
Sbjct: 2624 INNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKIS 2683

Query: 2679 YIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIE 2738
            Y+ETLR+SN  ES+ P+ Y DILRSL LL+TD+SV I +L +QISPI+LFDVEVLV+ I+
Sbjct: 2684 YMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRID 2743

Query: 2739 SISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGT 2798
             +S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YASKIVGGT
Sbjct: 2744 KVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGT 2803

Query: 2799 IIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVR 2858
            II+IPKL V MTT QEEK++ LEYL+ C F DK+SVRWNLGP+NFIKEMWTTH++A+AVR
Sbjct: 2804 IIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVR 2863

Query: 2859 RSQVVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVN 2918
            RSQ+  +  GQ+              S+F Y+ALE P+I++PQIRDLGDATPPMEWFGVN
Sbjct: 2864 RSQIANISFGQTEEELEESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVN 2923

Query: 2919 RKRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949
            RKRFP FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2924 RKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3307 bits (8574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1605/3002 (53%), Positives = 2132/3002 (71%), Gaps = 71/3002 (2%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M + S+FQ VP++  +NFSW+FL+ WIL V+L LS IFY+GR IAYI + ILEWLLWK A
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
             +KVNI+SLRISLLGGRIFFKNVTIIHKD TIS+L+G +TWRYWL  TRKP +   S D 
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180
                 T  KN QLPCRFV++ EG EIF+YN+T +YDNII +FSKEER +F+KFL+EQI +
Sbjct: 121  NGV--TMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFN 178

Query: 181  D-------------SATVKSMDDSQFXX---XXXXXXXXXXXXATNDRVFQEEETDTSS- 223
            D             S+T +S  D++                    NDR+F + ++D  S 
Sbjct: 179  DHSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSL 238

Query: 224  FLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELIN 283
            FL+  P++  V R SL  GNKFTPSL+I+S++    ++D+ QPKEKLDLYK KL+ E  N
Sbjct: 239  FLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHN 298

Query: 284  TEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKF 343
               T+K NIG+ E++ +KFK+DRGK+S +W  FT + GI+ +PL  T   +++NE  D F
Sbjct: 299  FAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLF 358

Query: 344  QAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPH 403
              KW+GL+LYKGT      +D+DDI+FDF NHEYAKFSS++K PK  FT ++D+PG VPH
Sbjct: 359  IQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPH 418

Query: 404  GAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAK 463
            GAHPT S +DGPDVGN+GAPP +SLDIQIFGGS+C+GPW QRQ + +  +L+P VSRT  
Sbjct: 419  GAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTES 478

Query: 464  PVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDL 523
            PVKR  PG  RIYT  ++ ++IMDD TWRI TRE SKD  FL+HY+ETN +YRPFGWIDL
Sbjct: 479  PVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDL 538

Query: 524  KFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLG 583
            +FSKE+    TFAL PT +GFKN+I IHL +NE RSSVNHDIL+KCK+FDFDID S+PL 
Sbjct: 539  RFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLV 598

Query: 584  WNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGY 643
            WND ATWTI++NS+Q+E F+LREHITLIADTLTDF+SGEPTPYELFRP    INWK+D Y
Sbjct: 599  WNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAY 658

Query: 644  SLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRX 703
             +YLNVNDHNIVNNPLDFNENCYLS HGD+L ++  IP   ITA+  +I+Y I TPMFR 
Sbjct: 659  FIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRL 718

Query: 704  XXXXXXXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYG 763
                       EFMK+KEVGRSYDF   GSYL+YS+LD+DNVDTI + C S+GTTLQCYG
Sbjct: 719  LLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYG 778

Query: 764  FVVRYLINVKMNYFGDFFHFVTSEEYTGAIR----------ANEDDMQYAXXXXXXXXXX 813
            FV+RYL NVKMNYFGDFF+F+TSEEYTG  R          +N  D +            
Sbjct: 779  FVIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESG 838

Query: 814  XXXXTMQGNDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVG 873
                  Q  + P R    T L+RSDL+RT NETDL+ TF+VW+GA++LPETIYNCD C  
Sbjct: 839  MDDAISQ--EIPER----TTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTA 892

Query: 874  LHFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSL 933
            L FGEL+IDLRS NYYMDLLA++ D  ++RY  K P +IF+++  +N E     G LS L
Sbjct: 893  LKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDL 952

Query: 934  TIHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLY 993
            +IHGHRM+GLPP EPTYFC+WDFD+G L++ S+ +FL+GF +SF+RIGFG+ DLENILLY
Sbjct: 953  SIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLY 1012

Query: 994  EKETYDDMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPT 1053
             KE  +DMTS+TVN +++SV L+     +  +    ++ FT IDFE+  YS+RLDLIIP+
Sbjct: 1013 SKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPS 1072

Query: 1054 LEFSLFIKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFIL 1113
            L+ S++  + DG   +LF   TKV +T+F Q ++F  HR  QR YI L+DA +HR SF+L
Sbjct: 1073 LKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLL 1132

Query: 1114 PQEYQDAEQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPF 1173
            PQ +Q  E Y EL+G+I                T DFI+ED LGE+  LL+  + FRMPF
Sbjct: 1133 PQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPF 1192

Query: 1174 SDQDYATDVSDDETEEDIDPLEF-NTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSI 1232
               +     S    EED+DPLEF N+     +N +C+                 +I  SI
Sbjct: 1193 GSTNTPNQASTHH-EEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISV------EINPSI 1245

Query: 1233 GTFLMLFST----ENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTD 1288
             T++   S+    ENIVQ+IDDIEI T+  LS  +EG   +TN+K+ +LY D++WG R  
Sbjct: 1246 STYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDR 1305

Query: 1289 TGVGIYLDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALS 1348
             G+ +YLD++DF M ++ +E+++EK L+E+T+L K RS+R ++++  +    +ERPPALS
Sbjct: 1306 YGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALS 1365

Query: 1349 LVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQK 1408
            LV+EG E+WS+T E QVNS++ +STDIT+DE+QLEWLF + + Q   +Q++I T +++Q 
Sbjct: 1366 LVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQA 1425

Query: 1409 RKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILT 1468
                SR++LIS LTAA+++YQISHDPYVITKPAFITRLS+GHVRENRSWKIITRLRHILT
Sbjct: 1426 EHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILT 1485

Query: 1469 YLPEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHS 1528
            Y+P DW S +   L + K+     +AK +F+SVFSNWRNWEFSD+ARSYIY +LFL   +
Sbjct: 1486 YIPSDWESGVENYLKE-KSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQA 1544

Query: 1529 NQEIHXXXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFN 1588
             +             +SFF+T Y+AGY+++ NF++T  N++ E   P +++ +SRE + N
Sbjct: 1545 EKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLIN 1604

Query: 1589 ITGTLGTAKGKLSDKIIMIKNLLPSL----KITDGGKSKETFDFVKSFKLNTLILCERGE 1644
            +TG++G+ KG  SD+++ +K L+P L    +  +   S +  +  KSFKLN L+L E+ E
Sbjct: 1605 LTGSIGSVKGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTE 1664

Query: 1645 LQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIR 1704
            +Q+ IG ++L +R+   ++S+L + PK+  S A S+ +Y +R+E  + H N TL E Q+R
Sbjct: 1665 VQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVR 1724

Query: 1705 DFSLIVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTR 1764
            DFSL  T ESWS KPT+LV++QC+  H+ +M  T  LV S+KE+++ +  I++ L   + 
Sbjct: 1725 DFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQL---SI 1781

Query: 1765 AEKITKVESHGPKPKVNTI---LTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNE 1821
            ++++ + E+  PK K+  +   + C  +N+SFE+MPISPF+IRHE K+ D+ F +FGS  
Sbjct: 1782 SDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQN 1841

Query: 1822 ILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYHI-NLYLSASILKLTVSDVQ 1880
            +++ VWD D +L S LTKQQYFR SFGD Q+  N++   + I +  +SAS++KLT S+  
Sbjct: 1842 VMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPN 1901

Query: 1881 KLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPI 1940
            +++ SFLQDE+  +ES +    L  F L + +         +  W +DT+I YFG+L PI
Sbjct: 1902 RILSSFLQDERTASESFKLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPI 1961

Query: 1941 GSAYFLFELRMLLASLTKMGSDIPNQSD-ISGQFSVENVLFFIKERALPVRLSKLLDFSI 1999
             + YF+FE   L+ S++ + ++   + D    Q S+ENV+F IK+R +P  LS++LDFSI
Sbjct: 1962 STTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSI 2021

Query: 2000 KVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLR 2059
              S +QK      ++Q+ES+HFR+ LSP SLVRL+W   Q      YYK+    + WD++
Sbjct: 2022 SFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIK 2081

Query: 2060 SKLNNIPK--APDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLG 2117
            +      K  +  + +N+ SFH+LSYNFC+GW+F   + S PG++LG++RLFSAYE   G
Sbjct: 2082 ASKLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYG 2141

Query: 2118 KLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGE 2177
            KLTLVD FFS+A G +S  F+    E +  NRSYLPNMQI+YW K +G M+D+F+RFHGE
Sbjct: 2142 KLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGE 2201

Query: 2178 ALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNTLSPFLANIR 2237
            ALDV+FL++++ VIES L S Q FQELK  LI   P      ++   ++ +L+PFL+NI+
Sbjct: 2202 ALDVSFLTTFITVIESMLQSFQVFQELKTSLIQ--PNTSTTENNTEPKIKSLAPFLSNIK 2259

Query: 2238 SISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKI 2297
            S++CQFKYDGGVFK+FS ED E+  EPSFE+ +P V+ID NYKH     K HWIR+L+ I
Sbjct: 2260 SVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAI 2319

Query: 2298 NSTHNILYAKCAPLLSDFFERIQGMVXXXXXXX-----XXXXXXXXXQNLDYKRLLDSFD 2352
             STHN L+A CAPL+++F E I  MV                     QN+DYKRLLD FD
Sbjct: 2320 GSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFD 2379

Query: 2353 IALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIK 2412
            IA K+TS++Q+LSLSCEPKAKVQAD+GF SFI  + TN+LD  EPL+FSLS++KT+ASIK
Sbjct: 2380 IAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIK 2439

Query: 2413 HIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRL 2472
            HIFS+ETSTS G+D +D+  MFTHPD+IN++GT LIS ++L+FNVKQLQNLYLF+DIW+L
Sbjct: 2440 HIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKL 2499

Query: 2473 SDLLKSKPANDIVKAKTDSS-LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISV 2531
            S  ++  P       K ++  L++ Q S+    IPW FTLIFTN+ G  DLGPSLGV+S+
Sbjct: 2500 SSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSL 2559

Query: 2532 QLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAH 2591
            +LKRTW A+DHY++ R+V+ AFTD  S  SKGRLSGIFEL GASW+SEV+WP +   + +
Sbjct: 2560 KLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNY 2619

Query: 2592 PLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITL 2651
            PLV++++NID +S KAAFDYHMFLIG I+  +  LHSEKD+ G MPDLLKV F CE I +
Sbjct: 2620 PLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINI 2679

Query: 2652 CSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKP-PINYTDILRSLNLLQTD 2710
            CSTALVAANILD+YNT MRMRQDNKI Y+ETLRES+  E++  P NY DILRSLNLLQTD
Sbjct: 2680 CSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTD 2739

Query: 2711 VSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTS 2770
            VS +I+ L +Q+SPI LFD+EVLVI IE+ISAR+ T +G+KL T LE++VYD  V+LSTS
Sbjct: 2740 VSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTS 2799

Query: 2771 KEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDD 2830
            K E+DE TVS ISV +Y++YASKI GGTIIE+PKL ++MT++QEE SDILEYLY C F+D
Sbjct: 2800 KREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFED 2859

Query: 2831 KLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXXXXXXXXXXXXNFSRFKYV 2890
            K++V+WNLGP+NFIKEMWTTH++A+AVRRSQ V   D Q+            N S+ KYV
Sbjct: 2860 KIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYV 2919

Query: 2891 ALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950
             +E PRIDMPQIRDLGDATPP+EWFGVNRKR PAFTHQT V  VQKLV++AE++YA++L 
Sbjct: 2920 PIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLD 2979

Query: 2951 SS 2952
            +S
Sbjct: 2980 NS 2981

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3096 bits (8027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1534/3020 (50%), Positives = 2058/3020 (68%), Gaps = 94/3020 (3%)

Query: 2    DAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAK 61
            D VSQF  + L + ++FSW+FLV WILT+ILS++ +FY+GR IA+ I+FI EWLLWK  +
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   VKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDET 121
            +KVNI+SLR+SLLGGRIFFKN+TII KD TIS L G I+WRYWLF  R P+F      E 
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 122  QTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSD 181
                +  +N +L CR ++  EG+E+FLYN+TVAYDN I+MFSKEER +FE+FLNE + +D
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 182  SATV-----------KSMDDSQFXXXXXXX-XXXXXXXATNDRVFQEEETDTSSFLRFLP 229
             A+            K+ D+ +                  NDR+F +EET  + FL +LP
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNYLP 242

Query: 230  IQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLK 289
            +Q  V+  S ++GNKFTPSLLIVSADSA+ +MD+ QPKEKLD+YK KL+ +  N   +LK
Sbjct: 243  LQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLK 302

Query: 290  QNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRG 349
            QNIG++E+V +KFKL  GK+S++W++F +    + KPL  +   + +      F  KWRG
Sbjct: 303  QNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWRG 362

Query: 350  LALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTI 409
            L+LYK     + +ND+DDIEFD A HEYAKF+SI+K P+   T + D+PG VPHGAHPT+
Sbjct: 363  LSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPTL 422

Query: 410  SVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLT 469
            S +DGPD+GN+GAPP + L+IQ+FGGS+C+GPWAQRQ   +  LL+P +SR  KPVK L 
Sbjct: 423  SSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPLQ 482

Query: 470  PGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKET 529
            PG RR+YT  ++ + + +D TWRIPTRESSKD EFL+HY+ TN +YRPFGW+DLKFSK++
Sbjct: 483  PGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKDS 542

Query: 530  TVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEAT 589
              +  FALC T DG +N +KIHL ++E RSSVNHDI +K K  DFD++  FPLGWN++A 
Sbjct: 543  YASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKAK 602

Query: 590  WTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNV 649
            WTIN+ SSQ+E F+LREHITLIADT++DFS+GEPTPYELFRPF+Y+INWK+DGYS+YLNV
Sbjct: 603  WTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLNV 662

Query: 650  NDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXX 709
            NDHNIVNNPLDFNENCYLSFHGD L++D  +PK  I AR TDISY I TPMFR       
Sbjct: 663  NDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAPP 722

Query: 710  XXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYL 769
                 EFMKHKEVGR+YDF+  G+YLIY++LD+DNVD I + C+SK T L CYGFV+RYL
Sbjct: 723  WNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRYL 782

Query: 770  INVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRR 829
            +N+KMNYFGDFFHFVTSEEYT  I +      Y                +   D      
Sbjct: 783  MNIKMNYFGDFFHFVTSEEYTEKISSK----GYGEGSLFEKYSDDASTFVSDFDKNNEED 838

Query: 830  LHTELQR--SDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCN 887
               ++ R  +D++R TNETDLW TF +WEGALLLPETIYNCDPC+ LHFGEL ID+RS N
Sbjct: 839  DKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTN 898

Query: 888  YYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPME 947
            YYMDLLA+++D+ +++Y +  P+EIFE + + NG +   H  +S++ IHGHRMYGLPP E
Sbjct: 899  YYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTE 958

Query: 948  PTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVN 1007
            PTYFC+WDFDLGT+ + S+++F++G  +SF +IGFG+ DLEN+LLYEKE  DDMT+VTVN
Sbjct: 959  PTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVN 1018

Query: 1008 LEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTT 1067
            ++   +++  P+L+  A   LNN+ F  IDFENEKYSTR+D+ IP L+ SL+    + + 
Sbjct: 1019 VKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASK 1078

Query: 1068 K-KLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQEL 1126
            +   F  ETK+  TNF   ++  +HR  QR+YI ++DAP+HRC FILP  YQ++  YQ+L
Sbjct: 1079 ELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKL 1138

Query: 1127 FGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSP---FRMPFSDQDYATDVS 1183
            +G+I                T +FII+D L E+     T+S      +P+ D   +T+++
Sbjct: 1139 YGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYN----TTSDCIILNLPYPD---STNLN 1191

Query: 1184 DDETEEDIDPLEFNTPSEAIQNDKC---ERXXXXXXXXXXXXXXCPDILDSIGTFLMLFS 1240
             D      D          I+       ER               P++   I   L  F 
Sbjct: 1192 SDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFY 1251

Query: 1241 TENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDF 1300
             ++  Q+ID IEI  V RLSN +EG   + N KI IL+ D+FWG R   G+ +YLD +DF
Sbjct: 1252 GDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDF 1311

Query: 1301 AMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSST 1360
             M EK++E+N+EK L E+T L K+ S+R +VN   +  K E +PPALSL++EG + WS+T
Sbjct: 1312 EMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTT 1371

Query: 1361 VEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISS 1420
             +  +NS+ + S D T+DE Q+ WLF +F +Q   I  ++KT + +QK + +SRKELIS 
Sbjct: 1372 AKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISR 1431

Query: 1421 LTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINR 1480
            LT ASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHI+TYLP+DW+ T+ +
Sbjct: 1432 LTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAK 1491

Query: 1481 SLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXX 1540
             L + K  A+ +DAK IF+SVFS+WRNWEFSD+ARSYIY K+FL   + ++         
Sbjct: 1492 QLKERKYNAS-KDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWK 1550

Query: 1541 XXXASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKL 1600
                S ++TVY+AG  V+H+FI+T++NL+ E    T++S  ++E + N+TG LG+ KGK+
Sbjct: 1551 AAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKI 1610

Query: 1601 SDKIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFG 1660
            SDK+  + NL+  ++  +    K    F +SFKLN  +L +  +L    G T L + +  
Sbjct: 1611 SDKMFKLHNLMNLVQQQEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGETSLTNTIHS 1670

Query: 1661 ARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPT 1720
             + S LWE+PK  T +  SL +Y +R E  +KH N+ L E QI   +L    +S    P+
Sbjct: 1671 GKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHPS 1730

Query: 1721 ILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKP-K 1779
            I+ N QC D++L  M  T+++V  ++E +   + +++        +     +S  P P K
Sbjct: 1731 IVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTK 1790

Query: 1780 VNTIL------TCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYL 1833
            +N  L      TCFF+N+S ++MPI PF  R E K+++  F+   +     ++WD+D+YL
Sbjct: 1791 INPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYL 1850

Query: 1834 TSHLTKQQYFRFSFGDLQL---KGNMVNDPYHINLYLSASILKLTVSDVQKLIPSFLQDE 1890
             SHLTKQQYFR S G++ +    G +VN  +  NL +SASI+KLT S+  +++ SFLQDE
Sbjct: 1851 GSHLTKQQYFRLSLGNIIVGYTNGRLVNTIH--NLDVSASIVKLTFSEPHRMLFSFLQDE 1908

Query: 1891 KILTESIEDFITL-DLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFEL 1949
            + ++ S++    L +LF       + P     K  W ++ +I Y G+L P+ + +F+FE+
Sbjct: 1909 REVSRSVKKLQVLGNLFSSEPEINTIPA--GAKIDWRLNADIKYLGILIPVSTTFFVFEM 1966

Query: 1950 RMLLASLTKM--GSDIPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKK 2007
              LLASL  +  G       + SGQ SV+N+LF IK+R +P  LS+++D S K+SA+QK 
Sbjct: 1967 HTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKI 2026

Query: 2008 KNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPK 2067
              + ++YQIES H R C SP SLVR+LW  +Q+     +Y+ HH  N WD   K     +
Sbjct: 2027 MESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVE 2086

Query: 2068 APDLP-----LNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLV 2122
                      L   S HILSYNFCVGWLF  +  ++ GLILGYNRLFSAYEK  GKLTLV
Sbjct: 2087 EDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLV 2146

Query: 2123 DVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVT 2182
            D FFS++NG +SD F+S+G E+DKYNRS+LPN+QI YW K A  M+D+F+R HGE LDV 
Sbjct: 2147 DAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVN 2206

Query: 2183 FLSSYLDVIESALTSVQTFQELKKDLIPGL-----------------------PKKQKVN 2219
            FLSS++ +IE+ L S+Q FQELKK L+  L                       P K+K  
Sbjct: 2207 FLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKE 2266

Query: 2220 DDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNY 2279
            D    ++   +PFL++IR ++CQFKYDGG+FK++S ED E+  +PSFE+ SP V IDL+Y
Sbjct: 2267 DAPRKDI---APFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDY 2323

Query: 2280 KHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXX---XXXXX 2336
            K+     K H IR+LI +NSTHN+L+A+CAPLL    + IQ MV                
Sbjct: 2324 KNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVS 2383

Query: 2337 XXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAE 2396
               QN+DYKRLL+SFDI  KI S++Q+LSLSCEPKAKVQA++GF SF+F + TNDLD +E
Sbjct: 2384 RPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSE 2443

Query: 2397 PLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFN 2456
            PLSF+L V+ T ++I+HIFSRE S S G+D +DVT MFTHP++IN+ G  LIS++ ++FN
Sbjct: 2444 PLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFN 2503

Query: 2457 VKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSI-AQLSDP---ESIIPWCFTLI 2512
            VKQLQNLYLFLDIW+LS+LL+ KP    +K   D  ++I A  S P    +IIPWCFTLI
Sbjct: 2504 VKQLQNLYLFLDIWKLSNLLRPKP----MKKPEDHHVAIDAPPSSPMDVGNIIPWCFTLI 2559

Query: 2513 FTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELK 2572
            F N+ G VDLGPSLG++S+ +++ WFA+DHY++ R++LHA+ D   L++KGRLSGI EL 
Sbjct: 2560 FANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELD 2619

Query: 2573 GASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDV 2632
            GA W +EVNWP     + +PLV+++  I  IS K AFDYHMFLIG + NT  HLHSE+D 
Sbjct: 2620 GALWAAEVNWPKYD--DPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDT 2677

Query: 2633 NGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESK 2692
            +G MPDLLKV   CE I +CSTALVAAN+LD+YNT MRMRQD  +SY+ETLRESN  ++K
Sbjct: 2678 SGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTK 2737

Query: 2693 PPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKL 2752
              ++Y DIL+ LNL+QTDV VDI TLN+QISPI+LFDVEVLV+ I ++ A  +TH+G+KL
Sbjct: 2738 ETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKL 2797

Query: 2753 MTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTF 2812
             T L +Q+Y+A  SLS+SK EMDE  VSKISV++Y+ YASKIVGGTI +IPKL +SM TF
Sbjct: 2798 ETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTF 2857

Query: 2813 QEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXX 2872
            Q+  SDILEY Y   F DK++VRWNLGP+NFIKEMWTTHI+A+AVRRSQ +    G    
Sbjct: 2858 QKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEG 2917

Query: 2873 XXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVF 2932
                        S+  Y+A+E P+ID PQI+DLGDATP +EWFG+NRK+FP FTHQT + 
Sbjct: 2918 DVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIV 2977

Query: 2933 LVQKLVYSAEREYANILGSS 2952
             VQKL++SAE+EYANI+G S
Sbjct: 2978 PVQKLIHSAEKEYANIVGHS 2997

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 3027 bits (7848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1506/2998 (50%), Positives = 2060/2998 (68%), Gaps = 79/2998 (2%)

Query: 7    FQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKVNI 66
            F+G  L  +RNFSW+FLV WILTVIL+L+ +FYL R  AY +TFILEWLLWK AKVKV+I
Sbjct: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 67   QSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEA---------- 116
             +LRISLL GR+FFKN+TII KD TI+ILEG+ITWRYWL  TRK E++ A          
Sbjct: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 117  --SVDETQTKPTSI--KNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEK 172
              S D+T+    +   K  +LPCRF+   EG E+F+YN+T AYDNI+ + SK ER +FEK
Sbjct: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189

Query: 173  FLNE--------------QILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEE 218
            F+ E              +I   S+   S D+                   NDR FQ + 
Sbjct: 190  FMAENDFLDPSSDGSSDDKIEETSSATNSTDEETI---------------ANDRTFQNDT 234

Query: 219  TDT-SSFLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKL 277
              T   +L  LPI+ L+ +GS+++GNKFTP +LI+S +SA AL D  +   KLDLY+ K 
Sbjct: 235  RKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKY 294

Query: 278  SAELINTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKN 337
               L N E  +KQNI +D + S  F+ D+GK+S +W+ FTR+  ++  P +    +RRK 
Sbjct: 295  EVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFK---SNRRKE 351

Query: 338  EHEDKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDM 397
            +  D F  KW+GL++Y+    GE  ++ DDIEFD ++HEYAKF+S+LKSP+VT    +DM
Sbjct: 352  QPHDNFMQKWKGLSMYRNDMFGEF-DEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDM 410

Query: 398  PGIVPHGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPV 457
            PG VPHGAHP  S  DGPDVGN+ APP Y  +I IFGG+VC+GPWAQRQ +HL  LLSP 
Sbjct: 411  PGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPS 470

Query: 458  VSRTAKPVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRP 517
            VSRTAKP+K+L PG +RIYT  ++ +  M+D TWRIPTRESSKD EFL HY+ETN +YRP
Sbjct: 471  VSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRP 530

Query: 518  FGWIDLKFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDID 577
            FGWID+K S+++      A+CPT  GFKN I + L + E RSSVNHDI LK K F F+ D
Sbjct: 531  FGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCD 590

Query: 578  TSFPLGWNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSIN 637
              +PLGWN EA WTI ++S+Q+E F+LREH+TLIADTLTDFSSGEP PYELFRPF+Y I 
Sbjct: 591  IGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIK 650

Query: 638  WKIDGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIK 697
            W + GYS YLNVNDHNIVNNPLDFNENCYLS HGD+L+++ ++PK +IT+R T+++Y I 
Sbjct: 651  WNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIY 710

Query: 698  TPMFRXXXXXXXXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGT 757
            TPMFR            EFM++KEVGRS+DF++ GSYLIYS+LDIDNVDT+ ++C+S+GT
Sbjct: 711  TPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGT 770

Query: 758  TLQCYGFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRANEDD---MQYAXXXXXXXXXXX 814
             L  YGFV+RYLINVKMNYFG+FFHFVTSEEYTG  R  + +    +             
Sbjct: 771  ALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESV 830

Query: 815  XXXTMQGNDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGL 874
               +   +D   + +    L++SDLKRT+NETD+WFTF+VW+GAL+LPETIYN DPC+ L
Sbjct: 831  SRISSNSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIAL 890

Query: 875  HFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLT 934
            HF EL++DLRSCNYYMD+LA   D+++KRYV K   EI+E +H NNG+++  HG+LS + 
Sbjct: 891  HFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIY 950

Query: 935  IHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYE 994
            IHGHRMYGLPP EPTYFCQWD D G L+I S++ FL+G F +F +IGFGY DLENILLYE
Sbjct: 951  IHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYE 1010

Query: 995  KETYDDMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTL 1054
             E  DDMTS+T+ +  + + L +     +A   L    FT IDFENE+YS R+D+ IP+L
Sbjct: 1011 TEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSL 1070

Query: 1055 EFSLFIKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILP 1114
            EF++F  E++  +  L   +  +  TNFVQ+QDF++HRK QR+YI L+DAPYHRC+F+LP
Sbjct: 1071 EFNIFSNEDNDLS--LLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLP 1128

Query: 1115 QEYQDAEQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFS 1174
            + YQ +  Y ELFGAIA               T ++++EDLL ++  L E +   +    
Sbjct: 1129 ESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSV 1188

Query: 1175 DQDYATDVSDDETEEDIDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGT 1234
            +    + +        I     ++    + +   E                P +  +I  
Sbjct: 1189 ENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEK 1248

Query: 1235 FLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIY 1294
             L     ++ VQIID IEI  V RLS++ +G   +TNVK+ I + +LFWG +    V ++
Sbjct: 1249 LLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMF 1308

Query: 1295 LDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGW 1354
             D++DFA+ EKT+E+N EK L+E+TVL KI++VR TV Q       +ERPPA+++ +EG+
Sbjct: 1309 FDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGF 1368

Query: 1355 EIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESR 1414
            E WS+ +E QVNS+++ S DITVD+AQ+EW F Y   Q     DM+++ + IQ  +IES+
Sbjct: 1369 EFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQ 1428

Query: 1415 KELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDW 1474
            KELIS LTAASEYYQISHDPYVITKPAFI RLSRGHVREN+SWKIITRLRHILTYLP+DW
Sbjct: 1429 KELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDW 1488

Query: 1475 HSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHX 1534
            +  + + L   K   + QDA+ IF+S+FSNWR+WEFSD+ARSYIY KLFLN H+ ++   
Sbjct: 1489 YLNVGQPLRDRKFDPS-QDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQS 1547

Query: 1535 XXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNLLLE---TNSPTSDSSLSRETIFNITG 1591
                      +FF+TVYS  Y+V+H+ +++   LLLE   +++   ++SL RE + +I+G
Sbjct: 1548 LQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISG 1607

Query: 1592 TLGTAKGKLSDKIIMIKNLLPSLKITDGGKS---KETFDFV-KSFKLNTLILCERGELQI 1647
            T+   KGKLS K++ ++ L+P L  T+G +    K   D + K FK+N   +    ++Q+
Sbjct: 1608 TVDVIKGKLSTKLLKLQKLIPIL--TEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQL 1665

Query: 1648 DIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFS 1707
             +  T+L   V   R+S+LWE+ +D T+QA S+ ++++  E+ LKHIN+ LAE ++ +F 
Sbjct: 1666 VMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFY 1725

Query: 1708 LIVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEK 1767
               TT++W+ +PT L++S+ S +H   M  T+ LV +IK+I   I +I + L    R  +
Sbjct: 1726 ATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQ 1785

Query: 1768 ITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVW 1827
               V  + P  K N I +C F+N+S ++MP+SPF +++ AKQ+D ++N+F S+  L+ + 
Sbjct: 1786 HPTV--YDPN-KSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLK 1842

Query: 1828 DADIYLTSHLTKQQYFRFSFGDLQLKGNMVND-PYHINLYLSASILKLTVSDVQKLIPSF 1886
            D D +LTS  TK+QY R S   LQ++ N+ +  P  +++ LS +++KLT S+ + ++ SF
Sbjct: 1843 DTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSF 1902

Query: 1887 LQDEKILTESIEDFITLD-LFGLSKNQKSKPE--KDNNKFSWSIDTNINYFGLLAPIGSA 1943
            L+DE++ +ES+    TL  LF +S +++S P+  ++  ++ WS+D++I+YFG+L P+ S 
Sbjct: 1903 LKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTST 1962

Query: 1944 YFLFELRMLLASLTKMGSDIPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSA 2003
            Y++ E    ++S++          DI+G  SVEN+LF IKE +LP  LSK++D ++ VS 
Sbjct: 1963 YYVMEFHSYVSSISNANGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVST 2022

Query: 2004 LQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKW------D 2057
            LQ+  + S + Q+ESSH R+CLSP+SL+RLLW  NQ     ++Y  +H  + W      D
Sbjct: 2023 LQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSD 2082

Query: 2058 LRSKLNNIPKAPDLPL--NVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKN 2115
             + +  N  K+ +     ++ S H LSYN CVGWLF  +     GLI GY+RLFSAYE  
Sbjct: 2083 DKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENC 2142

Query: 2116 LGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFH 2175
            +GKLT++D +F+ A GN+S  F+ E   K+ +NR YLPNMQI +W+K    M+D++VRF 
Sbjct: 2143 MGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFT 2202

Query: 2176 GEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNTLSPFLAN 2235
            GE LDV +LS ++  IES L S++ FQ+LKK+LI   PK++ V+  +   +N+ +  L N
Sbjct: 2203 GETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNNILKN 2262

Query: 2236 IRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLI 2295
            I+S++C FKYDGG + +F++ D      P+ E+ SP + +D+ YKH +  TK H IR L+
Sbjct: 2263 IKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLV 2322

Query: 2296 KINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXXXXXXX-XXXQNLDYKRLLDSFDIA 2354
             I+ THN+LYA CAPL+ +F E ++ +                  QN+DY++LL+ +D+A
Sbjct: 2323 NIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLA 2382

Query: 2355 LKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHI 2414
            + +TSAKQQLSLSCEPKAKVQAD+GF++   ++TTN  D  EPL+FS S++ T+ASIKH+
Sbjct: 2383 ITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHL 2442

Query: 2415 FSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSD 2474
            FSRETSTS GV ++D+TL+FTH + IN +GT+LIS+I+L+FNVKQLQNLYLFLDIW+LS+
Sbjct: 2443 FSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSE 2502

Query: 2475 LLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLK 2534
            LL    ++     + D   S+ +    ES +PWCFTLIFTNVKGD+DLGPSLG+IS++L 
Sbjct: 2503 LLNPVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLS 2562

Query: 2535 RTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLV 2594
            RTW ATDH+   R++LHAF D   L S+GRLSG+  + GASW+SEV W  D+  +  PLV
Sbjct: 2563 RTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLV 2622

Query: 2595 SITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCST 2654
            ++++N D+I  KAAFDYHMFLIG +NN    LHSE+D+ GV PDLLKV+F CE I LCST
Sbjct: 2623 ALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCST 2682

Query: 2655 ALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVD 2714
            ALVAANILDIYNT +RMRQD KISYIETL++SN   +K  + Y DIL+SL LL+TD++V 
Sbjct: 2683 ALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVS 2742

Query: 2715 IYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEM 2774
            I +L +QISPI+LFDVEV+VI + S+SARSETHS  KL T L M+VYDA++SLST+K+E+
Sbjct: 2743 ICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQEL 2802

Query: 2775 DEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSV 2834
            DE  +SKI+V +Y+ YASKI GGTIIEIP++ V MTT+QEEKSDILEYLY+C F DK++V
Sbjct: 2803 DEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAV 2862

Query: 2835 RWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEP 2894
            RWNLGP+NF+KEMWTTH++AIAVRRSQV+      S            N ++  YV +E 
Sbjct: 2863 RWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEE 2922

Query: 2895 PRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952
            P+IDMPQI+DLGDATPP+EWFGVNRKRFPAFTHQTAV  VQ LVY A+++YA  LG S
Sbjct: 2923 PQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2996 bits (7767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1502/2978 (50%), Positives = 2024/2978 (67%), Gaps = 67/2978 (2%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M+  SQF+ V L+ +RNFSW+FLV W+L  +++L+ IFYLGR  AY IT +LEW LWKH 
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            KVK++++SLRI+ L G I F+N+ II KD TISIL+G++ WRY L  TR+ +++EAS  +
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  -----TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLN 175
                  +    S+KN  LPCRFV+  EG EIF+YN+TVAY+NIIQMFS+EER QFEKF++
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 176  EQILSDSATVKS-MDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSS-FLRFLPIQFL 233
            +Q +S+     S   D +                 NDRVF E      S F+RFLP++  
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 234  VTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIG 293
            ++RGS++LGNKFTPSLLI S  S   ++D  QPKEKLDLYK     + I+ + +++QNI 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 294  FDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALY 353
            ++     K     GK+S +W  F ++L I +    +   H  K    + F  KW+GL LY
Sbjct: 301  YNRK---KATFKNGKLSRMWATFVKVLHIPF----YNKSHNNKGTESEPFMTKWKGLGLY 353

Query: 354  KGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLD 413
            KG        D D++ FDFANHEYAK S+I+KSP+   T  +D+PG+VPHGAHPT   L+
Sbjct: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPT---LE 410

Query: 414  GPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCR 473
            GP+VGN+GAPP++ +D+Q +G ++C+GPWAQR+  HL +++SP V+R++ P+K L+PG R
Sbjct: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470

Query: 474  RIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNT 533
            RIYT  +    ++D ++WRIPTRE SKD EFL+ ++ T+ EYRPFGW+DLKF+ ++  + 
Sbjct: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530

Query: 534  TFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTIN 593
            T  LCP  +GF N + IH  E E  SSVNHD++LKC  FD   D  +PLGWN  ATWTIN
Sbjct: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590

Query: 594  LNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHN 653
            L+S+Q+E F+LREH+TL+AD  TDFSSGEPTPYELFRPFIY INW IDGYS+YLNVNDHN
Sbjct: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650

Query: 654  IVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXX 713
            IVNNPLDFNENCYLS HG+EL +D   P  SIT  + D+ Y I TPMFR           
Sbjct: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTL 710

Query: 714  XEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVK 773
             EFMK+KEVGRSY F V G Y +YS+LDIDNVDT+ ++CTS GTTL CYGFV+RYL+NVK
Sbjct: 711  NEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770

Query: 774  MNYFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQG--NDAPGRRRLH 831
            MNYFGDFFHF+TSEEYTG IRA E +                  T  G  +D   R R  
Sbjct: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVRLRAD 830

Query: 832  TELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMD 891
              + RSD+KRTTNETD+WFTF+VWEGAL+LPETIYNCDPCV LHFGEL++DLRSCNYYMD
Sbjct: 831  PPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMD 890

Query: 892  LLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYF 951
            LLA M+  SIKRYVS+  HE+FE+I ++NG     HGSL++LTIHGHRMYGLPP+EPTYF
Sbjct: 891  LLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYF 950

Query: 952  CQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKL 1011
            CQW  DL  L I SD EF +GFF+ F  IGFGY +LEN LLY+ ET DDMTSVTV +  +
Sbjct: 951  CQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVRDM 1010

Query: 1012 SVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLF 1071
            +V+++    +  A  D+ NL FT IDFENE+YS R+DL +P+L   L   E+D    +L 
Sbjct: 1011 NVVVEND--SSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLM 1068

Query: 1072 TLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIA 1131
             L TKV +T+F+Q +DF +HR  QR+YI L+D+P++RCSF+LP   Q++  Y+ L G+I+
Sbjct: 1069 DLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGSIS 1128

Query: 1132 XXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETE--- 1188
                           T DFIIEDLLGEF   L+     +    D D  ++  D   E   
Sbjct: 1129 PSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEG 1188

Query: 1189 -EDIDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXC-PDILDSIGTFLMLFSTENIVQ 1246
             +D+    F    + +  +  E+                P I   +   L  F   N V 
Sbjct: 1189 PDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVD 1248

Query: 1247 IIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKT 1306
            IID+IE++ V RL  L      L N+K+ ++ ++ FWG +    V +Y D++DF + ++T
Sbjct: 1249 IIDEIEMSIVKRLGQLWNNTCVL-NLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRT 1307

Query: 1307 VEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVN 1366
             + + E  + E   L+K+RSVR TV   +     EERPPALSL +EGWE +S   E  V 
Sbjct: 1308 RDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVG 1367

Query: 1367 SLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASE 1426
            S+++LSTDITVDE+QLEWL  Y   Q   I++M+ +   + +    +R++L+  +T ASE
Sbjct: 1368 SVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASE 1427

Query: 1427 YYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSK 1486
            +YQISH+PYVITKPAFI RLS GHVREN SW+IITRLRHILTYLP +W    N S  Q  
Sbjct: 1428 HYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWR---NNSAIQVS 1484

Query: 1487 TAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASF 1546
                + DA     SV S+WR WE SDI RSYIYR +FL+  S  +             SF
Sbjct: 1485 PTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSF 1539

Query: 1547 FVTVYSAGYEVEHNFIITRTNLLLETNSPTSD-----SSLSRETIFNITGTLGTAKGKLS 1601
            F T+YS GY V HNF+ITR N++ E   P ++      +L  + + N+T +LG  KG+L+
Sbjct: 1540 FFTIYSEGYRVAHNFVITRANIVGE-EIPAAELSKVQQALDYDNVMNLTVSLGAIKGELN 1598

Query: 1602 DKIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGA 1661
            D+++ ++N+    +     +SK + +  KS+K+N L+  +R ELQ  +G TRL +R+   
Sbjct: 1599 DQLLKLRNIFSKAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNG 1658

Query: 1662 RLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTI 1721
            + ++L E  K+  + A+S   + +R+E  LKH +  LAE   R+ SL +T E WSY P++
Sbjct: 1659 KAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSL 1718

Query: 1722 LVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVN 1781
             +N QCS+ H+ AMT+T++LV SIK+IME+I  +++          +    ++   P  N
Sbjct: 1719 SINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQN 1778

Query: 1782 TILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQ 1841
            T LT  F++++ ELMP++PF +RHE KQL +Y NR  SNEIL+S+WDA+I L SH T +Q
Sbjct: 1779 TALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQ 1838

Query: 1842 YFRFSFGDLQLKGNMVNDPYHI-NLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDF 1900
            YF F+ GDLQ+K N+  +   I N+ LS S++KLT+S+ ++++ SFLQDEK++ ES+  +
Sbjct: 1839 YFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESL-GY 1897

Query: 1901 IT--LDLFG-LSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLT 1957
            I   L LF  L++N+       ++   WS+D N+NYFG+L P+ S +F+FE+ MLLA++ 
Sbjct: 1898 IKGLLQLFSPLARNKTQ-----SSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMN 1952

Query: 1958 KMGSDIPNQSD--ISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQ 2015
               SD  ++ D  ++GQ S+EN L  IKE +LP  LSKLLDFSI+V + QK  N+  +YQ
Sbjct: 1953 N-ASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQ 2011

Query: 2016 IESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNV 2075
            IESSHFRVCLSP SLV++LW T+Q+ + ++Y++ H   +K      L +   + D  ++ 
Sbjct: 2012 IESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDF 2071

Query: 2076 PSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSD 2135
             S HILSYN C+GW+F +    + GLI+G++RLFSAYEK+ GKLTL+D +FS+ANG S+D
Sbjct: 2072 RSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTD 2131

Query: 2136 NFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESAL 2195
             F+S+G EK +YNRS+L N+QI+YW K+  +M+DLF+R +GEAL+V+ LS+  D+IES L
Sbjct: 2132 TFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTL 2191

Query: 2196 TSVQTFQELKKDLIPGLPK--KQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIF 2253
             S+Q FQ LKK+ +       + K+N + T   N +SPFL++IR+I CQFKY GGV KI+
Sbjct: 2192 ASIQKFQTLKKERMHKRDSGPRNKLNLENT--SNNISPFLSHIRTIDCQFKYVGGVLKIY 2249

Query: 2254 SLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLS 2313
            SL+D      PS E+ SP VVI L Y H E   + H IR L+ I+ THNILY++C P+L+
Sbjct: 2250 SLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILN 2309

Query: 2314 DFFERIQGMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAK 2373
            D  E  Q MV                Q++DYK LLDSFDIA K+TS +QQLSLSCEP+AK
Sbjct: 2310 DIVEASQRMV---QKHSPDETPLESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAK 2366

Query: 2374 VQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLM 2433
            VQAD+GF SF F VTTNDL    P   SLSVEK ++S++HIFSRETS S  VDFVD T +
Sbjct: 2367 VQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSI 2426

Query: 2434 FTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKP-ANDIVKAKTDSS 2492
            FTHPDV    G AL+S+IN+FFN+KQLQNL LFLDIW+L+  L +K  A D  + K   S
Sbjct: 2427 FTHPDVF---GVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKS 2483

Query: 2493 LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHA 2552
            +++++ +   + I W FTLIFTNVKGDVDLGPSLGV+S++L RTWFATDHY   R+VLHA
Sbjct: 2484 MTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHA 2543

Query: 2553 FTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYH 2612
            F D  S+ S+GRLSG+F+LK A+WISEVN+P   +I     +S+++++  ++ K AFDYH
Sbjct: 2544 FADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYH 2603

Query: 2613 MFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMR 2672
            MFLIG I+  + HL SE D+ G++PDLL V   C+ +  C+TAL AANILDIYNT  RMR
Sbjct: 2604 MFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMR 2663

Query: 2673 QDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEV 2732
            QDN+ISYIETLRESN  E++  + Y DIL+SLNLL+TD+S DI T   QISPI+LFDVEV
Sbjct: 2664 QDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEV 2723

Query: 2733 LVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYAS 2792
            LV+ I+++SARSET SG+KL TEL +QV +A VSLSTSKEE+DE  V+KIS+++Y+ YAS
Sbjct: 2724 LVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYAS 2783

Query: 2793 KIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHI 2852
            KI GGTI+++P+LLVSMTT+Q+ KSD++EYL+TC F D+++V+WNLGPINFIKEMW+THI
Sbjct: 2784 KISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHI 2843

Query: 2853 RAIAVRRSQVVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPM 2912
            +++AVR++Q    +  +               ++ +YV L+ P I+MPQI+DLGDATPPM
Sbjct: 2844 KSLAVRQTQSNKTMSEKDKQADLDPEEEIK--AKLQYVPLDEPYIEMPQIKDLGDATPPM 2901

Query: 2913 EWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950
            EWFGV+RKR PA THQ A+ L+QKLV++AE+EYA + G
Sbjct: 2902 EWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQG 2939

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2713 bits (7033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1404/3041 (46%), Positives = 1965/3041 (64%), Gaps = 132/3041 (4%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            MD  S FQ V L R RNFSW+FLV W+LT I++L+ IFYLGR   +++TFILEW++WK  
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            KVK+NI+SLRI+ LGG I F+N+ IIH+D TIS LEG I WRYWLFN+RK ++QE   +E
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 121  TQ-----TKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLN 175
             +      +P S    + PCRF++  EGLEIF+YNKT +Y+NII MFSKEER QFEKF++
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 176  EQ--------------ILSDSA-------TVKSMDDSQFXXXXXXXXX-------XXXXX 207
            +Q              +LS+S        TV S D +                       
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 208  ATNDRVFQEEETDTSS-FLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQP 266
              ND +F+++ ++  S ++RFLPIQ    R SL+LGN+FTPS+L+VSA ++  ++D   P
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 267  KEKLDLYKFKLSAELINTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKP 326
            KEKLDL+K KL  EL + +A++KQNIGFD+D+S  FK  RG++S++W  F R+   L   
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF--LLPT 358

Query: 327  LRFTHMHRRKNEHEDKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKS 386
            L   H+   + + +  F+  W+GL+LY+        +++++++FDFANHEYA+  SILKS
Sbjct: 359  LGPKHL---QTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISILKS 412

Query: 387  PKVTFTSQHDMPGIVPHGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQ 446
             K+ FT ++D+PG+VP     T   L GP+VGNSGAPP++ +DIQ++G ++C+GPWA+RQ
Sbjct: 413  AKIVFTYEYDIPGLVPKEPEET---LQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469

Query: 447  ADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQ 506
              +L  LLSPVVSRT KP+K LTPG +RIYT  +  ++IM+++TWRIPTRE SKD EFL+
Sbjct: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529

Query: 507  HYRETNGEYRPFGWIDLKFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDIL 566
            HY ET  E+RPFGWIDLKF K++       +CPT +G  NN+  H +  E R+SVNH++L
Sbjct: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589

Query: 567  LKCKYFDFDIDTSFPLGWNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPY 626
            L+ K FDF+ D  +PLGWND+A W INL+S+Q+E FILREHITLI+D   DFSSG+PTPY
Sbjct: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649

Query: 627  ELFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSIT 686
            ELFRPFIY INW +DGYS+YLNVNDHNIVNNPLDFNENCYLS HGD L  D  IP+ ++ 
Sbjct: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709

Query: 687  ARHTDISYTIKTPMFRXXXXXXXXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVD 746
             R T+I+Y I TPMFR            EFMK+KEVGRSY+F+V G Y ++S+LDIDNVD
Sbjct: 710  NRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769

Query: 747  TIMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYAXXX 806
            TI ++C+S GTTL CYGFVVRYL+NVKMNYFGDF HFVT+EEYT A    E   +     
Sbjct: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829

Query: 807  XXXXXXXXXXXTMQGNDAPGRRRLHTEL---QRSDLKRTTNETDLWFTFTVWEGALLLPE 863
                              P  R  +  +   +RS+LKRT NE D+WF F+VWEGAL+LPE
Sbjct: 830  HSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPE 889

Query: 864  TIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEE 923
            TIYN DPC+ LHF EL +DLRS NYYMDLLA MN+  +KRYVS+HPH++FE + K+NG +
Sbjct: 890  TIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQ 949

Query: 924  YHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFG 983
              +HG LSSLTIHGHRMYGLPP EPTYFCQW  D+  L+I SD+EF +GF + F++IGFG
Sbjct: 950  EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFG 1009

Query: 984  YVDLENILLYEKETYDDMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKY 1043
            + +LENILLYE  T  DMTSVTV +++L  M+ +   +  +      + FT IDFENE Y
Sbjct: 1010 FKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAY 1069

Query: 1044 STRLDLIIPTLEFSLF-IKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLH 1102
            S R+D   P + F +F + E     + L  L+T++  T+F+Q+Q F +HR  QREYI LH
Sbjct: 1070 SQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLH 1129

Query: 1103 DAPYHRCSFILPQEYQDAEQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDL 1162
            D+ Y+RCSF+LP  +Q++  Y+EL G+I+               T D+IIED LGE+   
Sbjct: 1130 DSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAPT 1189

Query: 1163 LETSSPF--------RMPFSDQDYATDVSDDETEEDIDPLEFNTPSEAIQNDKCERXXXX 1214
            ++             R P +++D     +          +  N P     N++       
Sbjct: 1190 VKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPH---MPHNPP-----NNRDRYNNYV 1241

Query: 1215 XXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKI 1274
                       P +   +  +L  F TE+   IID  EIA V +L NL+ GA  +T  ++
Sbjct: 1242 LDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRL 1301

Query: 1275 NILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQT 1334
            ++  L   +     +GV + L+  DF +  KT+E   EK ++E T+ + I ++R ++ + 
Sbjct: 1302 HVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLE- 1360

Query: 1335 AANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGL 1394
            A  S    +P AL L IE  E+WSSTV++ VNS+N+ S   T+DE+QLE + GY   Q  
Sbjct: 1361 AHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIK 1420

Query: 1395 QIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVREN 1454
             ++D I ++  ++  + +++K+LI  LT+ASEYYQISHDPYVITKPAFI RLS GHVREN
Sbjct: 1421 VLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVREN 1480

Query: 1455 RSWKIITRLRHILTYLPEDWHSTINRSLTQ-SKTAATTQDAKGIFISVFSNWRNWEFSDI 1513
            RSW+IITRLRHILTYLP DW +  +    Q S+     Q  + IF+SVFSNWRNW+ SDI
Sbjct: 1481 RSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDI 1540

Query: 1514 ARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNLLLETN 1573
             RSYIY+K+FL Q+ +               SFF TV  +GYEV  + I TRTN++++  
Sbjct: 1541 TRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVL 1600

Query: 1574 SPTSDSS----LSRETIFNITGTLGTAKGKLSDKIIMIKNLLP----------------- 1612
             P+ ++S      +E +  +T  +G  KG+  +++  +K L                   
Sbjct: 1601 PPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSIS 1660

Query: 1613 -SLKITDGGKSKETF---------DFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGAR 1662
             S  I+  G   +           D  ++ K+   ++ ER +L   +G+TRL +R+   +
Sbjct: 1661 RSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGK 1720

Query: 1663 LSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTIL 1722
             SML E+ K+ T  A+S   + QR EI LKH    LAE+ ++   +  T +     P + 
Sbjct: 1721 NSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQ-LGVIPFVS 1779

Query: 1723 VNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKI---TKVESHGPKPK 1779
            +N Q ++  + AM +T +L  S+    E I R  + L+   ++ ++   + V    P+  
Sbjct: 1780 LNCQATNSFIRAMPSTVVLRNSV----EKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIP 1835

Query: 1780 VNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTK 1839
            +   +   FT++S E+M +SPF++  + KQL IY +   + E++L   + D+YL S L+ 
Sbjct: 1836 IKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSS 1895

Query: 1840 QQYFRFSFGDLQLKGNMVNDPYHI-NLYLSASILKLTVSDVQKLIPSFLQDEKILTESIE 1898
            +Q+F+FS  DLQ K  + ++   +  + +S S++KLT+ + ++ + + LQDE+ L ES++
Sbjct: 1896 EQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVD 1955

Query: 1899 DFITLDLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTK 1958
                L  F  S +  +      N   W++D N+ YFGLL P+ S  ++FEL  L ASLT 
Sbjct: 1956 HIQKLWNFLRSASGGNDRSPSRNT-RWALDANLKYFGLLVPVSSICYIFELHSLFASLTN 2014

Query: 1959 MGSDIPN-QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIE 2017
                        SGQ  VE+    +KE +LP  LSK+LDFSI+    QK  N+  +YQIE
Sbjct: 2015 ANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIE 2074

Query: 2018 SSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPS 2077
            SS+FR+CL PE LV +LW+ + + + + ++K HH    W L    N   K+ +  L+  S
Sbjct: 2075 SSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHT--PW-LPYSSNKTAKSGESTLDFRS 2131

Query: 2078 FHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNF 2137
             HILSYNFCVGWLF V   SEPGLILGY+RLFSAYEK+ GKLTL+D + S+ANGN+SD F
Sbjct: 2132 IHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTF 2191

Query: 2138 FSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTS 2197
            +S+  EKD Y R+YL NMQI YW K    ++DLFVRFHGE +DV FLS+   ++E  L S
Sbjct: 2192 YSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHS 2251

Query: 2198 VQTFQELKKDLIP--GLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSL 2255
            ++ F E+KK  I   G   K K+N +     NTL+PFLA+IR+I+ Q  + GGVFK++S 
Sbjct: 2252 IKRFNEMKKAKIKQTGSSTKSKLNMEAAS--NTLAPFLAHIRTINSQLNFAGGVFKVYSP 2309

Query: 2256 EDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDF 2315
             + ++++EP  E+ SP V + +NY+  E R K H IR    I  THN+L+AKCAPLLSDF
Sbjct: 2310 TELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDF 2369

Query: 2316 FERIQGMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQ 2375
               I+ M+                 ++DYK LL+ +DIA +I S KQ+LS SCEPKAKVQ
Sbjct: 2370 NHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQ 2429

Query: 2376 ADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFT 2435
             D GF SF+F VTT+ +D+ EP + S S++K E+S++HIFSR++S +  +D++D+ +MFT
Sbjct: 2430 LDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFT 2489

Query: 2436 HPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSS--- 2492
            +P   NV+G AL+S++N++ N+KQ QNL +FLDIWRLS+  ++KP+ +  + K+D+    
Sbjct: 2490 YP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSL 2546

Query: 2493 --LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVL 2550
                    +D   + PW FT+IFTN+ G VDLGPSLGV+++ L++ W  T H  + ++  
Sbjct: 2547 SPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTW 2606

Query: 2551 HAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFD 2610
            H F  G +++S+GRLSG+FEL  AS +SE++WP +  +   PL+S++M I+ +S K+AFD
Sbjct: 2607 HTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFD 2666

Query: 2611 YHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMR 2670
            YHMFLIG++ + +VHLH+E D   ++PDLL+V+   ESI LC+TAL AAN LDIYNT MR
Sbjct: 2667 YHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMR 2726

Query: 2671 MRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDV 2730
            M+QDN+ISYIETL+ESN + S   + Y ++L SLNLL+TD+SV +  L + ISP++LFD 
Sbjct: 2727 MQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDA 2786

Query: 2731 EVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQY 2790
            EVLV+++  ++ARSET SG+KL TEL++Q+ D + SLS+SKEE+DE TVSKI+V +Y+ Y
Sbjct: 2787 EVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLY 2846

Query: 2791 ASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTT 2850
            ASK  GGTII++P+LLVSMTT+Q++ S +LEYL+TC F DK+S++WNLGP+NFIKEMW T
Sbjct: 2847 ASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWAT 2906

Query: 2851 HIRAIAVRRSQVVGVLDGQSXXXXXXXXXXXXN---FSRFKYVALEPPRIDMPQIRDLGD 2907
            H+R++AVRR+Q+     G S                 S+F YV L+ P I+MPQI+DLGD
Sbjct: 2907 HVRSLAVRRTQL-----GNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGD 2961

Query: 2908 ATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANI 2948
            ATPP+EWFGV+RK  PA THQTAV L+QKLV++AE+EYA +
Sbjct: 2962 ATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2598 bits (6735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1341/3016 (44%), Positives = 1916/3016 (63%), Gaps = 85/3016 (2%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            M+  SQF  + L R++ FSW+FL  W+LT I SL+ IFYL R    I TFIL W +WK  
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQ-EASVD 119
            KVK+NI+S+R+S LGG +F KN++II++D T+S LE  I WRYWL N+R+ E++ +A++ 
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 120  ETQTKPTSI-------KNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEK 172
              Q++ +         KN +LPC  ++  +G E+F+YN+  AY+N++++F+KEER +F  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 173  FLNEQ----ILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSSFL-RF 227
            FLNE     I+S+   V SMD   F                NDR +++ + +  S L  F
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSEST--VINDRTYKKNKDERKSILFNF 238

Query: 228  LPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEAT 287
            LPIQ  +  G++ LGN+FTPSL++ S ++ + ++D +   EK+DLYK K++ +  +   +
Sbjct: 239  LPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNIS 298

Query: 288  LKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPL-RFTHMHRRKNEH--EDKFQ 344
            +K N+ +D + + +  +D+GK+S +WN F  ++ ++  P  +  H H +K EH  E  F 
Sbjct: 299  VKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFV 358

Query: 345  AKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHG 404
             KWRGL+LYK       R  +D+  +DF N EYAKFSSILK P  T +   D PGIVPHG
Sbjct: 359  NKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHG 418

Query: 405  AHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKP 464
            AH T    DGPD+GNSG+PP++ +D+Q+   S+ +GPW  RQ  +L ++LSPVVS+   P
Sbjct: 419  AHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIP 478

Query: 465  VKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLK 524
            +K+L PG RRI+T  ++ V I+D+++WRIPTRE SKD EF++ + +TN ++RPFGW+D  
Sbjct: 479  IKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFN 538

Query: 525  FSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGW 584
             +K T     F+L PT+DG  NN  IH  + E  +SVNHDILLK K FD   D  +PLGW
Sbjct: 539  LNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGW 598

Query: 585  NDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYS 644
            N +A W  ++ + Q+E F+L+EHI+L +D  +DF+S +PTPYELFRPF YS+NW I+GYS
Sbjct: 599  NSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYS 658

Query: 645  LYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXX 704
            +YLNVND NIVNNPLDFNENCYLS HGDEL +D LIP   I+  +T+I++ I TPMFR  
Sbjct: 659  IYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLL 718

Query: 705  XXXXXXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGF 764
                      EFMK KEVGR++DF + GSYLIYSDLDIDNVDTI M+CTS+ TTL CYG 
Sbjct: 719  LNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGV 778

Query: 765  VVRYLINVKMNYFGDFFHFVTSEEYTGAI-----RANEDDMQYAXXXXXXXXXXXXXXTM 819
            V+RYL+NV+ NYFGDF HF+TSEEY+  +     R+N++   +               T+
Sbjct: 779  VIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSVQNSSSDDTV 838

Query: 820  QGNDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGEL 879
                     + H  ++R+D+ RT NE D+WFTF VW+GAL+LPE +YN + C  L F EL
Sbjct: 839  LYTKEQDLSKPH--VRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSEL 896

Query: 880  VIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHR 939
            +I  R  NYYMD L N+ D+ I R+++  P EIF  +   +      HG+LS +TIH HR
Sbjct: 897  MISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHR 956

Query: 940  MYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYD 999
            M+GLPP + TYFCQW  D G+L I S+IEFL  FF  FT++GFGY +LEN L+Y+ E+ D
Sbjct: 957  MFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSD 1016

Query: 1000 DMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLF 1059
            DMT +T+  EK+ +++ +      AS ++  L    IDF+NE+YS R++L IP    S+F
Sbjct: 1017 DMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIF 1076

Query: 1060 IKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQD 1119
                      L   +TK+  TNFV  +DF      QR YI LHD+PYHRC FILP  YQ+
Sbjct: 1077 DVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQE 1136

Query: 1120 AEQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYA 1179
            +  Y EL+G I                T DF++ED L E+ DLLE  +PF    S  +  
Sbjct: 1137 SFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLD 1194

Query: 1180 TDVSDDETEEDIDPLE---FNTPSEAIQN--DKCERXXXXXXXXXXXXXXCP---DILDS 1231
            T    +E   D    E   F    +   N   K E                P   D +DS
Sbjct: 1195 TSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFIDS 1254

Query: 1232 IGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGV 1291
            + T L    +EN+V IID+IE+  V RL + ++   + TN+K+ I Y+D+FWGSR   G+
Sbjct: 1255 MSTKLY---SENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGI 1311

Query: 1292 GIYLDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVI 1351
             IYLD++DF M ++  ++  ++ L E T+L+K++S+R + ++T       ERPPALSL +
Sbjct: 1312 EIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTV 1371

Query: 1352 EGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKI 1411
            EG E+WS T   Q NS+NILSTDITVD +Q  WL  Y + Q     ++  + D +QKR +
Sbjct: 1372 EGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDV 1431

Query: 1412 ESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLP 1471
              +K LIS LT ASEYYQI HDPYVITKPA I RLS  HVRENRSW+I+TRLRHIL YLP
Sbjct: 1432 TLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLP 1491

Query: 1472 EDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQE 1531
            E W  + + +  +++   +  D K +F+SVFSNWRNWE SD+ARSYIYR++FL    + E
Sbjct: 1492 EGWEKS-SIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFL---PDIE 1547

Query: 1532 IHXXXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNL----LLETNSPTSDSSLSRETIF 1587
             +           SF+ T+YS  Y V+HN ++TR N+    +L    P + ++   + I+
Sbjct: 1548 KNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIY 1607

Query: 1588 NITGTLGTAKGKLSDKIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGELQI 1647
            +ITGT+GT KG+L D++I +K L    K     +    F   K FK+N +++ E+GEL +
Sbjct: 1608 DITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTL 1667

Query: 1648 DIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFS 1707
               NT+L+SR+   ++S  +E+ +D+ + + S+  Y  R E+ LKH    L +  + D  
Sbjct: 1668 AAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLF 1727

Query: 1708 LIVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEK 1767
            + V  E    KPTILVN + S L   A+  T  LV  ++E    I +I   L      ++
Sbjct: 1728 ISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKR 1787

Query: 1768 ITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVW 1827
             T         K++        +IS E++ +SPF ++H  K+L I FNR G N+ + S+ 
Sbjct: 1788 HTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSIL 1847

Query: 1828 DADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSF 1886
            DAD+YLTS+    QYFR S+ D+ L+  + +     I + +  S++KLT++D +K+  S 
Sbjct: 1848 DADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSL 1907

Query: 1887 LQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFL 1946
            LQDEK   +S+E   TL+    S N++ +    +N + + ++ ++ YFGLL P+ ++YF+
Sbjct: 1908 LQDEKTFEQSLESIKTLNTL-FSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFI 1966

Query: 1947 FELRMLLASLTKMGSDIPNQ--SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSAL 2004
             EL  LLA+ + +  + P Q    I+   +++N LF IK   +  ++SK+LDFS+ +S  
Sbjct: 1967 LELHSLLATFSNVYMN-PQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTE 2025

Query: 2005 QKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNN 2064
             K  N+  ++++ESSHFRVCL+PESL+++L    Q S+S +YYK+H     +  + K + 
Sbjct: 2026 TKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASV 2085

Query: 2065 IPK-APDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVD 2123
            + +     PL   S H LSYNFC+GW+F     S PGLI+GY+RLFSAYE + GKLT+VD
Sbjct: 2086 VSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVD 2145

Query: 2124 VFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTF 2183
             FFSIANG SSD F+S+G EK+KYNRSYLPN+QI YW K+   M+ LFVRF+GE +DV F
Sbjct: 2146 GFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRF 2205

Query: 2184 LSSYLDVIESALTSVQTFQELKKDLIP--GLPKKQKVNDDKTLELNT-LSPFLANIRSIS 2240
            LS++  +I   + SVQ FQ +KK+ +    +  ++KV +D   +++T  S F + ++ I+
Sbjct: 2206 LSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGED---DISTKFSLFFSKVQRIN 2262

Query: 2241 CQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINST 2300
            CQ  YDGGVF ++ +      +E + E+ +P V+ID++YK+  +  K HWIRS I I  T
Sbjct: 2263 CQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPT 2322

Query: 2301 HNILYAKCAPLLSDFFERIQGMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSA 2360
            +N L ++ A  L++F E +  MV                  +DYKR+L+ FD++  I++ 
Sbjct: 2323 YNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAG 2382

Query: 2361 KQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETS 2420
            KQ++SLSCEP AKV A++GF+SF+F++ TND D  EPLS SL+V   + SI H FS E +
Sbjct: 2383 KQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPT 2442

Query: 2421 TSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKP 2480
             S  VDFVD+T +FTHPD+   +GT LIS+++L+FN+KQLQNL +FLDIW L  L+K +P
Sbjct: 2443 ASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRP 2499

Query: 2481 ANDI-VKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFA 2539
               + VK       S  + S   +IIPW FT+I T++ GD+ LGPSLG +S++LK+ W +
Sbjct: 2500 QKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWIS 2559

Query: 2540 TDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMN 2599
            T+H+++ RK L  FTD  SL+S GRL G+ ++   SWI  V +  +  ++  PLV IT+N
Sbjct: 2560 TNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLN 2619

Query: 2600 IDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAA 2659
            ++ ++ KAAFDYHMFLIG ++N   +L SEKD+ G +PDLLK+  +C+ I +CSTALVA+
Sbjct: 2620 VENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVAS 2679

Query: 2660 NILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLN 2719
            NILDI NT  R RQD++ SYIETL ESN    K  I+YTDIL+SLNLL+TDV ++I+ + 
Sbjct: 2680 NILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQ 2739

Query: 2720 IQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATV 2779
            +QISPI+LFDVEV+V T+E++SARS T SG+KLMT+L+M++Y A++SLS S EE+DE  V
Sbjct: 2740 VQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAV 2799

Query: 2780 SKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLG 2839
            S+ISV +Y+ YA K+ GG I+ IPKL V MTT+Q E S I+EYL+ C F DK+SVRWNLG
Sbjct: 2800 SEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLG 2859

Query: 2840 PINFIKEMWTTHIRAIAVRRSQ---------VVGVLDGQSXXXXXXXXXXXXNFS----- 2885
            P+NFIKE+W TH++++AVRR+Q         V G++   S            + S     
Sbjct: 2860 PVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADN 2919

Query: 2886 ---------RFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQK 2936
                     +F YV L+ P+I+MP+I+DL DATPP+EWFGVNRK+FP  THQTA+ L+QK
Sbjct: 2920 DNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQK 2979

Query: 2937 LVYSAEREYANILGSS 2952
            +V+ A++EYA +LG S
Sbjct: 2980 IVHVAQKEYAKVLGDS 2995

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2301 bits (5963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1171/2571 (45%), Positives = 1656/2571 (64%), Gaps = 51/2571 (1%)

Query: 419  NSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTY 478
            N  APP+ +++ Q+F  S+ +GPWA R   ++ ++ SP+VSRT +      PG  R YT 
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 479  GQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALC 538
             ++ V+IM+D++WR+PTRE SKD +FL+ Y +TN   R FGW DL FS+ +      +  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 539  PTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQ 598
            P V+G+ N + +   + E RSSVNHDI  + K +  D D  +PLGWNDE TW+   +S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 599  MEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNP 658
            +E F LREH+ LIADT +DFSSGEPTPYE FRP IY ++W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 659  LDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXEFMK 718
            LDFNENCY+S HGD+  +   IP+  ITA +TDI + I TPMFR            EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 719  HKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFG 778
            +KE+GR YDF   GSY+IYSDLDIDNVD++ ++C+++  TL  YGFV+ YL+NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 779  DFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGN----DAPGRRRL---- 830
            +F HF+T+EEYT  +R N++D+                  +  +    D   +  +    
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 831  -HTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYY 889
             +  L++ D+KR  NETD+WFTF+VWEGALLLPE +YN DPC+ L F EL+ID R+C+YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 890  MDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPT 949
            +DLLA +N  S KR + K+ ++IFE +H N  +    HGS+S+++IHGHRMYG PP  P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 950  YFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLE 1009
            YF  W  D+  L I SDI F+RGF S  T++GF + +L+NILLY++   D+MTSVTV+  
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1010 KLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKK 1069
             + +++ +   +     +++ + F  I+F N++YS+R+DL +P L F+ F          
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249

Query: 1070 LFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGA 1129
            LF  +TK+  TNF Q +D + H K Q+E+I L+D+ +HRCSF+L    Q++  Y EL+G 
Sbjct: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309

Query: 1130 IAXXXXXXXXXXXXXXXTTDFIIEDLLGEF----QDLL---ETSSPFRMPFSDQDYATDV 1182
            I                T  FII+D LG F     +LL    TS+P          +   
Sbjct: 1310 ITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHS-------SNKP 1362

Query: 1183 SDDETEEDIDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTE 1242
                +   I P+E +  S  + +                    P        FL  F +E
Sbjct: 1363 LKPPSSSVIHPIE-SMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSE 1421

Query: 1243 NIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAM 1302
            NI++ ID IE+A VNRL    E    +TN+K+ I YLD F+G R   G+ +Y+D+ID  +
Sbjct: 1422 NIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEV 1481

Query: 1303 CEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVE 1362
             +KT ++     L E+ +L++  S+R ++N+       +ERPPALSL +EGWE WSST  
Sbjct: 1482 SQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTAS 1541

Query: 1363 DQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLT 1422
             QVNSLNI STDITVDE+Q+EWL  Y +   + + +++ + D+IQK+    +K+L+S LT
Sbjct: 1542 SQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLT 1601

Query: 1423 AASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSL 1482
             ASEYYQISHDPYVITKPA++ R+S+GHVR+NRSW+I+TRLRHI TYLP+DW   +   +
Sbjct: 1602 LASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEM 1661

Query: 1483 TQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXX 1542
             + K      D+  IF++VFSNWRNWE SD+ARSYIY+K+FL+                 
Sbjct: 1662 -RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLN 1720

Query: 1543 XASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSD 1602
              S F T+YS GY ++HN I+T+  +LLE  + T+ S    ++I N+TG+LG+ KG+ SD
Sbjct: 1721 LNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEFSD 1780

Query: 1603 KIIMIKNLLPSLKITDGGKS-KETFDFVKS----FKLNTLILCERGELQIDIGNTRLVSR 1657
            K + +  L+P     +  KS  E    V      F ++  +L E G LQ+ +G+T L + 
Sbjct: 1781 KFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNN 1840

Query: 1658 VFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSY 1717
            V   ++S L E        + S A Y +++E+ LKH    +AE Q+    LI T      
Sbjct: 1841 VTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPI 1900

Query: 1718 KPTILVNSQCSDLHLMAMTATDILVASIKEIME-NIHRIEQ-DLLAGTRAEKITKVESHG 1775
             P IL+N + +DLH  ++ +T+ +V +I++I E ++H  +  DL   T   K TKV+   
Sbjct: 1901 CPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTT--KPTKVDQKP 1958

Query: 1776 PKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTS 1835
             K   +  + C  + +S EL  ISPF++R+E KQLD+YFN+ G  EILLS+WD DI++TS
Sbjct: 1959 EKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTS 2018

Query: 1836 HLTKQQYFRFSFGDLQLKGNMVNDPYHINLY-LSASILKLTVSDVQKLIPSFLQDEKILT 1894
            H TK+QYFRFS+ D+Q+  N +++   + +  LSAS++KLT S+ +++  SFLQDE+I  
Sbjct: 2019 HHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITI 2078

Query: 1895 ESIEDFITLD--LFGLSKNQK---SKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFEL 1949
            ES ++   L    F  +KN K   +   K++    W+++ NINYFG+L PI S +F+ EL
Sbjct: 2079 ESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLEL 2138

Query: 1950 RMLLASLTKMGSDIPN-QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKK 2008
             MLL SLT    +I    + ISGQ S+EN+LF I +R+LP+RLSKL+DFSI++S LQK  
Sbjct: 2139 HMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTT 2198

Query: 2009 NTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRS-KLNNIPK 2067
            ++  + QIESSHFR+C SPESLV +LW   Q+   ++YYKDH    +W+L S K      
Sbjct: 2199 SSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTGTKSS 2258

Query: 2068 APDLPLN-VPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFF 2126
              + PLN   S HILSYNFC+GW+   + K  PG + GY+RLFSAYEKN GKLTL++ + 
Sbjct: 2259 TSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYM 2318

Query: 2127 SIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSS 2186
            S+ N NSS++FFS+G+EK+++NRS+LP+MQI YW K+  + +DLF+R HG+ALDV  LS+
Sbjct: 2319 SVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSN 2378

Query: 2187 YLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNT--LSPFLANIRSISCQFK 2244
            ++++IE    S Q F++ +K  I    +KQK ++    E  T  +  FL++I SI+C+FK
Sbjct: 2379 FVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFK 2438

Query: 2245 YDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNIL 2304
            Y+GG  ++FS++D E  S PS E+N+P V I LNYKH ++  K HW+R +I I+S+HNIL
Sbjct: 2439 YEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNIL 2498

Query: 2305 YAKCAPLLSDFFERIQGMVXXXXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQL 2364
            Y+KCAP + +F E IQ ++                 N  YKR+L  FDIA +I +AKQ L
Sbjct: 2499 YSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDIAFRIKAAKQML 2558

Query: 2365 SLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIG 2424
            S SCEP AKVQA++G  SF+F ++T      +PLS +L + K   S++HIFS+E S S  
Sbjct: 2559 SFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFS 2618

Query: 2425 VDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKP-AND 2483
            ++F+D+T +FT P    ++   LIS+I++FFN+KQ QNL LFLDIW LS+ +  +P    
Sbjct: 2619 LNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKK 2675

Query: 2484 IVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHY 2543
                K      I +   P  IIPW F +IFTNV  D+ LGP+LG++S +L++TWF +D Y
Sbjct: 2676 RKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRY 2735

Query: 2544 KNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEI 2603
             + R++L  FTDG  L S+GRLSG+ ++  A W  EVN+  +      P+V+I ++I  +
Sbjct: 2736 LDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCV 2795

Query: 2604 STKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILD 2663
            + K AFDYHMF+I  +NN    LHSE+D  G +PDLL  T LCE I++CST LVA+NILD
Sbjct: 2796 ALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILD 2855

Query: 2664 IYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQIS 2723
            IYNT +R RQD K SY ETL ESN  +++  I Y+DIL+SLNLL+TDV +D+  L +QIS
Sbjct: 2856 IYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQIS 2915

Query: 2724 PITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKIS 2783
            PI+LFD EVLVI I+++SARSET S  KL T LE+QV +ASV+LST+KEE+DE +V+KIS
Sbjct: 2916 PISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKIS 2975

Query: 2784 VKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINF 2843
            V +Y+ YASKI GGTI+ IPKLLV MTT+Q+  S+ +EY +TC FD K+SVRWNLGP+NF
Sbjct: 2976 VADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNF 3035

Query: 2844 IKEMWTTHIRAIAVRRSQVVGVLDGQSXXXXXXXXXXXXNFS--RFKYVALEPPRIDMPQ 2901
            IKEMW TH++++AVR++++   ++  S              +  +F YVAL  P I+MPQ
Sbjct: 3036 IKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQ 3095

Query: 2902 IRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952
            I+DL DATPPMEWFG+NRK+FP+FTHQTAV +VQKLV++ E+EYA I+G S
Sbjct: 3096 IKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 123/175 (70%), Gaps = 3/175 (1%)

Query: 6   QFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKVN 65
           +F  V L+R++ FSW+FLVTWILT IL L   FY+ R  AY +TFIL+WLLW+  KVK++
Sbjct: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65

Query: 66  IQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEF---QEASVDETQ 122
            +S+R+SLL  RI FKN+ II ++STISILEG I W+YWL NTR   +   Q+       
Sbjct: 66  CESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125

Query: 123 TKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQ 177
           T  +  KN QLPC+F+   EG EIF+YNKT AY+NII  FS +E+ ++++FL++ 
Sbjct: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 116/191 (60%), Gaps = 14/191 (7%)

Query: 225 LRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMD-FAQPKEKLDLYKFKLSAELIN 283
           L F P    +T+GS+I GNKFTPSLLI+S  SA+ ++D       ++DLYK K+  +  N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 284 TEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPL-RFTHMHR-RKN---- 337
            E  +K NI +++D   K       +S +W  F+ +  I+  PL R+ H  R  KN    
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 338 -----EHEDKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFT 392
                E ED F+ KW+GL+LYK   L  R N  + IEFDF NHEYA++ SI+K+P++ FT
Sbjct: 418 EDNIFEDED-FEKKWKGLSLYKDAALN-RGNPEEHIEFDFLNHEYARYCSIVKAPRLIFT 475

Query: 393 SQHDMPGIVPH 403
           +++D+PGIVP+
Sbjct: 476 NEYDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2279 bits (5905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1223/3071 (39%), Positives = 1804/3071 (58%), Gaps = 155/3071 (5%)

Query: 5    SQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKV 64
            ++F  V L+++R FSW+FLV WIL V+ + +F+FY+ +   + +TF  EWLLWK   +KV
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   NIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQ-EASVDETQT 123
             I+S+R+S L G IFFKNV +I +D TISILE ++TWRYWL NTRK E++  A  D ++ 
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 124  KPTSI-------------------------------------------------KNWQLP 134
                +                                                 KN +L 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 135  CRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSD-----SATVKSMD 189
              F +N  G EIFLYN+  AY+ IIQ FSKEE+ QF  FL +  L D     S+ +K+ +
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 190  D------SQFXXXXXXXXXXXXXXATNDRVF---QEEETDTSSF---------------L 225
            +                       A+N  +    QE ++D S+                L
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLHL 305

Query: 226  RFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTE 285
              LP+   + +G++ +GNKFT SLL+++   A  L+D+A P  KLD++K K++ E+ + +
Sbjct: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365

Query: 286  ATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQA 345
             ++K+NIG++ +++ +F    G ++ +W++   +L ++      T     + + +  F  
Sbjct: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425

Query: 346  KWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGA 405
            KW GL LYK +     +   DD++FDFANHEYAK S+  K+P++ F+ + D+PGIVPHG+
Sbjct: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485

Query: 406  HPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPV 465
            HP +S   GPD+GN  +PP + +D+Q+   S+ FG W  R    L  L+ PV+S+  KP+
Sbjct: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545

Query: 466  KRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKF 525
             +L PG  R+++     V+++DD++ R+PTRE SKD +FL+ Y ET  ++R FGWIDL F
Sbjct: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605

Query: 526  SKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWN 585
             K +       + PT  GF+N +    +E E  +SVNH++L K    +   +  +PLGWN
Sbjct: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665

Query: 586  DEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSL 645
            D   W  N+NS Q++ F+LREHITL++D + DFS+ EPTPYELFR F Y++N KI GYS 
Sbjct: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725

Query: 646  YLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXX 705
            Y NVND NI+NNPLDFNENCYLSFHGD  + +  IP  S+  ++  ISY I TPMFR   
Sbjct: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785

Query: 706  XXXXXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFV 765
                     EFM++KE+GRS+DF+V G+YLIYS+LDIDNVD++ +D  S  T L C+GFV
Sbjct: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845

Query: 766  VRYLINVKMNYFGDFFHFVTSEEYTGAIRAN-EDDMQYAXXXXXXXXXXXXXXTMQGNDA 824
            ++Y++N + NYFG F  F+T+EEY+  IR N  D++                     ND 
Sbjct: 846  IKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQKMDSITNDV 905

Query: 825  PGRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLR 884
                +    ++RSDL RT NETD+W  F V +GAL+LPE +YN D CV L FGEL I++R
Sbjct: 906  EDINQ--KTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMR 963

Query: 885  SCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLP 944
            +CNYYMD+   + D ++ R+    PHE+FE I   N       G++S +TIHGHRMYGLP
Sbjct: 964  TCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSS-SVEGNISDITIHGHRMYGLP 1022

Query: 945  PMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSV 1004
            P E TYFCQW  ++GT  I SD+ FL  F  S  +IGF   + EN LLYE +T +DMT +
Sbjct: 1023 PKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLL 1082

Query: 1005 TVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEED 1064
            +V++E L V+L +P L   A    +++    IDFENEKY+ RLD+      FSL   + D
Sbjct: 1083 SVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKID 1142

Query: 1065 GTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQ 1124
               K +  + TK+ ITNF ++ +   H  TQR++I LHD+PYHRC F+LP+++Q++  Y+
Sbjct: 1143 SGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSYK 1202

Query: 1125 ELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSD 1184
            EL+G+I                TT+FI+E +L ++ + L          SD      ++ 
Sbjct: 1203 ELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFL---------LSDHHNQMSINA 1253

Query: 1185 DETEEDIDPLE--FNTPSEAIQN-----DKCERXXXXXXXXXXXXXXCPDILDSIGTFLM 1237
            +    D  PL+  F+      QN     D  E                PDI+ +I  F  
Sbjct: 1254 ELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFST 1313

Query: 1238 LFSTE-NIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLD 1296
             F+ + ++   ID IE+A VNRLS+L+E      NV +N+  +D  WG R    +G Y++
Sbjct: 1314 EFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYIN 1373

Query: 1297 RIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEI 1356
             + F + +++   N      +LT+L K RSVR  +   + NS +++RPP LSL++EG+E 
Sbjct: 1374 MLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEA 1433

Query: 1357 WSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGL---QIQDMIKTSDTIQKRKIES 1413
            WSST   Q+ +LN+ S DITVDE Q+ WL  Y  +Q L   +IQD +K    I   +   
Sbjct: 1434 WSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVK---LIYDEQASY 1490

Query: 1414 RKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPED 1473
            +K  I+SL  A E YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHILTYLPED
Sbjct: 1491 QKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPED 1550

Query: 1474 WHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIH 1533
            W   ++      K +   ++A   F++VFSNWRNWE SDI +SYIYR +F+ + S + + 
Sbjct: 1551 WEDRLDEE-DLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRILQ 1609

Query: 1534 XXXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNLLLETNSPT---SDSSLSRETIFNIT 1590
                       +F+ T+YS  Y  + NF+IT+ N+L+   +      D    +E I ++ 
Sbjct: 1610 ---NSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVV 1666

Query: 1591 GTLGTAKGKLSDKIIMIKNLLPSLKIT--DGGKSKETFDFVKSFKLNTLILCERGELQID 1648
              +G+ K + ++ I+ +K  +  +  T  D     +     K FK+N   + +  +    
Sbjct: 1667 TKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQ 1726

Query: 1649 IGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSL 1708
              N+ L SR+    +   +E+  + ++ + S   Y  R  I LKH+N  L + Q+R+   
Sbjct: 1727 FYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFA 1786

Query: 1709 IVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDL--LAGT--- 1763
              T E  S   ++++N +CS+LH  ++  T+I V +IK I  ++  +  ++    GT   
Sbjct: 1787 STTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDN 1846

Query: 1764 -------RAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNR 1816
                      +  K++   P  K N  L+  FTN+S E+  + P +++HE   ++I +N 
Sbjct: 1847 INTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNT 1906

Query: 1817 FGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVN-DPYHINLYLSASILKLT 1875
               +E+L+ V D D+YL S  TK+QY R S+  L+L   + + +   I+L +S+SILKLT
Sbjct: 1907 INIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLT 1966

Query: 1876 VSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFS---WSIDTNIN 1932
             SD ++++ SFLQDEK L  S+    +L+    S N+K+  E     FS   W ++    
Sbjct: 1967 TSDPRRMLFSFLQDEKELKNSLTFLRSLE----SLNRKANSEDSETLFSSYEWIVNFKSK 2022

Query: 1933 YFGLLAPIGSAYFLFELRMLLASLT-KMGSDIPNQSDISGQFSVENVLFFIKERALPVRL 1991
            Y G+L PI + Y++FEL   L++++ K            G  S ++++F IK++++P + 
Sbjct: 2023 YMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKF 2082

Query: 1992 SKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHH 2051
            SK+LDFSIK+S  +   N   +++IESS FRVCL+P SL++ +W   Q+   +  Y D  
Sbjct: 2083 SKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQS 2142

Query: 2052 VDNKWDLRSKLNNIPKAPDLP----LNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNR 2107
              N +      NNI  A +       +V SFHILSYNF +GWL+     + PGLILGYNR
Sbjct: 2143 TVNFFVFND--NNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNR 2200

Query: 2108 LFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTM 2167
            LFS YE N GKLTLVD FFS+ANG+S D F+S G E  K+NRSYLPN+QI YW K+   M
Sbjct: 2201 LFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKM 2260

Query: 2168 RDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLEL- 2226
            + LF++FHGE LDV F  +++++IES + S+  FQ LK++ I  L K +   D+K+    
Sbjct: 2261 KHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSAL 2320

Query: 2227 -NTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENR 2285
             N   P    ++ ++C+F YDGG+F++FS      + EP+  + SP V I L+Y + E  
Sbjct: 2321 TNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKE 2380

Query: 2286 TKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXXXXXXXXXXQNLDYK 2345
             K+HWI  LI I  T N+L + C P LSDF  +I+ +V                  ++  
Sbjct: 2381 LKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINIT 2440

Query: 2346 RLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVE 2405
             LL++FDI  K+ S  Q ++L CEPKAK+  D+GF SF F++ T  L+  +PL  SL + 
Sbjct: 2441 SLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKIN 2500

Query: 2406 KTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYL 2465
              + S+KH FS E S S  V  +DV L+FTHP+V    GT L+ ++ L FN+KQ QN+ +
Sbjct: 2501 DIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVF---GTGLVDDVKLHFNLKQFQNISI 2557

Query: 2466 FLDIWRLS----DLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVD 2521
            FLDIW +S      L  K +N +V AK   S  IAQ     S +PW F  I TN+ GD++
Sbjct: 2558 FLDIWDVSKSTEKKLFKKDSNTLVDAK---SSPIAQTIVNSSTLPWSFVFIATNINGDIN 2614

Query: 2522 LGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVN 2581
            +G +LG +++ L+RTW +TDH+ N R++LH FTD   +SS+GRL G  E+   +W  +VN
Sbjct: 2615 MGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVN 2674

Query: 2582 WPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLK 2641
            +         PLV +  ++ ++S K AFDYHMFLI  + + + H+ SEKD++ ++PDLL 
Sbjct: 2675 YVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLT 2734

Query: 2642 VTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDIL 2701
            V   C+ I +C+TALVA+NILDIYNT MR RQDNK SYIETL ESN    K    Y DIL
Sbjct: 2735 VNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDIL 2794

Query: 2702 RSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVY 2761
            +SLNLLQT +S +I+ LN+QISP +L+D EV++I ++ + + +ET +G+K+ T+LEM+VY
Sbjct: 2795 KSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVY 2854

Query: 2762 DASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILE 2821
            +A++SL++  +E+ E  ++++S + Y+ YAS +  G I EIP+L ++MTTFQ   + IL+
Sbjct: 2855 NATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQ 2914

Query: 2822 YLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXXXXXXXXXXX 2881
            Y Y+C FD K+ V WNLGPINFIKE+W TH+R++ VR  Q +G  D  S           
Sbjct: 2915 YTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHD-ISLENEGDTDESV 2973

Query: 2882 XNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSA 2941
               S  +Y+ALE P I+MPQI+DL DATPP+EWFG+NRK FP+ THQ+ +  +QKLV  A
Sbjct: 2974 KVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVA 3033

Query: 2942 EREYANILGSS 2952
            ++EYA +LGSS
Sbjct: 3034 QKEYAKVLGSS 3044

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2183 bits (5657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1213/3037 (39%), Positives = 1766/3037 (58%), Gaps = 127/3037 (4%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            MDA SQF+ +P++++ NFSW+FLV W+L V+LSLS +FY GR +AY IT +++W+LW+  
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            KVK+NIQSL+IS LGGR+FFKN+T+I KD TIS L+G+ TWRYWL N+RK   +E    E
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEEL---E 117

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180
               +    K+  L CRF +  +G E+F+YN+TVAYD I++  +K+++  F+KF      S
Sbjct: 118  KSGEEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDS 177

Query: 181  DSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSSFLRFLPIQFLVTRGSLI 240
              ++ + ++D                 +TNDR FQE+++  S  L+FLPI   V RG+++
Sbjct: 178  LHSSEEKLEDETLASDSSVSNVD----STNDRNFQEQDS-RSMLLQFLPIHLKVNRGAVL 232

Query: 241  LGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSM 300
            LGN  TPS++I+  +SA+ ++D  Q  EKLDLYK +   +  N +  +K NI F ++  +
Sbjct: 233  LGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPI 292

Query: 301  KFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNE----HEDKFQAKWRGLALYKGT 356
            K  +   ++S VW  F +   I ++ +     H    +       +F  KWRGLALY   
Sbjct: 293  KSYIVHSRMSRVWKKFKK---IFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEY 349

Query: 357  GLGERRNDID--------DIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPT 408
             +    + +         ++  D  NHEYAK++ ILKS KV  T  +D+PG+VPHGA  T
Sbjct: 350  NVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHT 409

Query: 409  ISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRL 468
            +   DGPDVGNSGAPP++SLD +++G ++C+GPWA RQ  +L ++L P+VSR A P+K+L
Sbjct: 410  MEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKL 469

Query: 469  TPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKE 528
            TPG RRIYT   + V +M+DA WRIPTRESSKD +FL+ YRE+  + RPFGW+D+K +KE
Sbjct: 470  TPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKE 529

Query: 529  TTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEA 588
            T +  T  +CPT+ GF+N +  HL + E RSSVNHDI  K        D  +PLGWN EA
Sbjct: 530  TDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEA 589

Query: 589  TWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLN 648
             W    NS Q+  F LR+HI L++D   DF SG PTPYELFRPF+Y   W ID YS+YLN
Sbjct: 590  QWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLN 649

Query: 649  VNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXX 708
            VND NI+NNPLDFNENCYLS HGD L +DF +   +IT   T ++Y+I+TP F       
Sbjct: 650  VNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTP 709

Query: 709  XXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRY 768
                  EFMK+KEVGRSYDF + GSY  +SD+D+ N+DTI+++C SK TTLQC GFV+RY
Sbjct: 710  SWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRY 769

Query: 769  LINVKMNYFGDFFHFVTSEEYTGAIRANEDDMQ---YAXXXXXXXXXXXXXXTMQGNDAP 825
            L+N+ MNYFGDF HF T+EEYT  ++   +  +    A               +  +   
Sbjct: 770  LMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKET 829

Query: 826  GRRRLH-----TELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELV 880
                LH      +++R+DLKR  NE D+WFTF V +G L+ PE IY+C  C+GLHF  L 
Sbjct: 830  TEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLD 889

Query: 881  IDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRM 940
            +DLR  NYYMDL A+++   IKR+   +P  IF+ +    G      G LS L IH HRM
Sbjct: 890  VDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRM 949

Query: 941  YGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDD 1000
            +GLP +E TYFC+WDF +G+LDI SDI+F +G   +F++IGFGY D EN+L+YE     D
Sbjct: 950  FGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPID 1009

Query: 1001 MTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFI 1060
            MTS+T+  + +S  + +   N   + DL+ +  + IDFENE+YS ++   IP ++  +  
Sbjct: 1010 MTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSE 1069

Query: 1061 KEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDA 1120
            K      + LF  ET + +  F Q++DFD HR  QR +I LHD+PYHRC+F+LP +YQ  
Sbjct: 1070 KSSKNEVQGLF--ETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKT 1127

Query: 1121 EQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYAT 1180
              Y +LFGAI                T D I E LLG+     E         SD +Y+ 
Sbjct: 1128 VLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECC-------SDANYSK 1180

Query: 1181 DVSDDETE-------------EDIDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPD 1227
            + +  E               +++     N PS  ++  K E                P 
Sbjct: 1181 ETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLE-PKFEYDSFIINLGKTIIAINPS 1239

Query: 1228 ILDSIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGS-R 1286
                + +  + F   +I  IID  EI  V + S        +TN+++    +   +GS +
Sbjct: 1240 SEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPK 1299

Query: 1287 TDTGVGIY------LDRIDFAMCEKTV----EENKEKKLIELTVLNKIRSVRGTVNQTAA 1336
                V  Y      ++     +C+K +      +K +   E+T   K  S+   +NQ   
Sbjct: 1300 GKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQL 1359

Query: 1337 NSKNEERP-PALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQ 1395
              K   +  P  S+V E  E WS + E   NSLN  + D  V+ +QLEWL  Y     L 
Sbjct: 1360 KPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILC 1419

Query: 1396 IQDMI----KTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHV 1451
               +     K+   IQ R+    KELI     AS  Y I HD  VITKPA+ITRLS+ H+
Sbjct: 1420 ATKLFASFSKSKTLIQARQ----KELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHI 1475

Query: 1452 RENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFS 1511
            RENRSW+IITRLRHIL YLP+ W+     SL + +      DA+  F+ +FSNWR+WEFS
Sbjct: 1476 RENRSWRIITRLRHILNYLPKSWYKRTEESLKKEE-FKIPDDARDQFLKIFSNWRSWEFS 1534

Query: 1512 DIARSYIYRKLFLNQHSNQ-EIHXXXXXXXXXXASFFVTVYSAGYEVEHNFIITR----- 1565
            D+ + YIY+++FL++   +  I            SF  ++ S+ +E E +F++ +     
Sbjct: 1535 DVQKCYIYKRVFLSRSMKKNRITGADFKVNLERISF--SLSSSTHEDE-DFMVVKNLKSV 1591

Query: 1566 -TNLLLETNSP-----TSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLLPSL-KITD 1618
             +N L+E++ P     T DS+ + + I  I+  + + +G L D I+ +  +   L  ++D
Sbjct: 1592 ISNELIESSLPPSAKNTEDSASTEKMI--ISCNIKSIRGDLGDNIVKLVRMYDGLSNLSD 1649

Query: 1619 GG-KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQA 1677
               K+      VK   +  ++L +R +  I +   RL+ R F  R S   E     +   
Sbjct: 1650 TNLKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETK 1709

Query: 1678 VSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLHLMAMTA 1737
            VSLA     +E  ++H +A L E  ++D +L  +   +       V  +   L + AM +
Sbjct: 1710 VSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMAS 1769

Query: 1738 TDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPK--PKVNTI-LTCFFTNISFE 1794
            T+  +  I  I  ++  I ++L +    +  T + +  P+   ++NT+ L    +  S  
Sbjct: 1770 TEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLN 1829

Query: 1795 LMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFG--DLQL 1852
            + P++PF I      ++++  +       +++ D DI L S  +KQ+Y +FS    +L +
Sbjct: 1830 IQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVI 1889

Query: 1853 KGNMVNDPYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQ 1912
                  +   +N+ +++ I KLTVSD ++ I S ++DE +  ++     +L     SKNQ
Sbjct: 1890 SNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQ 1949

Query: 1913 KSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIP----NQSD 1968
            +   ++      W +  N+ Y G++  +GSA ++ EL  +L SL+   S           
Sbjct: 1950 EKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHG 2009

Query: 1969 ISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPE 2028
            I G FS+ENVL  I    L   LSKL+D ++ +   Q++ +     QIESSHFRV L P 
Sbjct: 2010 IVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPM 2069

Query: 2029 SLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAP----DLPLNVPSFHILSYN 2084
            SL ++LWA N+ +   + YK           S L +   AP    +L     S  ILSYN
Sbjct: 2070 SLTKVLWAINEFTRVSEAYKTR--------SSLLQHKKTAPTDISELSNKFRSIQILSYN 2121

Query: 2085 FCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEK 2144
            FC+GW+F   S+++PGLI GY RLF+AY+K  GKLTL+D +FSIA+G SSD FFS GKEK
Sbjct: 2122 FCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEK 2181

Query: 2145 DKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQEL 2204
            D++NRSYLP+MQI YWF   G   +LFVR  GE LDV FLSS + +   A+ S+QTFQEL
Sbjct: 2182 DQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQEL 2241

Query: 2205 KKDLIPGLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEP 2264
            KK ++      +        E   L P L+ IR+ +C  KY GGVFK+FS ED +  S+P
Sbjct: 2242 KKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKP 2301

Query: 2265 SFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVX 2324
            SFEV SP+V + ++YKHL +  K HWIR L+ ++ ++N L+  C P+LS   + ++ M+ 
Sbjct: 2302 SFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLK 2361

Query: 2325 X-XXXXXXXXXXXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSF 2383
                              ++YK+LL +FDIA  +   KQ +SLSCEPKAKVQAD+GF+  
Sbjct: 2362 SFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKL 2421

Query: 2384 IFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVH 2443
               + TN+LD +EPLS S+ +E   A+ +HIFSRE STS  +D +D   + THP++I  +
Sbjct: 2422 AVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTY 2481

Query: 2444 GTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSS---LSIAQLSD 2500
            GT L+S++ ++FN+KQLQ+L LFLDIW+    +   P     + ++ SS   L +++   
Sbjct: 2482 GTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQK 2541

Query: 2501 PE--SIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTS 2558
            P   +  PW +TLIF+N+KGD+DLGPSLGV+SV+  R+W  +DH+ + R+ L  F +   
Sbjct: 2542 PAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENIL 2601

Query: 2559 LSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGA 2618
            LSS GRL G   ++   W SE++WP        PL+S+++ +  ++ K +FDYHMFLI  
Sbjct: 2602 LSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIAN 2661

Query: 2619 INNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKIS 2678
            + +  + L++E+D  G++ DLL V+  C  I L  TAL +AN +DIYNT +RMRQDNK S
Sbjct: 2662 VEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNS 2721

Query: 2679 YIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIE 2738
            YIETL++SN   +K      ++L SL+LL+TD+SV I    +Q+ P TLFD+EVLV+  E
Sbjct: 2722 YIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAE 2781

Query: 2739 SISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGT 2798
             +SA ++T    K+ T L  Q+++  VSLS  K + +E  VS+I VK Y+++A+K+ GGT
Sbjct: 2782 DMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGT 2841

Query: 2799 IIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVR 2858
            I+  P +LV MTT+QE  S+++E LYT  F  K+ V+WNLGPINFI+EMW TH+RA+A+R
Sbjct: 2842 ILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALR 2901

Query: 2859 RSQVVGVLDGQSXXXXXXXXXXXXN----FSRFKYVALEPPRIDMPQIRDLGDATPPMEW 2914
            R  V  + D                     +++ Y+ LE PRI+MPQI+DLGDATPP+EW
Sbjct: 2902 R--VHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEW 2959

Query: 2915 FGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGS 2951
            FGVNR+RFP  THQ+ V  +QKL + AE EYA +LG+
Sbjct: 2960 FGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1853 bits (4801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1083/3031 (35%), Positives = 1657/3031 (54%), Gaps = 148/3031 (4%)

Query: 4    VSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVK 63
             SQF+ V L+   +FSW+FLV W+L + +SL   FY GR   Y +TF+LEWL WK  KVK
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 64   VNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEAS--VDET 121
            ++IQSL+IS LGGRIFFKN+T++ ++ T S L+G+ITWRYWL N+RK  F +AS  +D++
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121

Query: 122  QTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSD 181
              K        LPCRF V  +GLE F+YNKT A+DNI+    +E+  +F+ F  +    +
Sbjct: 122  VEK--------LPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKN 173

Query: 182  SATVKSMDDSQFXXXXXXXXXXXXXXAT---NDRVFQEEETDTSSFLRFLPIQFLVTRGS 238
            +      +DS                 +   NDR FQ  ++ T  FL+ LP+++ V +G+
Sbjct: 174  TDECSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDS-TPPFLKLLPLEYSVQKGA 232

Query: 239  LILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDV 298
            +++GNK + S++++S +  D ++D   P  K+DLYK K+  E      +LK N+  + + 
Sbjct: 233  VVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESEN 292

Query: 299  SMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGL 358
             +K  + R K+S++W+   ++      P      +  K+   +  + +WRGL LY     
Sbjct: 293  PLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLK-RWRGLGLY----W 347

Query: 359  GERRNDIDD-IEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDV 417
             E     DD  +FD + HEYA+++ ++K   +      D PGIVPHGA PT   +DGPDV
Sbjct: 348  KEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDV 407

Query: 418  GNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYT 477
            GNSG PPDYS+DIQI G S+ +GPW+  +   L KL SPVVSR ++PV++LTPG +RIYT
Sbjct: 408  GNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYT 467

Query: 478  YGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFAL 537
              ++ + I+ ++ WRIPTRE+SKD EFL+ +RET  E RPFGW+++  S+ + V    A+
Sbjct: 468  RLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAM 527

Query: 538  CPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSS 597
            CPT  GF N + +H  + E R+SVNHDILL  +         +PLGWN +A W  +  S+
Sbjct: 528  CPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSN 587

Query: 598  QMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNN 657
            Q + FIL++HITL+ D ++DF SGEPTPYELFRPF Y+ NW   GYS+YLNVND NIVNN
Sbjct: 588  QCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNN 647

Query: 658  PLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXEFM 717
            P++FNENCYLSFHGD+L L+F +P+ +I    T I+Y + TP+FR            EFM
Sbjct: 648  PVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFM 707

Query: 718  KHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYF 777
            K KEVGRS +F + GSYL +S LD+DN+DTI+++C SK TTL+CYG+V+RY + VKMNYF
Sbjct: 708  KDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYF 767

Query: 778  GDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTE---- 833
            GDF HF T+EEY   +R                         Q ++   +R  H +    
Sbjct: 768  GDFVHFKTTEEYMEELRGT----NAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLT 823

Query: 834  LQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLL 893
             +++ LKR  NE D+WFTF V +G  +LPE +Y+CD C  L F  L IDLR  NYYMD+ 
Sbjct: 824  AKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQ 883

Query: 894  ANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQ 953
            A ++ + I+R +     E+FE   +    E    G LS L IH HRM+GLPP E TYFC+
Sbjct: 884  AALSPLRIRRLIDCGCEEVFEQKGRALCGEL-VAGRLSRLHIHTHRMFGLPPAEETYFCK 942

Query: 954  WDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSV 1013
            WDF LGTLD++SD+ F  GF +++ ++GFG+ D ENI+ Y+     DMTSVT+ ++ +  
Sbjct: 943  WDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVF 1002

Query: 1014 MLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTL 1073
               + K       +  ++   F D EN  YS+R+DL +  L  S  I +++ + K + + 
Sbjct: 1003 CTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTAS--IIDKNKSNKAIASF 1060

Query: 1074 ETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXX 1133
             T +KI+NF Q QD   H + Q+ +I  +DAP+HRC F++P   Q++  Y+ LFG I   
Sbjct: 1061 MTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIP-- 1118

Query: 1134 XXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFR------MPFSDQDYATDVSDDET 1187
                               E++   FQ  L+  +  +       P ++       S  + 
Sbjct: 1119 -----PGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDF 1173

Query: 1188 EEDIDP-LEFNTP-SEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIV 1245
            +  + P L+ NT  S +  +   E                P+  + IG  +     + I 
Sbjct: 1174 KGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIE 1233

Query: 1246 QIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEK 1305
            Q ID+IE+  V     +        N+++ +  LD+ + +           ++     + 
Sbjct: 1234 QFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQV 1293

Query: 1306 TVEENKEKKLI---------ELTVLNKIRSVRGTV-NQTAANSKNEERPP--ALSLVIEG 1353
            +++ + +K L          + T L KI S+   V N+    +K  E     A    ++ 
Sbjct: 1294 SLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKE 1353

Query: 1354 WEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFD---NQGLQIQDMIKTSDTIQKRK 1410
             E WS       +SL + S + +V   +  WL  +     N   Q+ + +    T Q RK
Sbjct: 1354 LEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYC-TGQFRK 1412

Query: 1411 IESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYL 1470
             E  +E    ++ AS+ YQI+HDP VITKPA+ITRL   HVRE+RSWKI+TRLRHIL YL
Sbjct: 1413 AE--QEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYL 1470

Query: 1471 PEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQ 1530
            P    S I   L  S+    +  A+  F+ +FSNW NW++SD+ + Y+YR++F N   + 
Sbjct: 1471 PTTLISDIFNDLKNSEYPPRST-AEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDT 1529

Query: 1531 EIHXXXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFN-- 1588
              H           +F +  + +      + I+          +   +++  R  + N  
Sbjct: 1530 VAH--ESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAE 1587

Query: 1589 ------ITGTLGTAKGKLSD----KIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLI 1638
                  ++  +  A+  LSD    K++ ++ L          K  E     + +      
Sbjct: 1588 DDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKLPAFQQYT----A 1643

Query: 1639 LCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATL 1698
            L +R ++Q+  G  R   + FG  L+++ E+ K   + A S A      E  ++H N  L
Sbjct: 1644 LVDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTIL 1702

Query: 1699 AEIQIRDFSLIVTTESWSYKPTIL-VNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQ 1757
             +   R  S  V    +S K +   ++ +     L   + +      I  + E+ + +  
Sbjct: 1703 LDAFSR--SSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRL 1760

Query: 1758 DLLAGT---RAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYF 1814
             L   T           E   P+  +N  ++   T+IS     +S   I    K+L + +
Sbjct: 1761 ALGPNTGFLEKPHSAATEKVAPQFALNIDISDLTTDISL----LSSLAITKNFKKLTLAY 1816

Query: 1815 NRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQL-----KGNMVNDPYHINLYLSA 1869
             +  S+ + L+    DI + S  T QQY + S  ++       K N  + P    + L +
Sbjct: 1817 EQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPP---TVKLDS 1873

Query: 1870 SILKLTVSDVQKLIPSFLQDEKILTESIEDFITL-DLFGL--SKNQKSKPEKDNNKF--- 1923
            +I KL + D + +     +D   + ++     +L   FG   +KN K    + N KF   
Sbjct: 1874 NITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFS 1930

Query: 1924 -SWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTK----MGSDIPNQSDISGQFSVENV 1978
             SW     +NY GLL P+GS  ++ EL  + A +T       +   +Q  + G  S  ++
Sbjct: 1931 ASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASI 1990

Query: 1979 LFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATN 2038
             F I +R LP  LS+++DF++ +   ++ +    + QIES +FR+ LSP SLVR+L+  N
Sbjct: 1991 AFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVN 2050

Query: 2039 QVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLN------VPSFHILSYNFCVGWLFS 2092
            ++S   +  K          R  +  +P++ ++           S  +LSYNFC+GW+F 
Sbjct: 2051 ELSRLSELQK----------RQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100

Query: 2093 VDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYL 2152
            V+   EPGLI GY RLF+A+EK  GKLTL+D +FSIA G++SD+F++     +  NRS+L
Sbjct: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFL 2160

Query: 2153 PNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGL 2212
            P+MQI YW +  G   +LF+R +GE LDV FLS  +DV    + S+  F ELKK  +   
Sbjct: 2161 PSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVD-- 2218

Query: 2213 PKKQKVNDDKTLELNTLS--PFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNS 2270
            P K   N  +    +T S  P L+ I+ + C+ +Y GGVF+++SL+D + ++ PSF++ S
Sbjct: 2219 PFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLES 2278

Query: 2271 PNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXX 2330
            P+V I  +Y+ + +    H +R+ + + S+HN ++  C P+L++    I+ ++       
Sbjct: 2279 PSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSP 2338

Query: 2331 XXXXXXXXXQ-NLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTT 2389
                     Q +LDY+  L   DI+  I   KQQ+S SCEPKAKVQAD+GF+     V T
Sbjct: 2339 QEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFT 2398

Query: 2390 NDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALIS 2449
            NDLD +EPLS S+ + +  A  +HIFSRE STSI +D +    + THPD I+ +G   I 
Sbjct: 2399 NDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIP 2458

Query: 2450 NINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLS---IAQLSDPESI-- 2504
            NI+++FN+KQLQ+L +F++IW+    + ++P  D   ++  +S     +A+     S   
Sbjct: 2459 NIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTS 2518

Query: 2505 IPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGR 2564
             PW F LI + +KGD+DLG SLGV+S+   R W  TDHY +  + L    +   LSS GR
Sbjct: 2519 FPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGR 2578

Query: 2565 LSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRV 2624
            L G   L+  SW+S + WP    +   PLV++ + +DE   K +FDYH+ LI ++   ++
Sbjct: 2579 LGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKL 2638

Query: 2625 HLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLR 2684
             L +++D  G+  +LL V     S  L  TAL  ANILD+YNT +RMR+DN+ SY ETL 
Sbjct: 2639 KLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLG 2698

Query: 2685 ESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARS 2744
            +SN  +++      DIL SL+ L+T++ V +  ++IQI P  LFD+EVL    +    +S
Sbjct: 2699 DSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQS 2758

Query: 2745 ETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPK 2804
            +    +KL T L+ Q++   ++LS  K ++ E   S+I VK Y+++A K  GGTI+ IP 
Sbjct: 2759 QIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPA 2818

Query: 2805 LLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRS---Q 2861
            +L+ MTT+ +  ++ +E LY+  F  K+ +RWNLG INF++EMW TH+RA+A+RRS   Q
Sbjct: 2819 ILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQ 2878

Query: 2862 VVGVLDGQSXXXXXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKR 2921
              G  + +                 ++YV LE P I++PQ +DLG+ATPP+EWFGVNRK+
Sbjct: 2879 PRGFFEDEHLEEKLRDVDLG---DEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2935

Query: 2922 FPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952
            FP  THQ  +  +QKL + AE E+A ILG +
Sbjct: 2936 FPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1807 bits (4680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1069/3016 (35%), Positives = 1656/3016 (54%), Gaps = 145/3016 (4%)

Query: 5    SQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKV 64
            S+F+ VP++  ++FSW+FL  W+L + +SL   FY GR + Y IT ILE+L WK   VKV
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDETQTK 124
                       GR+FFKN+T+I +D T SIL G+ITWRYWL ++RK          T  +
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRK----------TSLE 101

Query: 125  PTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSDSAT 184
              S K  +LPCRF +  +GLE F+YN+T A+DNI+    +E++   +KF ++     +  
Sbjct: 102  SQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEE 161

Query: 185  VKSMDDSQFXXXXXXXXXXXXXXAT---NDRVFQEEETDTSSFLRFLPIQFLVTRGSLIL 241
              + +DS                +T   NDR +Q   +   SFLR LP+++ V +G+LI+
Sbjct: 162  TSTENDSAAQKSHLETSMSSPSASTESLNDRTYQLPNS-MPSFLRLLPLEYSVQKGALII 220

Query: 242  GNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSMK 301
            GNK T S+++ S +     +D   P  K+DLYK KL +++   + +L+ N+ +D D  +K
Sbjct: 221  GNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLK 280

Query: 302  FKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQA----------KWRGLA 351
              L +       N   ++L   Y+   F  + +R      K ++          +WRGL 
Sbjct: 281  -NLPKA------NRLPKLLHKYYE--TFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLG 331

Query: 352  LYKGTGLGERRNDIDDI-EFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTIS 410
            LY      E     DD+  F+   HEYA++S ++K   +     HD PG+VPHGA PT+ 
Sbjct: 332  LY----WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLE 387

Query: 411  VLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTP 470
             LDGPDVGN GAPPD+SLDIQ+FG ++ +GPWA  +   + K+ SPVVSR + P +RL+ 
Sbjct: 388  PLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSA 447

Query: 471  GCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETT 530
            G  R++T  ++ + IM D+ WRIPTRE SKD +FL+ Y+ET  + RPFGW++L  ++ + 
Sbjct: 448  GSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSE 507

Query: 531  VNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATW 590
            V    A+CPT  GF N + +H  + E R+SVNHDILL  +  D +    +PLGWN +A W
Sbjct: 508  VRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKW 567

Query: 591  TINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVN 650
              +L S Q   FIL++HITL+ D L+DF +G+PTPY+LFRPFIY  NW++ GYS+YLNVN
Sbjct: 568  NFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVN 627

Query: 651  DHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXX 710
            D NIVNNP+DFNENCYLSFHGD+L + F +P+ SI    T I Y + TP+FR        
Sbjct: 628  DANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSW 687

Query: 711  XXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLI 770
                EFMK KEVGR+ DF + GSYL +S LD++N+DTI+++C S+ TTL+CYG+VVR+L+
Sbjct: 688  NTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLV 747

Query: 771  NVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRL 830
             VKMNYFGDF HF T+EEY   +R  +  ++                  +G D     + 
Sbjct: 748  GVKMNYFGDFVHFKTTEEYMEELR--DAYVEPKANSEQSANSTETTTAGEGEDKQNAPKN 805

Query: 831  HTE----LQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSC 886
            HT      ++  LKR  NE D+WFTF V +G L+LP+ +Y+C+ C    F  L IDLR  
Sbjct: 806  HTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYI 865

Query: 887  NYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPM 946
            NYYMDL A ++ V ++      P  +F    +         GS+S L IH HRM+GLPP 
Sbjct: 866  NYYMDLQAALSPVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPD 924

Query: 947  EPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTV 1006
            E TYFC+WDF +G LDI+SD+  +  F  +++++ F + D ENI+ Y+     DMTS+  
Sbjct: 925  EETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIF 984

Query: 1007 NLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGT 1066
            +  ++ V + +  ++ Y   ++ N+    +DFENE+YS+R D+ I ++   +    +DG+
Sbjct: 985  HAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGS 1044

Query: 1067 TKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQEL 1126
                F+  + +KIT F Q ++F  H   Q+ +I  +DAP+HRCSF+LP   Q ++ Y++L
Sbjct: 1045 LIGDFS--SSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKL 1102

Query: 1127 FGAIAXXXXXXXXXXXXXXXTTDFIIEDLL-GEFQDLLETSSPFRMPFSDQDYATDVSDD 1185
             G+I                    I+++ L GE   L   +  F     +  YA + +  
Sbjct: 1103 LGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASG 1162

Query: 1186 ETEEDIDPLEFNTPSEAIQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIV 1245
                        + +E   N + E               C   +    +F     +  + 
Sbjct: 1163 ----------LMSSTENDSNVESESLVVKLIKPQASISAC--CIKPFRSFSDQAYSNFVE 1210

Query: 1246 QIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWG-------SRTDTGVGIYLDRI 1298
            Q+ID  EI  V           +  NVK+     ++          S+T   V I +  I
Sbjct: 1211 QLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEI 1270

Query: 1299 --DFAMCEKTVEENKEKKLIE-LTVLNKIRSVRGTVNQTAANS--KNEERPPALSLVIEG 1353
              D +M E+    + EK  ++ +T L K+ S+   V+ T+ N   +N       S  I+ 
Sbjct: 1271 SVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKD 1330

Query: 1354 WEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIES 1413
             E W ++ + + +S N  S D  V   + E    +  N    I  + +     ++R  ++
Sbjct: 1331 LEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKA 1390

Query: 1414 RKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPED 1473
            +++    ++ AS+ YQI HDP VITKPA+ITRL   HVREN+SWKIITRLRHIL YLP  
Sbjct: 1391 QRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPS 1450

Query: 1474 WHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIH 1533
              + I  +L  +   A T +A  IF+++FS WR+WE SD+ + Y+YRK F +Q+  Q   
Sbjct: 1451 LLAEIYGALKSASFEAPT-NAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQ--- 1506

Query: 1534 XXXXXXXXXXASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTL 1593
                       S   TV  + ++ E + I  +   LL+     S+   S   I + T T 
Sbjct: 1507 AGPLNLRVEVDSCSATVSDSTHK-EGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATD 1565

Query: 1594 GTA--------KGKLSD---KIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTL-ILCE 1641
            G +        K  +S+   K++  + L  S    D   + +     K  KL  L +L +
Sbjct: 1566 GNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLID 1625

Query: 1642 RGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEI 1701
            R E++I + +     + FG  +S      +       S+A+     E  ++H NA + + 
Sbjct: 1626 RCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDA 1685

Query: 1702 QIRDFSL---IVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQD 1758
              R  SL   I  +ES +    + + SQ   L L   ++T      I  + E+   +   
Sbjct: 1686 FARRGSLGSFISQSESTTLH-RVHLGSQ--KLRLKVPSSTKDYCNFINSLSESWSSLAPK 1742

Query: 1759 LLAGTRAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFG 1818
            L   TR++ ++    +  K      +  F + IS     +SP  I    K L + F +  
Sbjct: 1743 LKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEIS----ALSPLSISKRFKGLTVQFEKEA 1798

Query: 1819 SNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYHI--NLYLSASILKLTV 1876
            ++ + L V + D+ L S +T QQY + S   ++L   + +    +   + L +++ K  +
Sbjct: 1799 NSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKL 1858

Query: 1877 SDVQKLIPSFLQDEKILTESIEDF-ITLDLFGLSKNQKSKPEKD------NNKFSWSIDT 1929
             D +++I +  QD     +++E   I L   G      S  E+         ++ W +D 
Sbjct: 1859 CDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLD- 1917

Query: 1930 NINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPNQSDISGQFSVENVLFFIKERALPV 1989
             + Y GLL P+G+  ++ E+  L +SL+   +   +   + G+ SV  + F I ++ LP 
Sbjct: 1918 -MKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFLINDKELPE 1976

Query: 1990 RLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVS--TSIQYY 2047
             LSK+L+F+ ++   +  +N+  + QIES+HFR+ L P SL+R+L    + +  + +Q  
Sbjct: 1977 DLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQAL 2036

Query: 2048 KDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNR 2107
            KD+      D      NI +         S  ILSY+FC+GW+F+ D  S  GL  GY R
Sbjct: 2037 KDNAGVKSSDDAKDFFNISQT------FHSIQILSYDFCLGWIFNNDGASNSGLTWGYQR 2090

Query: 2108 LFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTM 2167
            LF+A+EK  GKLTL+D +F IA G++S++F+ +  E D+ NRS LP+MQI YWF+  G+ 
Sbjct: 2091 LFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSE 2150

Query: 2168 RDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELN 2227
             +LFVR +GE LDV+FLS  + +      S+  FQELK+  +     ++ V         
Sbjct: 2151 DELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAF 2210

Query: 2228 TLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTK 2287
            +  P L++I  ++C+ +Y GGVFK++SL+D + ++ PSF++ SP+V +   Y  +    +
Sbjct: 2211 SKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKR 2270

Query: 2288 QHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXXXXXXXXXXQ-NLDYKR 2346
            +H +R+L+ ++S+HN L+  C P++S+    I+ ++                Q  ++Y+ 
Sbjct: 2271 KHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRS 2330

Query: 2347 LLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEK 2406
            LL   DI+  +   KQQ+SLSCEPKAKVQAD+GF+ F   + TND D  EPLS SL +  
Sbjct: 2331 LLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHN 2390

Query: 2407 TEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLF 2466
              A+ +HIFSRE STS+ ++ +    M THPD I+ +G A I  I+++FN+KQLQ+L +F
Sbjct: 2391 ITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVF 2450

Query: 2467 LDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESII-----PWCFTLIFTNVKGDVD 2521
            ++IW+L   + S+P  D       ++L     S  + +I     PW F +I + ++G++D
Sbjct: 2451 INIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEID 2510

Query: 2522 LGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVN 2581
            LG SLGV+S+  ++ W  TDHY +  + L    D  SLSS GRL G F L+   W+S++ 
Sbjct: 2511 LGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIK 2570

Query: 2582 WPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLK 2641
            WP +      PLV + + +DE + K  FDYH+ LI ++    + L +++D  GV+ +LL 
Sbjct: 2571 WPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLS 2630

Query: 2642 VTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDIL 2701
            V+   +S  +  TAL  ANI D+YNT +RMR+DN+ SY+ETL +SN  ++K   +  +IL
Sbjct: 2631 VSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEIL 2690

Query: 2702 RSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVY 2761
             SL+ L+T++SV +  ++IQ+ P TLFD+EV+       S  S+T   KKL T+L+++V+
Sbjct: 2691 SSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVH 2750

Query: 2762 DASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILE 2821
            +  ++LST K ++ E   S+I VK Y+++ASK+ GGTI+  P +L+ MTT+ +  ++ +E
Sbjct: 2751 NVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVE 2810

Query: 2822 YLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXX-----XXXX 2876
             LY+  F  K+ VRWNLG INF++EMW TH RA+A+RRS      +GQS           
Sbjct: 2811 LLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSH-----NGQSKSFFEDEHLGD 2865

Query: 2877 XXXXXXNFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQK 2936
                      + Y+ LE P I++PQ +DLG+ATPP+EWFGVNRK+FP  THQ  +  +QK
Sbjct: 2866 KLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQK 2925

Query: 2937 LVYSAEREYANILGSS 2952
            L + AE E+A ILG +
Sbjct: 2926 LAHLAESEWARILGRA 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1667 bits (4317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 993/2810 (35%), Positives = 1544/2810 (54%), Gaps = 125/2810 (4%)

Query: 210  NDRVFQEEETDTSSFLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEK 269
            NDR +Q   +   SFLR LP+++ V +G+LI+GNK T S+++ S +     +D   P  K
Sbjct: 12   NDRTYQLPNS-MPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTK 70

Query: 270  LDLYKFKLSAELINTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRF 329
            +DLYK KL +++   + +L+ N+ +D D  +K  L +       N   ++L   Y+   F
Sbjct: 71   IDLYKIKLQSDITKFQMSLRPNLCYDNDEPLK-NLPKA------NRLPKLLHKYYE--TF 121

Query: 330  THMHRRKNEHEDKFQA----------KWRGLALYKGTGLGERRNDI--DDI-EFDFANHE 376
              + +R      K ++          +WRGL LY       + ND   DD+  F+   HE
Sbjct: 122  LRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLY------WKENDPAWDDVFHFELPKHE 175

Query: 377  YAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGS 436
            YA++S ++K   +     HD PG+VPHGA PT+  LDGPDVGN GAPPD+SLDIQ+FG +
Sbjct: 176  YARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGAN 235

Query: 437  VCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTR 496
            + +GPWA  +   + K+ SPVVSR + P +RL+ G  R++T  ++ + IM D+ WRIPTR
Sbjct: 236  IHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTR 295

Query: 497  ESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALCPTVDGFKNNIKIHLTENE 556
            E SKD +FL+ Y+ET  + RPFGW++L  ++ + V    A+CPT  GF N + +H  + E
Sbjct: 296  EPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPE 355

Query: 557  TRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQMEAFILREHITLIADTLT 616
             R+SVNHDILL  +  D +    +PLGWN +A W  +L S Q   FIL++HITL+ D L+
Sbjct: 356  IRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILS 415

Query: 617  DFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSL 676
            DF +G+PTPY+LFRPFIY  NW++ GYS+YLNVND NIVNNP+DFNENCYLSFHGD+L +
Sbjct: 416  DFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRI 475

Query: 677  DFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXEFMKHKEVGRSYDFKVVGSYLI 736
             F +P+ SI    T I Y + TP+FR            EFMK KEVGR+ DF + GSYL 
Sbjct: 476  SFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLF 535

Query: 737  YSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRAN 796
            +S LD++N+DTI+++C S+ TTL+CYG+VVR+L+ VKMNYFGDF HF T+EEY   +R  
Sbjct: 536  HSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELR-- 593

Query: 797  EDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTE----LQRSDLKRTTNETDLWFTF 852
            +  ++                  +G D     + HT      ++  LKR  NE D+WFTF
Sbjct: 594  DAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTF 653

Query: 853  TVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEI 912
             V +G L+LP+ +Y+C+ C    F  L IDLR  NYYMDL A ++ V ++      P  +
Sbjct: 654  IVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHL 713

Query: 913  FEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRG 972
            F    +         GS+S L IH HRM+GLPP E TYFC+WDF +G LDI+SD+  +  
Sbjct: 714  FSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILS 772

Query: 973  FFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLY 1032
            F  +++++ F + D ENI+ Y+     DMTS+  +  ++ V + +  ++ Y   ++ N+ 
Sbjct: 773  FGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVT 832

Query: 1033 FTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLETKVKITNFVQSQDFDEHR 1092
               +DFENE+YS+R D+ I ++   +    +DG+    F+  + +KIT F Q ++F  H 
Sbjct: 833  ARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFS--SSLKITKFCQLKNFLVHS 890

Query: 1093 KTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXXXXXXXXXXXXXTTDFII 1152
              Q+ +I  +DAP+HRCSF+LP   Q ++ Y++L G+I                    I+
Sbjct: 891  MQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMIL 950

Query: 1153 EDLL-GEFQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTPSEAIQNDKCERX 1211
            ++ L GE   L   +  F     +  YA + +              + +E   N + E  
Sbjct: 951  DEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASG----------LMSSTENDSNVESESL 1000

Query: 1212 XXXXXXXXXXXXXCPDILDSIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTN 1271
                         C   +    +F     +  + Q+ID  EI  V           +  N
Sbjct: 1001 VVKLIKPQASISAC--CIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKN 1058

Query: 1272 VKINILYLDLFWG-------SRTDTGVGIYLDRI--DFAMCEKTVEENKEKKLIE-LTVL 1321
            VK+     ++          S+T   V I +  I  D +M E+    + EK  ++ +T L
Sbjct: 1059 VKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITAL 1118

Query: 1322 NKIRSVRGTVNQTAANS--KNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDE 1379
             K+ S+   V+ T+ N   +N       S  I+  E W ++ + + +S N  S D  V  
Sbjct: 1119 VKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHS 1178

Query: 1380 AQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITK 1439
             + E    +  N    I  + +     ++R  +++++    ++ AS+ YQI HDP VITK
Sbjct: 1179 DKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITK 1238

Query: 1440 PAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFI 1499
            PA+ITRL   HVREN+SWKIITRLRHIL YLP    + I  +L  +   A T +A  IF+
Sbjct: 1239 PAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPT-NAGEIFL 1297

Query: 1500 SVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTVYSAGYEVEH 1559
            ++FS WR+WE SD+ + Y+YRK F +Q+  Q              S   TV  + ++ E 
Sbjct: 1298 NIFSKWRSWESSDVEQCYMYRKAFYSQYEGQ---AGPLNLRVEVDSCSATVSDSTHK-EG 1353

Query: 1560 NFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTA--------KGKLSD---KIIMIK 1608
            + I  +   LL+     S+   S   I + T T G +        K  +S+   K++  +
Sbjct: 1354 DMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFR 1413

Query: 1609 NLLPSLKITDGGKSKETFDFVKSFKLNTL-ILCERGELQIDIGNTRLVSRVFGARLSMLW 1667
             L  S    D   + +     K  KL  L +L +R E++I + +     + FG  +S   
Sbjct: 1414 ELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFAL 1473

Query: 1668 ESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSL---IVTTESWSYKPTILVN 1724
               +       S+A+     E  ++H NA + +   R  SL   I  +ES +    + + 
Sbjct: 1474 VDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLH-RVHLG 1532

Query: 1725 SQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTIL 1784
            SQ   L L   ++T      I  + E+   +   L   TR++ ++    +  K      +
Sbjct: 1533 SQ--KLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVAFEAHV 1590

Query: 1785 TCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFR 1844
              F + IS     +SP  I    K L + F +  ++ + L V + D+ L S +T QQY +
Sbjct: 1591 DDFTSEIS----ALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLK 1646

Query: 1845 FSFGDLQLKGNMVNDPYHI--NLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDF-I 1901
             S   ++L   + +    +   + L +++ K  + D +++I +  QD     +++E   I
Sbjct: 1647 VSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKI 1706

Query: 1902 TLDLFGLSKNQKSKPEKD------NNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLAS 1955
             L   G      S  E+         ++ W +D  + Y GLL P+G+  ++ E+  L +S
Sbjct: 1707 HLLALGALFGTDSTDEEVFAGALWPREWLWQLD--MKYVGLLVPLGTTSYISEINELSSS 1764

Query: 1956 LTKMGSDIPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQ 2015
            L+   +   +   + G+ SV  + F I ++ LP  LSK+L+F+ ++   +  +N+  + Q
Sbjct: 1765 LSCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQ 1824

Query: 2016 IESSHFRVCLSPESLVRLLWATNQVS--TSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPL 2073
            IES+HFR+ L P SL+R+L    + +  + +Q  KD+      D      NI +      
Sbjct: 1825 IESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQT----- 1879

Query: 2074 NVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNS 2133
               S  ILSY+FC+GW+F+ D  S  GL  GY RLF+A+EK  GKLTL+D +F IA G++
Sbjct: 1880 -FHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGST 1938

Query: 2134 SDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIES 2193
            S++F+ +  E D+ NRS LP+MQI YWF+  G+  +LFVR +GE LDV+FLS  + +   
Sbjct: 1939 SNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGG 1998

Query: 2194 ALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIF 2253
               S+  FQELK+  +     ++ V         +  P L++I  ++C+ +Y GGVFK++
Sbjct: 1999 FARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLY 2058

Query: 2254 SLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLS 2313
            SL+D + ++ PSF++ SP+V +   Y  +    ++H +R+L+ ++S+HN L+  C P++S
Sbjct: 2059 SLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIIS 2118

Query: 2314 DFFERIQGMVXXXXXXXXXXXXXXXXQ-NLDYKRLLDSFDIALKITSAKQQLSLSCEPKA 2372
            +    I+ ++                Q  ++Y+ LL   DI+  +   KQQ+SLSCEPKA
Sbjct: 2119 EMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKA 2178

Query: 2373 KVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTL 2432
            KVQAD+GF+ F   + TND D  EPLS SL +    A+ +HIFSRE STS+ ++ +    
Sbjct: 2179 KVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVF 2238

Query: 2433 MFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSS 2492
            M THPD I+ +G A I  I+++FN+KQLQ+L +F++IW+L   + S+P  D       ++
Sbjct: 2239 MLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTN 2298

Query: 2493 LSIAQLSDPESII-----PWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMR 2547
            L     S  + +I     PW F +I + ++G++DLG SLGV+S+  ++ W  TDHY +  
Sbjct: 2299 LEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWT 2358

Query: 2548 KVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKA 2607
            + L    D  SLSS GRL G F L+   W+S++ WP +      PLV + + +DE + K 
Sbjct: 2359 QTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKL 2418

Query: 2608 AFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNT 2667
             FDYH+ LI ++    + L +++D  GV+ +LL V+   +S  +  TAL  ANI D+YNT
Sbjct: 2419 TFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNT 2478

Query: 2668 AMRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITL 2727
             +RMR+DN+ SY+ETL +SN  ++K   +  +IL SL+ L+T++SV +  ++IQ+ P TL
Sbjct: 2479 ILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTL 2538

Query: 2728 FDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNY 2787
            FD+EV+       S  S+T   KKL T+L+++V++  ++LST K ++ E   S+I VK Y
Sbjct: 2539 FDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEY 2598

Query: 2788 LQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEM 2847
            +++ASK+ GGTI+  P +L+ MTT+ +  ++ +E LY+  F  K+ VRWNLG INF++EM
Sbjct: 2599 IEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREM 2658

Query: 2848 WTTHIRAIAVRRSQVVGVLDGQSXX-----XXXXXXXXXXNFSRFKYVALEPPRIDMPQI 2902
            W TH RA+A+RRS      +GQS                     + Y+ LE P I++PQ 
Sbjct: 2659 WATHARAMALRRSH-----NGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQT 2713

Query: 2903 RDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952
            +DLG+ATPP+EWFGVNRK+FP  THQ  +  +QKL + AE E+A ILG +
Sbjct: 2714 KDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2763

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 1557 bits (4032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 994/3043 (32%), Positives = 1576/3043 (51%), Gaps = 195/3043 (6%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            MD  ++F+ + +  +R F W+FLV W   +++++   FYL R I YI+T IL W++WK  
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120
            KV +NIQSL  S++GG+++FKN++I  +D TISIL+G  TWRYWL N R  + + +++++
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120

Query: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFL--NEQI 178
              +K          CRF +  +G+E+F+YNK   Y++I+   +K ++    KF   +E I
Sbjct: 121  ENSK----------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESI 170

Query: 179  LSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDTSSFLRFLPIQFLVTRGS 238
                  VK+     F                 + V    ++    +L FLP + +++ G+
Sbjct: 171  F---GRVKTDSSVMFDPLDESSEQSKVGQTILNSV--SNQSAVPLYLDFLPAEVILSSGA 225

Query: 239  LILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGF-DED 297
            +++GNK TPS+ I+     + ++D A P   LD YK +   EL +T  ++K NI F +  
Sbjct: 226  VVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGS 285

Query: 298  VSMKFKLDRGKVSEVWNHFTR-MLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGT 356
             S K K+D GK   +W      +L  +   L FT  +++    +++F   W+GLA+Y   
Sbjct: 286  SSKKHKID-GKPFNLWQKLKDCLLFTISHILAFTG-NKKGLTGQEEFLTSWKGLAMYD-- 341

Query: 357  GLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPD 416
             +       D+I FD  NHEYAK+++IL + ++     +D PG++      T +++ G +
Sbjct: 342  -VATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYE 394

Query: 417  VGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIY 476
             G+    P+YS+D+Q++  +  +GPWA RQ  +  K+ SP VSR     ++   G  R +
Sbjct: 395  NGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREH 454

Query: 477  TYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFA 536
               +  + IM+D+ WRIPT+E SKD  FL  Y+ TN E R FGWID+K +K+T ++    
Sbjct: 455  ANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELG 514

Query: 537  LCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNS 596
            L  +  GF+N    +L      +SVNHD+L   K        S+P  WN   TW ++  S
Sbjct: 515  LQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFIS 574

Query: 597  SQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVN 656
            S +E FILR+H  L+ D  TDF+SG+  PYELFRP +Y  +W I  YSLYLN ND NIVN
Sbjct: 575  SDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVN 634

Query: 657  NPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXXXXEF 716
            NPLDFNENCY+S HG+   +   +P  +I+     ISY I TP F             EF
Sbjct: 635  NPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEF 694

Query: 717  MKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNY 776
            M  + VGRS++F   GSYL Y+D+DIDNVDTI ++C +   T   YGF++RY++N+K+NY
Sbjct: 695  MAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNY 754

Query: 777  FGDFFHFVTSEEYTGAIRANEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLH-TELQ 835
            FG+F  F T+EEY+  + A  +D+                         G   LH  ++ 
Sbjct: 755  FGEFAQFRTTEEYSEEL-AQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKKID 813

Query: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895
            ++ LKRT NE D+W TF   +G  +LPE+ Y+   C GLHF  +  D+R  +YY DL  +
Sbjct: 814  KASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFS 873

Query: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955
            MN   IKRY     + +F+    N     +  G LS   IH HRM+GLPP E TY  + D
Sbjct: 874  MNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKID 933

Query: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015
              LG L   SDIE L+GF    T+  FG+ + E++L YE     D++ ++   + +S+ L
Sbjct: 934  VSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRL 993

Query: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075
                 N + S  + N+    +DF   KYS R ++ IP  +F   +   D     L T+ T
Sbjct: 994  NNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDF--LVSSMDDHNIVLGTIST 1051

Query: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXX 1135
             +    F ++ DF      Q ++I L DAP+ RCSF+ PQEYQ ++ Y+ L+ +I     
Sbjct: 1052 SISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSS 1111

Query: 1136 XXXXXXXXXXXTTDFIIEDLLGE-FQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPL 1194
                         D I E+LLG+ +QD +   +             D+S+D T+  ++  
Sbjct: 1112 IPLLPEPIGPNNFDTIFENLLGDIYQDYISEGT------------FDISND-TKLQLNID 1158

Query: 1195 EFNTPSEA-------------IQNDKCERXXXXXXXXXXXXXXCPDILDSIGTFLMLFST 1241
            EF   SE              I ++  E                 D+L+         +T
Sbjct: 1159 EFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTT 1218

Query: 1242 ENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDL---FWGSRTDTGVGIY---- 1294
              I   ID + +  VN  S    GA  +T  K+    +D     +       V  Y    
Sbjct: 1219 FTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSD 1278

Query: 1295 LDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGT--VNQTAANSKNEERPPALSLV-- 1350
            ++++D  +  +  E +KE    E+   NK+     T  +N    + +N   P   S    
Sbjct: 1279 INKLDLNLRLRQ-EYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSY 1337

Query: 1351 ------IEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSD 1404
                  +EG+  +    +D V   N+    + +++   + +  +     L+    IK+  
Sbjct: 1338 KSTFEELEGYAFYD---DDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVT 1394

Query: 1405 TIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLR 1464
              +      ++EL+  +  A + Y I HDP VITKPA ITRLSR HVRE+RSW+I+TRLR
Sbjct: 1395 ISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLR 1454

Query: 1465 HILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFL 1524
            H+L YLP+ W+ T +  L + K   + +DAK  F+ +F+ WR+WEF+D+ R ++Y+K ++
Sbjct: 1455 HVLNYLPQYWYETTSLELQKGK-FRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513

Query: 1525 NQHSNQEIHXXXXXXXXXXASFFVTVYSAGYEVEH----NFIITRTNLLLETNSPTSDSS 1580
                               +S  +T+     + EH    +F+I   N    +++     +
Sbjct: 1514 PAE-------VTFAKTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSAVGESMA 1566

Query: 1581 LSRETIFNITGTLGTAKGKLSDKIIM-IKNLLPSLKITDGGKSKETFDFVKSFKLNTLIL 1639
                 ++    +L   +  +  KII+ +  L+ +LK          F++V S   N +++
Sbjct: 1567 AKSNNVYKTVVSLDELQINVDKKIILKLSKLIHTLK----------FEYVYS---NPIVV 1613

Query: 1640 -------CERGELQID-------IGNTRL---VSRVFGARLSMLWESPKDLTSQAVSLAV 1682
                   C+   LQ++       +GN  L     R++   L    +S  +     +S+ +
Sbjct: 1614 AKDANGRCKNISLQLNKITTNCFLGNVSLGFIFERIYVYSLIDTLDSGNN---SLLSVLL 1670

Query: 1683 YTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLHLMAMTATDILV 1742
            +   A++  ++    L  +   D    +T  S         +++  +++    +  DI+ 
Sbjct: 1671 FFDVAKLFFRYKTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFMNINSSIPSINDIIE 1730

Query: 1743 ASIKEIMENIHRIEQDLLAGTRAEKITKV-ESHGPKPKVNTILTCFFTNISFELMPISPF 1801
            A+  EI  +I+ I QD  +  +  ++  + +S   KP     +     NI  +L+   PF
Sbjct: 1731 AN-NEIRLHINEIGQDFASNIQYTELPVLPDSQVLKPIAMVKMNIAAINIQLQLL--LPF 1787

Query: 1802 FIRHEAKQLDIYFNRFGSNEIL---LSVWDADIYLTSHLTKQQYFRFSFGDLQLKG-NMV 1857
             +R+  K+ +I  + FG   IL   LS+ D  + L S   ++ Y ++S   L+L G ++ 
Sbjct: 1788 ILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLG 1844

Query: 1858 NDPYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPE 1917
            N      + L +S  KL++ + +K +  FL D +   ++IE   +  L       ++K  
Sbjct: 1845 NTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTML-------ETKSS 1897

Query: 1918 KDNNKFSWS------IDTNINYFGLLAPIGSAYFLFELRMLLASLTK-MGSDIPNQSDIS 1970
               N+F +S      ++ N+ Y GLL   G+  ++ E   L  S +K   S  P     S
Sbjct: 1898 TVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFS 1957

Query: 1971 GQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESL 2030
              +S E++ F IK+R +   LSK+LDFS+++  ++       + QIESS+    LSP SL
Sbjct: 1958 SDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSL 2017

Query: 2031 VRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVGWL 2090
            VRLL   N+ S     Y D         RS  +N      LP+++ S HILSYN C+GWL
Sbjct: 2018 VRLLSFVNEFSIMKSIYHDIKP------RSTSSN-STLSILPISIKSAHILSYNLCIGWL 2070

Query: 2091 FSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRS 2150
            F +   +  GLI GY RLF+ Y+K  GKLTL+D +FS+A+G SS  ++ +G EK   NRS
Sbjct: 2071 FDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRS 2130

Query: 2151 YLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIP 2210
            YLP+MQI+YW ++    +DLF+R +GE LDV+ L+ +  +++ A  S+  F++LK+ ++ 
Sbjct: 2131 YLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILD 2190

Query: 2211 GLPKKQKVNDDKTLELNTL-SPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVN 2269
              P K   ND    E N L +P  +++RSI+C   Y G   K++S +D +     SFE+ 
Sbjct: 2191 --PLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQ-HGTCSFEIR 2247

Query: 2270 SPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXX 2329
            SP   + ++YK+  ++ K HWIR+L  +N+THN L+  C PLL++ +     M+      
Sbjct: 2248 SPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQ 2307

Query: 2330 XXXXX--XXXXXQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTV 2387
                          ++Y+ LL++FDIA+ I   KQ++SL+CEP AK+QA IGF+ F   +
Sbjct: 2308 FSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKI 2367

Query: 2388 TTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTAL 2447
             TN +   EPL  S+ +    AS +H+FSRE S+S+ +  + +    TH + I+ +G+ L
Sbjct: 2368 FTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTL 2427

Query: 2448 ISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPE----- 2502
            IS    +FNVKQ+++L LFL+IW +    K K  NDI+ A   +S   +  S P+     
Sbjct: 2428 ISKPLFYFNVKQIEDLNLFLEIWSIE---KQKSVNDIILAPVTASSFESVPSMPKLQRVP 2484

Query: 2503 --SIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLS 2560
              +   W + LI + +  ++DLGPSLG++ V+    W  + H  +  + L        +S
Sbjct: 2485 INATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMS 2544

Query: 2561 SKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAIN 2620
            S GRL G   +K   W S++ WP     +  PLV +++ +   +TK +FDYHMF I  I 
Sbjct: 2545 SSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQ 2604

Query: 2621 NTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYI 2680
            N  + L +++D  G + DLL V+   ++I +  T+L  AN+ DIY+T  RMR D+  + +
Sbjct: 2605 NAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNL 2664

Query: 2681 ETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESI 2740
            + L ESNE +     + + +L SL  L+T++SV+   LN+ I   TL   EV+V+    +
Sbjct: 2665 DLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKV 2723

Query: 2741 ------SARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKI 2794
                   A S+T S  K+ TEL  Q+ D S+SLS+ K ++DE  + KI V +Y++ AS I
Sbjct: 2724 IANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASII 2783

Query: 2795 VGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRA 2854
             GG I+E P + V+M T+Q + S+++E LY+  F + +S+ WNL PINFIK+MW+ HI A
Sbjct: 2784 HGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINA 2843

Query: 2855 IAVRRSQVVGVLDGQSXXX-------XXXXXXXXXNFSRFKYVALEPPRIDMPQIRDLGD 2907
            + +R  Q      G S                     +++ Y  LE P I+MP+I+DLGD
Sbjct: 2844 MKLRHMQ-----KGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGD 2898

Query: 2908 ATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950
            ATPP+EWFG+NR RFP  THQ  V  +QKL   AE+EY  ILG
Sbjct: 2899 ATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 1369 bits (3544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 899/3013 (29%), Positives = 1483/3013 (49%), Gaps = 229/3013 (7%)

Query: 37   IFYLGRTIAYIITFILEWLLWKHAKVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILE 96
            IFY+GR + YI++     +LWK  +V V+IQSL  S L G++ FKNV++  +D  IS+L+
Sbjct: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65

Query: 97   GNITWRYWLFNTRKPEFQEASVDETQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYD 156
            G ITWRYWL    +   +  + D  +            CRF +  EG E F+YN+   YD
Sbjct: 66   GTITWRYWLIGRYR---RSGTADGARR-----------CRFALKFEGFEYFVYNRNGVYD 111

Query: 157  NIIQMFSKEERFQFEKFLNEQILSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQE 216
             I +    E+               + +V S+++                          
Sbjct: 112  RIARELDGEDTSA----------EPTVSVPSVEE-----------------------VIA 138

Query: 217  EETDTSSFLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFK 276
            E  D     RFLP++FL  +G+++LGNK T S+ I++ +     +    P +      F+
Sbjct: 139  ELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFR 198

Query: 277  LSAELINTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRK 336
              A++ N    +K NI ++ D  +K  ++  + + +W  +  +LG + +     H  R+K
Sbjct: 199  TEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEAT--LHAKRKK 256

Query: 337  NEHE-DKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQH 395
             +H+  K+   WRGL++Y    L E  ++  +++FD  +HEYAK +++LK+ ++  T  +
Sbjct: 257  EQHQTPKWYDNWRGLSMYD-VNLDEELDE--EVKFDIEHHEYAKCTTVLKADQMDVTYSY 313

Query: 396  DMPGI--VPHGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKL 453
             MPG   V    +    +L+ P++       D+S+DI ++  +  +GPWA RQ     ++
Sbjct: 314  GMPGTARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRV 366

Query: 454  LSPVVSRTAK---P---VKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQH 507
             SP V R  K   P    ++  P   ++       VTIM+D+  R+P +ESSKD  FL+ 
Sbjct: 367  FSPTVCRNFKLRTPEEIAQQTEPAAFKLS------VTIMEDSVLRVPMKESSKDAAFLEK 420

Query: 508  YRETNGEYRPFGWIDLKFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILL 567
            Y++T  E RPFGWID++ +KE+ +    A  PT +GF+N +  +L +    +SVNHD LL
Sbjct: 421  YKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLL 480

Query: 568  KCKYFDFDIDTSFPLGWNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYE 627
            K K  D  +D S+P GW D+A W  N+ S+Q E F+LR+H+ LI+D +TDFS GE   YE
Sbjct: 481  KAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYE 540

Query: 628  LFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITA 687
             FRPF Y   W I GYS YLNVND NI+NNP+DF ENCYLS HGD+  + F +P TSI  
Sbjct: 541  QFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQ 600

Query: 688  RHTDISYTIKTPMFRXXXXXXXXXXXXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDT 747
            ++  + + I TP F             E + +KE+GRS +F + GSY  YS++D+DNVD 
Sbjct: 601  KYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDA 660

Query: 748  IMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRA------------ 795
            + + C +    + CYG +++ ++NVK+NYFG+  HF T+EEY   ++             
Sbjct: 661  LNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPF 720

Query: 796  NEDDMQYAXXXXXXXXXXXXXXTMQGNDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVW 855
            N D   +               +      P        +++S LKR+ NE D+WFTF   
Sbjct: 721  NSDGNVHDSDVVATESNEIIDASFDAFGGP------PTIKKSALKRSINELDVWFTFISK 774

Query: 856  EGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEA 915
             G    PE IY  D C+G +F  L   LR  NYY+D   +++ +  KR+       +F+ 
Sbjct: 775  GGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKV 834

Query: 916  IHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFS 975
            I         +   LS  +   H+M G+ P E +Y C++D  + TLD+  D+  L+ F +
Sbjct: 835  IEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVN 894

Query: 976  SFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQ--EPKLNMYASFDLNNLYF 1033
            +   + FG+ D+EN L YE+E   D+  ++  +E ++V LQ  +   +++ S +L     
Sbjct: 895  TLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTL 954

Query: 1034 TFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRK 1093
            T  D  NE+YS R DL IP L F ++  + + T    F+  T V +T F + + F   R 
Sbjct: 955  TSFDLANERYSRRSDLSIPELLFGIYRGDSESTCLGAFS--TGVTVTLFERFEQFARCRV 1012

Query: 1094 TQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIE 1153
             QR++I ++DAP+HRCSF+LP EY+    Y+ L+G I                  + I E
Sbjct: 1013 LQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFE 1072

Query: 1154 DLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTPSEAIQNDKCERXXX 1213
             LLGE                 Q+YA+D S   T++ I   E +  ++ +          
Sbjct: 1073 KLLGEIY---------------QEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSL 1117

Query: 1214 XXXXXXXXXXXCPDIL--DSIGTFLMLFSTENIVQI------------IDDIEIATVNRL 1259
                          I+  D I  +L L +TE +++I            ID +EI  +N+ 
Sbjct: 1118 FIRSQNHQQTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQF 1177

Query: 1260 SNLREGAFKLTNVKINILYLDLFWGSRTDT----GVGIYLDRIDFAMCEKTVEENKEKKL 1315
                     ++ V++    + L   ++        +   +  +D     K+ + N +   
Sbjct: 1178 IQTFGEDNGISEVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDP 1237

Query: 1316 IELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDI 1375
             + T+  KI  +R  + Q       ++     S  IE  E + S  +  +   N+ S  +
Sbjct: 1238 EKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSV 1297

Query: 1376 TVDEAQLEWLFGYFDNQGLQIQDMIKTS-DTIQKRKIESRKELISSLTAASEYYQISHDP 1434
            T+     + LF +  N  +   D+++    + +   + S++E + ++      Y+I HDP
Sbjct: 1298 TLSPGTDKLLFEFL-NPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDP 1356

Query: 1435 YVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSL-TQSKTAATTQD 1493
             VITKPA ITR S  H+R   SW+II RLRHIL YLP++WH +  R L TQ  T+   ++
Sbjct: 1357 PVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSP--EE 1414

Query: 1494 AKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHXXXXXXXXXXASFFVTVYSA 1553
            A   F+S+FS+WR+WE +D+  S+++ K+F  + S                  F  +   
Sbjct: 1415 AGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSRP----------------FAAL--Q 1456

Query: 1554 GYEVEHNFIITRTNLLLETNSPTSDSSLS---RETIFNITGTLGTAKGKL---------- 1600
            G+    + I  R N+  +   P +   ++   R          G  +G +          
Sbjct: 1457 GFTFSSDDI--RLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRTEGSMPDPDYISFCT 1514

Query: 1601 SDKIIMI--KNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGE-------LQIDIGN 1651
            +D+++M   ++ + +LK        E  D +  FK+   +   + +       +    G 
Sbjct: 1515 TDEVVMRVDRSFVKTLK--------EFRDLIHRFKIGGPVGTAKHDNVSLFSNITFQFGK 1566

Query: 1652 TRLVSRVFGARLSMLWE--SPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLI 1709
              +V+++ G  L +  +  S   LTSQ+   +     + +   H+ A L     R  ++ 
Sbjct: 1567 LYVVAKLAGVYLRICLDNLSALMLTSQSSVESKVISSSTLSFDHMQAILGYRSFRFMTID 1626

Query: 1710 VTTES--WSYKP---TILVNSQCSDLHLMAMTATDI-LVASIKEIMENIHRIEQDLLAGT 1763
            +   S    Y P      ++ +    H+ + +AT   L  S+  + + I  + + L+   
Sbjct: 1627 IDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPEL 1686

Query: 1764 RAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEIL 1823
             AE   + ES G K     +      NI+ +L  +SPF I + A+  ++      S    
Sbjct: 1687 FAEPPIERESSGNKIHA-VLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFD 1745

Query: 1824 LSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYHINLYLSASILKLTVSDVQKLI 1883
            L+  ++ + ++S   K  YF+++   L+L G   +     ++     ILKL+V D++  I
Sbjct: 1746 LNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRI 1805

Query: 1884 PSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFSW------SIDTNINYFGLL 1937
               LQD K    S++     D+  +S++  +         SW      ++     Y GLL
Sbjct: 1806 TDLLQDIKAALFSMKSLS--DILNISQSSPTASAFG----SWFSILPDNLSLQATYAGLL 1859

Query: 1938 APIGSAYFLFELRMLLASLTKMG--SDIPNQSDISGQFSVENVLFFIKERALPVRLSKLL 1995
               G   ++ E     A  T+ G    I  +       S+E+  F IK+R +  RL+K++
Sbjct: 1860 LGFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVV 1919

Query: 1996 DFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNK 2055
            DF++  + +        + QIES+H ++ L+P ++VRLL   N+     + + +  +   
Sbjct: 1920 DFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESI--- 1976

Query: 2056 WDLRSKLNNIPKAPDLP-----LNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFS 2110
            +   S  NN      L      L + S HILS++F + WLF + + S  GLI GY+RLFS
Sbjct: 1977 YTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFS 2036

Query: 2111 AYEKNLGKLTLVDVFFSIANGNSSD-NFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRD 2169
             YEK  GKLTL++ +FS A   +S+ +F+S    K + N SYL +MQ+ YWF +     D
Sbjct: 2037 VYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTD 2096

Query: 2170 LFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNTL 2229
            LF+R HG  L V   +  + ++E  + S+QTF  LKK L+     K++ +D      N  
Sbjct: 2097 LFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWN 2156

Query: 2230 SPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQH 2289
            +     +RS++C   Y G   K+ S  D    + P  E+ SP+  + ++YK+  N  K H
Sbjct: 2157 NQLATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPNLEKTH 2214

Query: 2290 WIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXXXXXXXX----XXQNLDYK 2345
              R+LI    THN  Y+  A L+ D   R   ++                    +  D  
Sbjct: 2215 RFRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNS 2274

Query: 2346 RLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVE 2405
             LL S D+ + +   KQ+++ SCEPKAKVQA +GF+ F   +  N+++  E L  ++ +E
Sbjct: 2275 TLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIE 2334

Query: 2406 KTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYL 2465
                + +HI+SRE   S+ +  + +        V  ++G+ LIS+   +FN+KQLQ+L L
Sbjct: 2335 NLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKL 2394

Query: 2466 FLDIW---RLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDL 2522
            F+D W   +      S P   +V   + S  S        S   W +++I      +++L
Sbjct: 2395 FIDQWFPQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIEL 2454

Query: 2523 GPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNW 2582
            GPSLGV++V  +  W  +    +  + L        ++S GRL G F ++ A    E+ W
Sbjct: 2455 GPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKW 2514

Query: 2583 PTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKV 2642
            P        PLV + +  D + TK +FDYH F I ++      L +E+D +G + DLL V
Sbjct: 2515 PNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSV 2574

Query: 2643 TFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDILR 2702
            T   ES+ +  TAL AANI DI N+  R+++DN++SY+ +   S++   +P  +   I  
Sbjct: 2575 TVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEED-GGIFD 2633

Query: 2703 SLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYD 2762
            +L+LL+T +S+++    +QISP +LFD +VL++T   + A +   +  K+ T+L  Q+ D
Sbjct: 2634 TLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDD 2693

Query: 2763 ASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEY 2822
             S++L      +DE+ ++ + V  Y++ +S I GG I   P ++V+MTT+QE +S+++E 
Sbjct: 2694 VSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIEL 2753

Query: 2823 LYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSXXXXXXXXXXXX 2882
            LY+  F   + +RWNLGPI+FIK+MW  H+ A+ +R     G+ +               
Sbjct: 2754 LYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPL 2813

Query: 2883 NF---SRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVY 2939
                 S ++Y+ L+ P I+MP+I+DLGDATPP+EWFGVNR +FP FTHQ  +  +QKL  
Sbjct: 2814 EMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLAR 2873

Query: 2940 SAEREYANILGSS 2952
            +AE+EY  ILG +
Sbjct: 2874 TAEKEYEKILGRA 2886

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1585 (30%), Positives = 785/1585 (49%), Gaps = 120/1585 (7%)

Query: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60
            MD+ S F+ + ++ +++ S  FLV WIL VIL +   FYLGR +A+++T  L++ +W+  
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTR--KPEFQEASV 118
            K+K+N+QS+++S LGGRIFFKN+T++  D TIS LEG+ TWRYWL +TR    +F+    
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 119  DETQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQI 178
            D ++       N +LPCRF++  +GLE+F+YNK   Y+++++          + F N  +
Sbjct: 121  DASE-------NAKLPCRFLLQCDGLEVFVYNKIDVYESVLR----------DHFTN--V 161

Query: 179  LSDSATVKSMDDSQFXXXXXXXXXXXXXXATNDRVFQEEETDT---SSFLRFLPIQFLVT 235
              D    +S DD                 +      + + TD    S+  +  PIQ    
Sbjct: 162  TKDGQETESNDDITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLFPIQLEAN 221

Query: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295
            R +++LGN+ T  + +   + A  + D       LD Y+ K+S +L +    L+ N+G+ 
Sbjct: 222  RAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQ 281

Query: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355
             D  +K  +    + ++W    +    + K L         N+    +   W+GL LY  
Sbjct: 282  NDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQ--AYIDSWKGLDLYHH 339

Query: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415
            T   +  N    +       EYA++S ++K+ +V+ T   D+PGIVP  +    S  D  
Sbjct: 340  TKAVQEENVDTTV---LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRD 396

Query: 416  DVGNSGA---PPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGC 472
            +  N       P +  DI I+  +V +GPWA +    + +L SP+VSR      +  PG 
Sbjct: 397  ESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGS 456

Query: 473  RRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVN 532
             RIY   ++ V   D +   IPTRESSKD EF++ Y+ T   +R FGW+++  ++   + 
Sbjct: 457  LRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEIL 516

Query: 533  TTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTI 592
               ALC   D   N + + L   E +SSVNH++L +C       +  +P GWN +A W  
Sbjct: 517  FNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLF 576

Query: 593  NLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDH 652
             L+S   E F+LR+HI+LI+D  TDFS+ +   YELFRPF Y I W    Y L+LNVND 
Sbjct: 577  ELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDA 636

Query: 653  NIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRXXXXXXXXXX 712
            NI+NN LD NENC+LS  GD L+    +P TSI     + ++ +K+P+ +          
Sbjct: 637  NIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNT 696

Query: 713  XXEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINV 772
              EF+     G   DF + G+Y+ +  +D+DN DTI++D  S  T    +GFV+RYL+N+
Sbjct: 697  LHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNI 756

Query: 773  KMNYFGDFFHFVTSEEYTGAIRANEDD-------MQYAXXXXXXXXXXXXXXTMQGNDAP 825
            K+NYFGDF HF T+EEY+  +   ED         +                + Q  D  
Sbjct: 757  KLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTI 816

Query: 826  GRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRS 885
                +H    +S L RT NETD+W TF V +G +++PE +Y+C     L F  L  D+R 
Sbjct: 817  NENTIH----KSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRY 872

Query: 886  CNYYMDLLA--------NMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHG 937
             NY+MDL A        + N+ S  R V+       E  H  N       G L  L +HG
Sbjct: 873  TNYFMDLTAFFSRIYLNHSNEFSFNRVVA------IEESHSENT------GYLDDLNLHG 920

Query: 938  HRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKET 997
            HRM+G+PP+E TY C+WD  +G+L   SD +FL  F  +  ++GF Y D ENIL+Y    
Sbjct: 921  HRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHK 980

Query: 998  YDDMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFS 1057
             +D+TS+T+++ ++S +++       A+  LN++     D  N +YS R+DL++  +  S
Sbjct: 981  PEDVTSLTISIGRVSSIVRTNH-GGSATLSLNDITINSWDLSNSRYSKRVDLLVAAI--S 1037

Query: 1058 LFIKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILP-QE 1116
            +   +E  T   LFT +T V++T FV   +   HR TQ+  + L+D+P+HRC F+L   +
Sbjct: 1038 VCAIDEKKTV--LFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQ 1095

Query: 1117 YQDAEQYQELFGAIAXXXXXXXXXXXXXXXTTDFIIEDLLGEFQDLLETSSPFRMPFSDQ 1176
               +  Y +L G+I                T D I E LLG + +L+     F     D 
Sbjct: 1096 LNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLIN----FDTDIIDT 1151

Query: 1177 DYATDVSDDETEEDIDPLEFNTPSEAIQN---DKCERXXXXXXXXXXXXXXCPDIL---D 1230
               TD  D   ++ + PL  NT S  +     ++ E                P      +
Sbjct: 1152 KNLTD--DRPDDKRLLPLS-NTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAE 1208

Query: 1231 SIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAF-----KLTNVKINILYLDLFWGS 1285
            +   F++  STE+I+    ++ I  +  + ++  G F      L NVK+NI        +
Sbjct: 1209 NAAHFMLTMSTESIMDYF-EMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKT 1267

Query: 1286 RTDTGVGIYLDRIDFAMCEKTV-----------EENKEKKLI--ELTVLNKIRSVRGTVN 1332
            + +      LDR++ ++   +V           E++ E   I  + T+     S++  + 
Sbjct: 1268 QLEA-----LDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIF 1322

Query: 1333 QTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQ 1392
            +++ N   +  P A   ++    +  S V  +V+ L   S    + +A +EW   Y    
Sbjct: 1323 KSSKNRLTKVLPIAWFEILMFNTVLFSDV-GKVSKLIFGSIKSAILDADVEWTVEYLLKL 1381

Query: 1393 GLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVR 1452
                    K+   + K +    KE I  +    +   I   PY+ITKPA+ITRLS+ HVR
Sbjct: 1382 AKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVR 1441

Query: 1453 ENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGI------FISVFSNWR 1506
            +  SWKIITRLRH+  +       T + S T S+     ++ + I      F+ +F +W+
Sbjct: 1442 DTASWKIITRLRHVSKH-------TSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWK 1494

Query: 1507 NWEFSDIARSYIYRKLFLNQHSNQE 1531
            NW+  ++ +S ++  LF  + +  E
Sbjct: 1495 NWDVYEVEQSSLFTLLFSGESTVHE 1519

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/1177 (32%), Positives = 631/1177 (53%), Gaps = 64/1177 (5%)

Query: 1800 PFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVND 1859
            PF IR     LD  F       I+++    ++ L  +  + +  R S  +   K +  ++
Sbjct: 1779 PFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKLLRIS--NSVTKVDYRSN 1834

Query: 1860 PYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKD 1919
                ++ L   I+KLT+SD +  I         LT+S+   ++ +L  + KN+ +  E  
Sbjct: 1835 TLLTDIGLDTDIVKLTLSDNRVYIEE-------LTDSLNGTVS-ELIKIFKNKNADNEPA 1886

Query: 1920 NNKFS-WSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDI----PNQSDISGQFS 1974
              KF   S   N  Y GLL  + +  ++ E      S       +     N +       
Sbjct: 1887 APKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLV 1946

Query: 1975 VENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLL 2034
            ++NV   +    +   LSK+ D    +  ++   +   T QIE+ H RV L+P +L+ ++
Sbjct: 1947 IQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTLQIETPHSRVMLAPSTLIAVI 2004

Query: 2035 WATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLP--LNVPSFHILSYNFCVGWLFS 2092
            +   +   S+Q  K          + K N+   A ++P      S +ILS   C+GW+F 
Sbjct: 2005 FFIQEAKVSLQKVKQ---------KGKFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFE 2055

Query: 2093 VDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYL 2152
             D+  E G+++GY  LF+AYEK  GKLT+VD + + A G  S+NFF      +  NRS+L
Sbjct: 2056 EDT-DENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE-LNRSHL 2113

Query: 2153 PNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGL 2212
             +MQI++WF      +DLFVR + + LDV  L++ ++++    +S+++FQ+ K   I  +
Sbjct: 2114 SSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQK-KLAKISNI 2172

Query: 2213 PKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLED-AETQSEPSFEVNSP 2271
             KK  ++     E  +    + +IRSI+C  KY GG+  +++ +D A+   + S E+ SP
Sbjct: 2173 -KKSSISTHNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSP 2231

Query: 2272 NVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVXXXXXXXX 2331
            ++ + L+Y H     KQHWIRSL+ + STHNIL++ C P+L +    IQ  +        
Sbjct: 2232 SIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKK 2291

Query: 2332 XXXXXXXXQ-------NLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFI 2384
                    Q       + DYK L    D A+ I    Q ++L+CEP+AK+QAD+GF +F 
Sbjct: 2292 QLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFR 2351

Query: 2385 FTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHG 2444
             ++ T+  D +EPLS SL   + E S +HIFSRE S+S G++ V +  M TH + I  +G
Sbjct: 2352 ISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYG 2411

Query: 2445 TALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESI 2504
              LIS++  + N+KQLQ + LFLDIW        K  +     +     ++ + + P+  
Sbjct: 2412 NTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTPK-- 2469

Query: 2505 IPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGR 2564
            IPW + +IF N    +D+ PSLG I+ ++   W ++ H  +    +  + D  +  S GR
Sbjct: 2470 IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGR 2529

Query: 2565 LSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRV 2624
            L G+FE+K   + S ++WP        PL+++   +  +S+K  FDYH FLI  +++ ++
Sbjct: 2530 LGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQL 2589

Query: 2625 HLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLR 2684
             + +E+D +G++ DLL V+    S+ +  TAL +AN+ DIY T  RMR +NK SY++TL+
Sbjct: 2590 AIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLK 2649

Query: 2685 ESN-EAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISAR 2743
            ESN E+  K   +  ++L  L  L+T+++ +I +  + + P TLFD EVLV+    ++  
Sbjct: 2650 ESNPESSGKIHFSNNELLAPLR-LRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVE 2708

Query: 2744 SETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIP 2803
            + T + +K  T+L  Q+ D ++SL+  K E+ E   +++SV+ Y + A+ + G  I+  P
Sbjct: 2709 AATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAP 2768

Query: 2804 KLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVV 2863
             + V +TT+Q+     +E+LY+  F DK+ ++WNL PINFI+EMW TH+RA++VRR    
Sbjct: 2769 SVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRR---- 2824

Query: 2864 GVLDGQSXXXXXXXXXXXXNFS----------RFKYVALEPPRIDMPQIRDLGDATPPME 2913
                G +            N +          ++KY+ LE P I+MP +RDLG+ATPP+E
Sbjct: 2825 ----GHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIE 2880

Query: 2914 WFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950
            WFGVNRKRFP   HQ  V  +QKL+Y AE +Y   LG
Sbjct: 2881 WFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%)

Query: 5  SQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKV 64
          S+F+ VP++  ++FSW+FL  W+L + +SL   FY GR + Y IT ILE+L WK   VKV
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>ZYRO0E06534g Chr5 complement(493175..494323) [1149 bp, 382 aa] {ON}
            similar to uniprot|Q04370 Saccharomyces cerevisiae
            YMR026C PEX12 RING-finger peroxisomal membrane peroxin
            that plays an essential role in peroxisome biogenesis and
            peroxisomal matrix protein import forms translocation
            subcomplex with Pex2p and Pex10p
          Length = 382

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 2120 TLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEAL 2179
            T VD F+ +   N S+      + K+   + + P +Q +      G  R +F+    + +
Sbjct: 84   TFVDRFYGLQRFNCSNEVLVRKQAKNNNTKVWPPGLQFT-----KGQKRVVFI----QKV 134

Query: 2180 DVTFLSSYLDVIESALTSVQTFQELKKD 2207
             V +L   LD +ES   +  TFQE + D
Sbjct: 135  IVPYLKDRLDELESKWVAQSTFQEQRND 162

>NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa] {ON}
            Anc_8.478 YDR248C
          Length = 190

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 1576 TSDSSLSRETIFNITGTLGTAKGKLSDKII-MIKNLLPSLKITDG 1619
            T+DSS  RE I  + GT GT K  ++D I+   K   P L+  +G
Sbjct: 3    TTDSSTQREKIIVLAGTAGTGKSTIADLILRTFKKDFPKLEFVEG 47

>KLLA0B03894g Chr2 complement(352195..356871) [4677 bp, 1558 aa] {ON}
            similar to uniprot|P47170 Saccharomyces cerevisiae
            YJR138W IML1
          Length = 1558

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 2114 KNLGKLTLVDVFF--SIANGNSSDNFFSEG---KEKDKYNRSYLPNMQISYWFKDAGTMR 2168
            KN+G    + + F  SI   +SS N  + G   K  D Y R+ +  + I +W +   T+R
Sbjct: 338  KNIGTHHSISIMFCASIDRSDSSFNDVTSGERLKNTDDYYRAVVDQVNIVHWVEIMKTLR 397

Query: 2169 DLFVRFHGEALDVTFLSSYLDVIESALTSV 2198
              F+R   +  +V  L+  + VI+ +L SV
Sbjct: 398  KEFIRIAQDLRNVK-LNENVSVIKGSLPSV 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 307,302,266
Number of extensions: 13785554
Number of successful extensions: 40276
Number of sequences better than 10.0: 37
Number of HSP's gapped: 40535
Number of HSP's successfully gapped: 58
Length of query: 2952
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2824
Effective length of database: 38,804,151
Effective search space: 109582922424
Effective search space used: 109582922424
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)