Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050008.259ON1409140973960.0
Smik_12.1458.259ON1418142742060.0
NDAI0B019708.259ON1415141741880.0
Suva_10.1708.259ON1416136441620.0
TDEL0F038608.259ON1399140941570.0
Skud_12.1548.259ON1417137041430.0
YLR086W (SMC4)8.259ON1418141541330.0
KAFR0B027108.259ON1416143241230.0
ZYRO0C01716g8.259ON1413137140010.0
Kpol_392.88.259ON1427142839890.0
SAKL0H17094g8.259ON1422138139610.0
KNAG0G020208.259ON1444144639120.0
AGR089C8.259ON1370137037780.0
KLTH0G13750g8.259ON1399140337620.0
Ecym_43118.259ON1376136937160.0
TBLA0E044108.259ON1422138336830.0
Kwal_56.238258.259ON1396139536750.0
TPHA0J007208.259ON1393141036290.0
KLLA0F19085g8.259ON1372137634410.0
CAGL0L12188g8.259ON1398142233870.0
TPHA0P003408.68ON121913156992e-74
KAFR0C032008.68ON122313116931e-73
YFL008W (SMC1)8.68ON122513366912e-73
NDAI0G033208.68ON123113376868e-73
Smik_6.718.68ON122813266805e-72
Suva_6.528.68ON126413106805e-72
NCAS0C040008.68ON122313426681e-70
SAKL0B02288g8.68ON122813276619e-70
Skud_6.648.68ON123013296511e-68
KLLA0D07502g8.68ON124313456441e-67
Kwal_23.50438.68ON122513446422e-67
Ecym_73038.68ON122213196253e-65
CAGL0F02079g8.68ON122313396209e-65
TBLA0G035308.68ON123213466093e-63
ZYRO0F03828g8.68ON121713236065e-63
KNAG0G009108.68ON122613375889e-61
AGL023W8.68ON122213185861e-60
Kpol_1011.58.68ON122113195816e-60
Kwal_55.204217.186ON117013144271e-41
TDEL0C009608.68ON12227524244e-41
Kpol_1063.207.186ON117113054244e-41
KAFR0A016101.295ON122713583691e-34
KLTH0A02706g8.68ON12289993512e-32
KAFR0G029307.186ON11707283207e-29
YJL074C (SMC3)1.295ON123013813208e-29
Suva_6.1047.186ON117010653162e-28
Smik_7.3467.186ON11707273064e-27
CAGL0D05258g7.186ON117010793054e-27
Skud_6.1197.186ON11707333054e-27
ZYRO0D15642g7.186ON117010072949e-26
NCAS0E019207.186ON11707272893e-25
Ecym_43907.186ON11707222804e-24
KNAG0L011607.186ON11707242804e-24
Kwal_14.24351.295ON12478152634e-22
SAKL0F07282g7.186ON11704742616e-22
AGR236W7.186ON11703822572e-21
AAL182W1.295ON12317922572e-21
NDAI0G056301.295ON12297282553e-21
SAKL0D06116g1.295ON12297152473e-20
TDEL0D016201.295ON12237462464e-20
KLLA0D16005g7.186ON11701922393e-19
KLLA0A00286g1.295ON12248322341e-18
TPHA0C044407.186ON11701902277e-18
ZYRO0G21296g1.295ON122710412214e-17
Smik_10.1671.295ON12297252196e-17
Kpol_1018.21.295ON12117522187e-17
KLTH0H09966g1.295ON12249972162e-16
TDEL0H026107.186ON1170862053e-15
TBLA0D046107.186ON11741542026e-15
NDAI0G020707.186ON1171791991e-14
NCAS0A093301.295ON12271161992e-14
YFR031C (SMC2)7.186ON1170791982e-14
Suva_6.1491.295ON12301111946e-14
TPHA0I010901.295ON12161111946e-14
CAGL0H02805g1.295ON12191091873e-13
TBLA0C027401.295ON11191621873e-13
Ecym_63221.295ON12321141865e-13
Skud_10.1701.295ON12301111848e-13
KNAG0B052301.295ON12251891642e-10
KLTH0E04774g7.186ON1170731642e-10
KNAG0L006307.101ON11083991392e-07
SAKL0B09526g7.101ON10994141339e-07
KLLA0F07997g7.101ON11192891231e-05
KLTH0D02816g7.101ON10941611193e-05
Suva_15.1337.101ON10923891169e-05
Kwal_26.72047.101ON11171881151e-04
Ecym_26257.101ON10974071132e-04
TDEL0E013404.237ON1106851113e-04
CAGL0I02090g5.88ON11363051104e-04
KAFR0D013307.101ON10801971060.001
ZYRO0B12122g4.237ON1109781030.002
CAGL0F01155g7.101ON11052011030.003
Smik_15.1317.101ON10932571000.006
NCAS0I005707.101ON1095262990.007
CAGL0H05071g4.237ON111076990.008
NDAI0J021804.237ON1108154990.009
ZYRO0G01584g7.101ON1088421980.010
Kpol_1044.137.101ON1103189980.010
Skud_15.1217.101ON109388980.011
NCAS0J013904.237ON109668980.011
TPHA0B008404.237ON111968970.013
Skud_12.4684.237ON112068960.016
NDAI0A084507.101ON111962960.016
YOL034W (SMC5)7.101ON1093206960.017
YLR383W (SMC6)4.237ON111468960.017
Smik_12.4704.237ON111468960.018
Suva_10.5004.237ON111568960.018
KNAG0B060104.237ON111768960.019
TBLA0E021907.101ON1089159940.027
TPHA0L006007.101ON111762940.029
Ecym_53444.237ON110254940.031
KLLA0E05303g4.237ON109892940.032
TBLA0I028904.237ON1098211940.033
TDEL0H034907.101ON110364930.036
AEL337C7.101ON1097186930.036
SAKL0F14894g7.488ON1297270920.055
TPHA0B008304.238ON2536246910.083
Smik_2.677.488ON1377253890.11
AER044W4.237ON110353890.11
KLTH0D14080g4.237ON1102142890.12
Kpol_483.104.237ON1118207880.14
TBLA0A053001.67ON70763880.15
KAFR0A060404.237ON1102517870.19
SAKL0H03322g4.237ON111147870.20
YBL047C (EDE1)7.488ON1381245870.23
Kwal_26.93804.237ON110285860.28
AER045C4.238ON1292271860.28
TDEL0C035107.488ON1302180850.40
KAFR0H015208.484ON86092840.49
SAKL0H03300g4.238ON1707279820.72
NCAS0A149407.488ON1336248820.89
NCAS0G002305.702ON1735255820.90
KLLA0E21583g5.412ON39480801.1
KAFR0B014202.563ON321248791.2
SAKL0G11110g5.267ON1871238801.3
NCAS0B087001.67ON71572801.3
KLTH0D09504g8.604ON718219772.5
TDEL0G028102.351ON109463772.8
Kpol_483.114.238ON2546136773.2
Suva_2.707.488ON1380143773.2
SAKL0G08316g5.373ON18440733.6
NDAI0F020906.161ON108473763.7
NCAS0A007701.110ON1304121764.0
KLTH0F16544g5.412ON38567754.3
KLTH0G05632g5.609ON74178754.6
Smik_8.2425.88ON1168133754.9
Kpol_1050.695.88ON1084189755.0
AAL069C5.311ON665131755.2
CAGL0J11572g3.149ON460270745.9
CAGL0K05489g5.679ON34086736.2
Suva_15.3035.412ON40769736.2
TDEL0E013304.238ON1657176746.4
KNAG0D043404.238ON222086746.6
Skud_8.1685.412ON40769736.9
SAKL0F04026g7.163ON113999747.0
ZYRO0F17050g1.67ON71456737.9
CAGL0D00924g4.238ON1980212739.1
ABR049C2.558ON22373719.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05000
         (1409 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  2853   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1624   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1617   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1607   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1605   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1600   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1596   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1592   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1545   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1541   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1530   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1511   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1459   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1453   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1436   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1423   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1420   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1402   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1330   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1309   0.0  
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   273   2e-74
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   271   1e-73
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   270   2e-73
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             268   8e-73
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   266   5e-72
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   266   5e-72
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   261   1e-70
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   259   9e-70
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   255   1e-68
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   252   1e-67
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   251   2e-67
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   245   3e-65
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   243   9e-65
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   239   3e-63
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   238   5e-63
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   231   9e-61
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   230   1e-60
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   228   6e-60
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   169   1e-41
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   167   4e-41
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...   167   4e-41
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...   146   1e-34
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   139   2e-32
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   127   7e-29
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...   127   8e-29
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   126   2e-28
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   122   4e-27
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   122   4e-27
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   122   4e-27
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   117   9e-26
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....   115   3e-25
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   112   4e-24
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...   112   4e-24
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...   105   4e-22
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   105   6e-22
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   103   2e-21
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...   103   2e-21
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...   102   3e-21
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...   100   3e-20
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    99   4e-20
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    97   3e-19
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    95   1e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    92   7e-18
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    90   4e-17
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    89   6e-17
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    89   7e-17
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    88   2e-16
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    84   3e-15
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    82   6e-15
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    81   1e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    81   2e-14
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    81   2e-14
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    79   6e-14
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    79   6e-14
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    77   3e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   3e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    76   5e-13
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    75   8e-13
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    68   2e-10
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    68   2e-10
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    58   2e-07
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    56   9e-07
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    52   1e-05
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    50   3e-05
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    49   9e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    49   1e-04
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    47   4e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   0.001
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.002
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    44   0.003
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    43   0.006
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    43   0.007
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.008
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    43   0.009
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    42   0.010
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    42   0.010
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    42   0.011
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.011
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.013
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.016
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.016
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    42   0.017
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.017
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.018
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.018
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.019
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    41   0.027
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.029
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    41   0.031
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    41   0.032
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    41   0.033
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.036
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    40   0.036
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    40   0.055
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    40   0.083
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    39   0.11 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.11 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    39   0.12 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    39   0.14 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.15 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    38   0.19 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.20 
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    38   0.23 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.28 
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    38   0.28 
TDEL0C03510 Chr3 (612431..616339) [3909 bp, 1302 aa] {ON} Anc_7....    37   0.40 
KAFR0H01520 Chr8 complement(280214..282796) [2583 bp, 860 aa] {O...    37   0.49 
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    36   0.72 
NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON} Anc_...    36   0.89 
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    36   0.90 
KLLA0E21583g Chr5 (1926061..1927245) [1185 bp, 394 aa] {ON} simi...    35   1.1  
KAFR0B01420 Chr2 (268184..269149) [966 bp, 321 aa] {ON} Anc_2.56...    35   1.2  
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    35   1.3  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    35   1.3  
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    34   2.5  
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    34   2.8  
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    34   3.2  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    34   3.2  
SAKL0G08316g Chr7 complement(709133..709687) [555 bp, 184 aa] {O...    33   3.6  
NDAI0F02090 Chr6 complement(509708..512962) [3255 bp, 1084 aa] {...    34   3.7  
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    34   4.0  
KLTH0F16544g Chr6 (1342328..1343485) [1158 bp, 385 aa] {ON} high...    33   4.3  
KLTH0G05632g Chr7 complement(447986..450211) [2226 bp, 741 aa] {...    33   4.6  
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    33   4.9  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    33   5.0  
AAL069C Chr1 complement(226816..228813) [1998 bp, 665 aa] {ON} S...    33   5.2  
CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa...    33   5.9  
CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} simil...    33   6.2  
Suva_15.303 Chr15 complement(529184..530407) [1224 bp, 407 aa] {...    33   6.2  
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    33   6.4  
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    33   6.6  
Skud_8.168 Chr8 complement(300599..301822) [1224 bp, 407 aa] {ON...    33   6.9  
SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa] ...    33   7.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   7.9  
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    33   9.1  
ABR049C Chr2 complement(482243..482914) [672 bp, 223 aa] {ON} Sy...    32   9.5  

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 2853 bits (7396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1409/1409 (100%), Positives = 1409/1409 (100%)

Query: 1    MSLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLI 60
            MSLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLI
Sbjct: 1    MSLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLI 60

Query: 61   LGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLEL 120
            LGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLEL
Sbjct: 61   LGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLEL 120

Query: 121  IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG 180
            IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG
Sbjct: 121  IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG 180

Query: 181  PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG 240
            PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG
Sbjct: 181  PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG 240

Query: 241  DTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEV 300
            DTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEV
Sbjct: 241  DTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEV 300

Query: 301  ENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVD 360
            ENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVD
Sbjct: 301  ENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVD 360

Query: 361  REKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEK 420
            REKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEK
Sbjct: 361  REKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEK 420

Query: 421  SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKA 480
            SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKA
Sbjct: 421  SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKA 480

Query: 481  KTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTS 540
            KTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTS
Sbjct: 481  KTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTS 540

Query: 541  GISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA 600
            GISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA
Sbjct: 541  GISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA 600

Query: 601  LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN 660
            LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN
Sbjct: 601  LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN 660

Query: 661  VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQ 720
            VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQ
Sbjct: 661  VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQ 720

Query: 721  QCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD 780
            QCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD
Sbjct: 721  QCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD 780

Query: 781  TLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDD 840
            TLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDD
Sbjct: 781  TLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDD 840

Query: 841  YNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSA 900
            YNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSA
Sbjct: 841  YNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSA 900

Query: 901  EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEK 960
            EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEK
Sbjct: 901  EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEK 960

Query: 961  IMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITL 1020
            IMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITL
Sbjct: 961  IMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITL 1020

Query: 1021 ITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSF 1080
            ITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSF
Sbjct: 1021 ITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSF 1080

Query: 1081 EIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD 1140
            EIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD
Sbjct: 1081 EIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD 1140

Query: 1141 EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK 1200
            EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK
Sbjct: 1141 EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK 1200

Query: 1201 YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI 1260
            YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI
Sbjct: 1201 YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI 1260

Query: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320
            ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL
Sbjct: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320

Query: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1380
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ
Sbjct: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1380

Query: 1381 LVGIYKCENRTHSATIKNREILNSDINRE 1409
            LVGIYKCENRTHSATIKNREILNSDINRE
Sbjct: 1381 LVGIYKCENRTHSATIKNREILNSDINRE 1409

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1624 bits (4206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 860/1427 (60%), Positives = 1074/1427 (75%), Gaps = 42/1427 (2%)

Query: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISP------INNSKSHTPR 57
            P +KRQK    E   PE   +D  A   L++  Q    +++  P       + +KSHTPR
Sbjct: 5    PLSKRQKRKAVEE--PELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHTPR 62

Query: 58   KLILGQNDNRYAFSQPSVSSS-SFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKR 116
            KL+L   +NRYAFSQP+ S++ S  VP LQPP  +SSRGR D K+YSQSPPRSPGRSP R
Sbjct: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-GTSSRGR-DYKAYSQSPPRSPGRSPTR 120

Query: 117  RLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVVGPFHTSF 175
            RLEL+QLSPVKN+R++L++LY++H S +K++ RLFIN+L L NFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 176  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAI 235
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L SCSV V F Y I
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 236  DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295
            DE  G ++I E KP LVI+RKAFKNNSSKYYINGKES+YT+VTKLLK EGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 296  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENR 355
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ + +IE+LNE+C+EKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 356  FEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEE 415
            FEIVDREKNSLESGK  ALEFL KEKQLTL KSKL Q+ + Q+NSKL +TL+KIS+LN++
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 416  YNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL 475
            +  EK K Q    ++   K    E + +I   +  EK  +  +R LEG  VSL+E+ KNL
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 476  TQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535
              K  K+E+    T+++IS     ++EL   Q E+  E++ LNQ L+ ER  L+ +KL L
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 536  KEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEV 595
            K+KT  IS EI+ HE +LEPW++++QEK+++IQL ES++SLL+E Q KLK +++ + +++
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 596  SNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEAR 655
              + A K + ++ ++NLKK+ SS+  E S GE   +    KL+EM+ VLN  RQRA EAR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 656  LALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVET 715
             +L+  QN+ KVLTAL KLQKSGRI GFHGRLGDLG IDN++DVA+STACPRLDD+VV+T
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 716  VECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFY 775
            VEC QQCI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFDL+KPKD KF  AFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 776  SVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQ 835
            SVLRDTLVA+ LKQAN VAYG++R+RVVT+DGKLID+SGT+SGGGNHVSKGLM L     
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895
            N  DDY PE+V +IE +LS++E NF +AN+  +EME EL+ L +++P IE +ISK  ME 
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIA 955
            D+ ++E+   E+Q++E     ++ L D  ++ + ++NL++LK EH  LQ +TK KK+KI 
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 956  SLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSK 1015
             L+ +IMKIGG +LQ+QNSKV S+ QR+DIL AK KK ++  KKS+ ++ K +K L  S+
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1016 NDITLITDDIKEISERI--DKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEEN 1073
             D+ L ++++K I E++   K+  S N+I K  E F    E LK+E ++LK+ V + EEN
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDI-KMTETFNLRSE-LKEESEQLKEMVAETEEN 1078

Query: 1074 INEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAP 1133
            I+EFKS EIE+ NKLEKLN LL HIK +I   E  LS+L++R +   L  LD        
Sbjct: 1079 IDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILD-------- 1130

Query: 1134 NNGTL----SDEQIHDQTGHELTNTAVQD-----------DD--SMDIDNGAEVISNGLP 1176
             N T+    +D +I      E  ++  QD           DD  SMDID  +  +  G+P
Sbjct: 1131 -NNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIP 1189

Query: 1177 ILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKR 1236
              S++EL  LDI L+E E+S+L  YI+ T+ +I VLEEY +RL EFK RKLDLN AV KR
Sbjct: 1190 RFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKR 1249

Query: 1237 ETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1296
            + V+ Q+E LKK R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS
Sbjct: 1250 DEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1309

Query: 1297 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369

Query: 1357 KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            KERTKNAQFIVISLRNNMFELAQQLVGIYK +NRT S T+KN +ILN
Sbjct: 1370 KERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1617 bits (4188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 850/1417 (59%), Positives = 1082/1417 (76%), Gaps = 29/1417 (2%)

Query: 2    SLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQS---ISPINNSKSHTPRK 58
            ++P+ KRQKV E  S TPEQ  E+++ +    SPL R EHQQS   +SP   SKSHTPRK
Sbjct: 6    NIPSPKRQKVLE--SHTPEQQEENRREDDE--SPL-RFEHQQSAVSLSPPAISKSHTPRK 60

Query: 59   LILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSS--RGRKDIKSYSQSPPRSPGRSPKR 116
            LIL Q+DNRYAFSQP+VS+SS QVP+LQPP++SSS  RGR+DIK YSQSPPRSPGRSP R
Sbjct: 61   LILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTR 120

Query: 117  RLELIQLSPVKNNRI-KLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSF 175
            +LELIQLSPVKNNRI KL+ELY   NSQ KKERLFINKL LNNFKSYAG+QV+GPF+T+F
Sbjct: 121  KLELIQLSPVKNNRIRKLQELY---NSQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNF 177

Query: 176  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAI 235
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L SCSVDVEF Y +
Sbjct: 178  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVV 237

Query: 236  DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295
            D+ +G +KI + KPKL+I+RKAFKNNSSKY+INGKES+YT+VTKLLKEEGIDLDHKRFLI
Sbjct: 238  DKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLI 297

Query: 296  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENR 355
            LQGEVENIAQMKPKAE+E DDGLLEYLEDIIGT+ YK  IEK+ IE+++LNEICIEKENR
Sbjct: 298  LQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENR 357

Query: 356  FEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEE 415
            FEIV+REKNSLES KN ALEF++KE++LTLSKSKLLQYN+ + + KL +TLQK+S L EE
Sbjct: 358  FEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEE 417

Query: 416  YNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL 475
            Y  E +K +  Q E N+ +    +   KI  ++ + K     KR L+ +  SL+EK+K+ 
Sbjct: 418  YQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSY 477

Query: 476  TQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535
            T+KK K  K IA ++K + +  +EI+ L   Q+E    L++L  +L+ E+  LE +KL L
Sbjct: 478  TRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSL 537

Query: 536  KEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEV 595
            K+KT+ IS EI  HE +LEPW  ++QEKK EIQ+ ESQISLLQE Q KLK++I+ L  ++
Sbjct: 538  KDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDL 597

Query: 596  SNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEAR 655
              Q   K  +EE L++LK Q S+I+ E   GE+EC + +SK+K+M++VL  QRQ+  +AR
Sbjct: 598  KCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDAR 657

Query: 656  LALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVET 715
              LA V+N+ KVL+AL+KLQKSGRI GF+GRLGDLG IDN YD+A+STA  RLDDIVV++
Sbjct: 658  SRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDS 717

Query: 716  VECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFY 775
            VECGQ CIEYLRKNKLGYARFILL+KLR+     IQTP+NV RLFDL+KP    F+PAFY
Sbjct: 718  VECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFY 777

Query: 776  SVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQ 835
            SVLR+TLVAKDLKQANRVAYG  R+RVVT+DGKLID+SGT++GGG   ++GLM L++KGQ
Sbjct: 778  SVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQ 837

Query: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895
               D Y+ +D+E+IEK+L ++E NF+ AN+ ++EME  LQ+L +RKPE+ELEISK +M+ 
Sbjct: 838  ENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDT 897

Query: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIEN-LQKLKEEHLALQDKTKAKKKKI 954
            D  S E++S + QL++K        Q+ +E+ V IE+ L  L++E+  L D TK   +KI
Sbjct: 898  DISSKELESTQDQLKQKITFYERHTQNKDEV-VEIEHQLNLLQKEYQLLLDSTKNISEKI 956

Query: 955  ASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTS 1014
              LK++IM+IGGI+LQ+QNSKV SI+Q IDI+ +KQK+  +S KK + E+ +++K L  +
Sbjct: 957  DKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGA 1016

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
            + D    + ++   S+ ++ +  SL +ID++  + +     L+ EC  LK+K+ + E   
Sbjct: 1017 ELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEG 1076

Query: 1075 NEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQV---------LMALD 1125
             +FKS+EI+V ++LEKLN LL HIK  IK  ++ L  L LR    +         +  +D
Sbjct: 1077 TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVD 1136

Query: 1126 EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSA 1185
              S       G    +Q      + + N     +  M+ID+ A+  S G+P +S  +L  
Sbjct: 1137 RTSHG----GGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQ 1192

Query: 1186 LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE 1245
            +D+  +E E+  LE+Y+  T+ NI+VLEEY +RL ++ +RKLDLN AV++RE ++K L+E
Sbjct: 1193 IDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLLDE 1252

Query: 1246 LKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1305
            LKK RY+EFM GFGIISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPKKSWR
Sbjct: 1253 LKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWR 1312

Query: 1306 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1365
            NI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Sbjct: 1313 NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1372

Query: 1366 IVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            IVISLRNNMFELAQQL+GIYK +N+T SA I+N++ L
Sbjct: 1373 IVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1607 bits (4162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/1364 (60%), Positives = 1039/1364 (76%), Gaps = 16/1364 (1%)

Query: 51   SKSHTPRKLILGQNDNRYAFSQPSVSS-SSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRS 109
            +KSHTPRKL+L   +NRYAFSQP+ S+ SS  VP LQPP++ S RGR D K+YSQSPPRS
Sbjct: 56   AKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPS-RGR-DYKAYSQSPPRS 113

Query: 110  PGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVV 168
            PGRSP RRLEL+QLSPVKN+RI+L++LYD+H    +++ RLFI+KL L NFKSYAG+QVV
Sbjct: 114  PGRSPTRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVV 173

Query: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228
            GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L SCSV 
Sbjct: 174  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVA 233

Query: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288
            V F Y +DE  G ++I E KP LVI+RKAF+NNSSKYYINGKESNYT VTKLLK EGIDL
Sbjct: 234  VHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDL 293

Query: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348
            DHKRFLILQGEVENIAQMK KAEKESDDGLLEYLEDIIGT+ YK LIE  L +IE+LNEI
Sbjct: 294  DHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEI 353

Query: 349  CIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK 408
            C+EKENRFEIV+REKNSLESGK  ALEFLEKEKQLTL KSKL Q+ L Q+NSKL +TL+K
Sbjct: 354  CLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEK 413

Query: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468
             S+LN+++  EK K Q    E++  +    E + ++     +EK     KR LE   VSL
Sbjct: 414  TSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSL 473

Query: 469  DEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528
            +E+ KNL  K  K EKI+ +T  +IS     ++EL   Q E+  E++ LNQ L+ ER  L
Sbjct: 474  EERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRIL 533

Query: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588
            + +KL LK+KT  IS EI+ HE DLEPW++++QEKK++IQL ES++SLL+E QVKLK + 
Sbjct: 534  DDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNA 593

Query: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648
            + L + ++ + A K + +  +++LKK   S+    S GE + +    KLKEM+ +LN  R
Sbjct: 594  EALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHR 653

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708
            QRA EAR +L+  +N+ KVLTAL +LQKSGRI GFHGRLGDLG ID+ +DVA+STACPRL
Sbjct: 654  QRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRL 713

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768
            DD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FN   + TP+NVPRLFDL+KPKD 
Sbjct: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDP 773

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
            KF  AFYSVLRDTLVA+DLKQAN VAYG+RR+RVVT+DGKLID+SGTMSGGGNHV KGLM
Sbjct: 774  KFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM 833

Query: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888
             + +   +  DDY PE+V +IE +LS++EKNF +AN+  +EME EL+K+ +++P++E +I
Sbjct: 834  RIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQI 893

Query: 889  SKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTK 948
             +  ME D+ ++E+   E Q++E     +  + D  +L   ++ L+ L+ E+  LQ +TK
Sbjct: 894  LRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETK 953

Query: 949  AKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAK 1008
             KK++I +L+++IMKIGG  LQ+QNSKV S+ QRIDIL AK KK ++  KKS  ++ K +
Sbjct: 954  TKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQ 1013

Query: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068
            K L   + DI L ++++K I E+ ++I   L   D  +      K  L+++ ++LK+KV 
Sbjct: 1014 KQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVA 1073

Query: 1069 DLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALD--- 1125
            ++E  I+EFKS E+E+ NKLEKLN LL +IK+ IK  E  L++L++R +   L+ LD   
Sbjct: 1074 EMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQ 1133

Query: 1126 ------EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILS 1179
                  E  + +  N   +S E   +  G E  N    D   M+ID  ++ +S G+P LS
Sbjct: 1134 MDILDKEGEDRQETNQEDISGEAKGETQGEEGDN---DDRHCMNIDETSDEVSRGIPRLS 1190

Query: 1180 DDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETV 1239
            +DEL  L+I L+E ++ +L  YI++T+ +I VLEEY +RL EFK RKLDLN AV KR+ V
Sbjct: 1191 EDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEV 1250

Query: 1240 RKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1299
            ++QLE LKK R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP
Sbjct: 1251 KEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1310

Query: 1300 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1359
            PKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1311 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1370

Query: 1360 TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            TKNAQFIVISLRNNMFELAQQLVG+YK +NRT S T+KN +ILN
Sbjct: 1371 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1605 bits (4157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 815/1409 (57%), Positives = 1062/1409 (75%), Gaps = 25/1409 (1%)

Query: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILGQ 63
            P TKRQ+V + ES+      E +  N S +SPL         S  N++ SHTP+KL++G 
Sbjct: 5    PLTKRQRVNDNESR------EFEAVNGSTKSPL--------TSNSNSTISHTPKKLVIGT 50

Query: 64   NDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLELIQL 123
            ND+  + SQP VSSSS Q P+LQ P+SSS RGR+  ++YSQSPPRSPGRSP R+LELI++
Sbjct: 51   NDDTTSQSQPIVSSSSLQAPSLQHPNSSS-RGREQ-RTYSQSPPRSPGRSPTRKLELIKI 108

Query: 124  SPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNG 183
            SPVK NR++L+ LYDA  SQ    RL INKL L +FKSYAG+QVVGPFH+SFSAVVGPNG
Sbjct: 109  SPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNG 168

Query: 184  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTK 243
            SGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L SCSV+V F Y +DE DG T+
Sbjct: 169  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTR 228

Query: 244  ISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENI 303
            I E KP LV++RKAFKNNSSKYY+N KESNYT+VT+LLK+EGIDLDHKRFLILQGEVENI
Sbjct: 229  IDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENI 288

Query: 304  AQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREK 363
            AQM+PKAEKE +DGLLEYLEDI GT+KYK  IE  L EIE LNE CIEKENRF IVD+EK
Sbjct: 289  AQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEK 348

Query: 364  NSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKN 423
            +SLE+GK+ ALEFLEKEK LTL +SK++QY +WQN+ KLT+TL K S L  + + E  K 
Sbjct: 349  SSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKY 408

Query: 424  QTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTE 483
                 E++  K    +   +I+ L  EEK  L  KR L+ + V+++EK+K++ QK  K E
Sbjct: 409  SETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAE 468

Query: 484  KIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGIS 543
            K++ + + ++++  + ++EL +SQ +Y  EL+ LNQ+L +ER  LE +K+ LKEKT  IS
Sbjct: 469  KLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNIS 528

Query: 544  EEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKI 603
              I  +E DLEPW+ ++Q+K+ EIQL ES++SLL++   ++  DI+ L  E++     K+
Sbjct: 529  AGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKL 588

Query: 604  KREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQN 663
             +E+ +  LK+++S +T E+     EC+   ++LK+M  +L  QRQR  +AR A ++ QN
Sbjct: 589  AKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQN 648

Query: 664  RGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCI 723
            +  VLTAL KLQKSGRI GFHGRLGDLG ID  YDVA+STACPRL+DIVVE+VECGQQCI
Sbjct: 649  KSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCI 708

Query: 724  EYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLV 783
            EYLRKNKLGYARFILLDKLR F+T  IQTP+NVPRLFDL+KPKD KF+PAFYSVLRDTL 
Sbjct: 709  EYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLA 768

Query: 784  AKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNP 843
            A+ L QANRVAYG++R+RVV+LDGKLID+SGTMSGGG+HV +GLM L +      D ++P
Sbjct: 769  AQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSP 828

Query: 844  EDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIK 903
            E+V Q+E +L++KEK+F++A++ F EME++L+KL +R PEI+L++SK++ME +++ +E+K
Sbjct: 829  EEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELK 888

Query: 904  SKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMK 963
             KE+ L E+          NEE ++A   ++ LK+E  AL D+T   ++KIA LK+KIM+
Sbjct: 889  LKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIME 948

Query: 964  IGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITD 1023
            IGG ELQ+QNSKVTS +QR++ILT+KQKK + S KK++ EL+K+ K +  ++ D+ L + 
Sbjct: 949  IGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQ 1008

Query: 1024 DIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIE 1083
            +I  + E  D +  +L +++KS++E Q     + ++ D+LK ++  +E    EFKS +IE
Sbjct: 1009 EIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIE 1068

Query: 1084 VNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDE---ESEAKAPNNGTLSD 1140
            +N+KLEKLN LL HI  +++ LE  L+ L +R + + L  LDE    + +K PN      
Sbjct: 1069 INDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKR 1128

Query: 1141 EQIHDQTGHELTNTAV------QDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETE 1194
             +  D T  E   + V       +D+ M++D     + NGLP +S+ EL +LD+  +  +
Sbjct: 1129 TEGADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQ 1188

Query: 1195 VSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEF 1254
            + DL+ Y++S + ++E+LEEY KRL E K RK+DLN+AV +R+ +R++L ELKK R++EF
Sbjct: 1189 IEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEF 1248

Query: 1255 MHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGE 1314
            M GFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGE
Sbjct: 1249 MQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGE 1308

Query: 1315 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1374
            KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM
Sbjct: 1309 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1368

Query: 1375 FELAQQLVGIYKCENRTHSATIKNREILN 1403
            FELAQQLVGIYK +N T SA++KN +ILN
Sbjct: 1369 FELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1600 bits (4143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/1370 (60%), Positives = 1044/1370 (76%), Gaps = 23/1370 (1%)

Query: 51   SKSHTPRKLILGQNDNRYAFSQPSVSSS-SFQVPTLQPPDSSSSRGRKDIKSYSQSPPRS 109
            ++SHTPRKL+L   +NRYAFSQP+ S++ S  VP LQPP   SSRGR D K+YSQSPPRS
Sbjct: 56   ARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-KVSSRGR-DYKAYSQSPPRS 113

Query: 110  PGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVV 168
            PGRSP RRLEL+QLSPVKN+RI+L++LYD+H S  K++ RLFINKL L+NFKSYAG+QVV
Sbjct: 114  PGRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVV 173

Query: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228
            GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL +CSV 
Sbjct: 174  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVA 233

Query: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288
            V F Y IDE  G ++I E KP LVI+R+AFKNNSSKYYIN KES+YT+VTKLLK+EGIDL
Sbjct: 234  VHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDL 293

Query: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348
            DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ L +IESLNEI
Sbjct: 294  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEI 353

Query: 349  CIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK 408
            C+EK NRFEIVDREKNSLESGK  ALEFL+KEKQLTL KSKLLQ+ + Q+NSKL +TL+K
Sbjct: 354  CLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEK 413

Query: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468
            IS+LN E+  EK K Q    E++  K    + + +I      EK     KR LEG  VSL
Sbjct: 414  ISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSL 473

Query: 469  DEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528
            +E+ KNL  K  K EK + +T+ +IS      QEL++ Q E+  E++ LNQ L+ ER  L
Sbjct: 474  EERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIIL 533

Query: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588
            + +KL LK+KT  IS +I+ HE + EPW++++QEKK++IQL ES++SLL+E + KLK + 
Sbjct: 534  DDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNA 593

Query: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648
            + L +++ ++   K + +  +++L ++  S+    S GE +      KLKEM+ +LN  R
Sbjct: 594  EALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHR 653

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708
            QRA EAR +L+  QN+  VLTAL KLQKSGRI GFHGRLGDLG IDN++DVA+STACPRL
Sbjct: 654  QRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRL 713

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768
            DD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFD++KPKD 
Sbjct: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDP 773

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
            KF  AFYSVL+DTLVA+DLKQAN+VAYG+RR+RVVT+DGKLID+SGTMSGGGNHV KGLM
Sbjct: 774  KFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLM 833

Query: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888
             L     +  +DY PE+V +IE +L+++EKNF +AN+  +EME EL+K+ +++P++E +I
Sbjct: 834  RLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQI 893

Query: 889  SKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTK 948
            S+  ME D+ ++E+   E+Q +E     +  + +  ++   ++NL+ L+ E+  LQ +T+
Sbjct: 894  SRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETR 953

Query: 949  AKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAK 1008
             KK++I  L+++IMKIGG +L  QNSKV S+ QRIDIL  K KK ++  KKS+ ++ K +
Sbjct: 954  TKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQ 1013

Query: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068
            K L   + D  L ++++K I E++ +   +L   D ++ E    K  LKD+ ++LK+++ 
Sbjct: 1014 KQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLT 1073

Query: 1069 DLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES 1128
            ++EENI+EFKS EIE+ NKLEKLN LL HIKN+IK  +  L+ L++R +   L  LD  +
Sbjct: 1074 EMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLD-NN 1132

Query: 1129 EAKAPNNGTLSDEQIHDQTGHELTNTAVQDDD-------------SMDIDNGAEVISNGL 1175
            +     +G + DEQ  DQ       + + DD+             SM+ID  +  IS G+
Sbjct: 1133 QMDVVEDG-IKDEQDADQD----KPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGI 1187

Query: 1176 PILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDK 1235
            P L ++EL  LDI L+E+++S L  YI  T  +I VLEEYV+RL EFK RKLDLN AV K
Sbjct: 1188 PKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQK 1247

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1295
            R+ V++QLE LKK R++EFM+GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF
Sbjct: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307

Query: 1296 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1355
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1367

Query: 1356 IKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405
            IKERTKNAQFIVISLRNNMFELAQQL+GIYK +NRT S T+KN +IL  D
Sbjct: 1368 IKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1596 bits (4133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 843/1415 (59%), Positives = 1075/1415 (75%), Gaps = 18/1415 (1%)

Query: 4    PNTKRQK---VTEPESKTPEQGT--EDQQANASLRSPLQRPEHQQSISPINNSKSHTPRK 58
            P +KRQK     EPE  + +QG   ED Q    +      PE        + SKS+TPRK
Sbjct: 5    PLSKRQKRKSAQEPEL-SLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPRK 63

Query: 59   LILGQNDNRYAFSQPSVSSS-SFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRR 117
            L+L   +NRYAFSQP+ S++ S  VP LQPP  +SSRGR D KSYSQSPPRSPGRSP RR
Sbjct: 64   LVLSSGENRYAFSQPTNSTTTSLHVPNLQPP-KTSSRGR-DHKSYSQSPPRSPGRSPTRR 121

Query: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVVGPFHTSFS 176
            LEL+QLSPVKN+R++L+++YD H S SK++ RLFIN+L L NFKSYAG+QVVGPFHTSFS
Sbjct: 122  LELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSFS 181

Query: 177  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAID 236
            AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP L SCSV V F Y ID
Sbjct: 182  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVID 241

Query: 237  EHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLIL 296
            E  G ++I E KP L+I+RKAFKNNSSKYYIN KES+YT+VTKLLK EGIDLDHKRFLIL
Sbjct: 242  ESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLIL 301

Query: 297  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRF 356
            QGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ + +IE+LNE+C+EKENRF
Sbjct: 302  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRF 361

Query: 357  EIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEY 416
            EIVDREKNSLESGK  ALEFLEKEKQLTL +SKL Q+ L Q+NSKL +TL+KIS+ N++ 
Sbjct: 362  EIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDL 421

Query: 417  NVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLT 476
              EK K Q    +++  K    E + +I     +EK  +  +R LEG  VSL+E+ KNL 
Sbjct: 422  EDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLV 481

Query: 477  QKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLK 536
             K  K EK + +T+ +IS   + ++EL   Q E+  E++ L Q L+ ER  L+ +KL LK
Sbjct: 482  SKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLK 541

Query: 537  EKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVS 596
            +KT  IS EI+ HE +LEPW++++QEK+++IQL ES++SLL+E Q KLK +++ L +++ 
Sbjct: 542  DKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKIL 601

Query: 597  NQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656
             +   K + ++ +++LKK+ +S+  E S GE        KLKEM+ VLN  RQRA EAR 
Sbjct: 602  AKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARS 661

Query: 657  ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETV 716
            +L+  QN+ KVLTAL +LQKSGRI GFHGRLGDLG ID+++DVA+STACPRLDD+VV+TV
Sbjct: 662  SLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDTV 721

Query: 717  ECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYS 776
            EC Q CI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFDL+KPK+ KF  AFYS
Sbjct: 722  ECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYS 781

Query: 777  VLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQN 836
            VLRDTLVA++LKQAN VAYG++R+RVVT+DGKLID+SGTMSGGGNHV+KGLM L     +
Sbjct: 782  VLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSD 841

Query: 837  YFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEID 896
              DDY PE+V++IE++LS++E NF +A++  +EME EL+KL + +P++E +ISK  ME D
Sbjct: 842  KVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEAD 901

Query: 897  TYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIAS 956
            + ++E+   E+Q++E        + D  +L V ++NL++L+ E+  LQ +TK KK+KI  
Sbjct: 902  SLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKG 961

Query: 957  LKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKN 1016
            L+++IMKIGGI+LQ+QNSKV S+ Q++DIL AK KK +++ KKS  ++ K +K L  S+ 
Sbjct: 962  LQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSER 1021

Query: 1017 DITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINE 1076
            D+ L +D++K I E++     +L   D ++ E    K  LK++ ++LK+++ D+EE+INE
Sbjct: 1022 DVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESINE 1081

Query: 1077 FKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES----EAKA 1132
            FKS EIE+ NKLEKLN LL +IK++I   E  L++L++R +   L  LD+      +   
Sbjct: 1082 FKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDV 1141

Query: 1133 PNNGTLSDE----QIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDI 1188
             NN  L  E    +  D++  +   T+  +   M+ID  ++ +S G+P LS+DEL  LD+
Sbjct: 1142 KNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELDV 1201

Query: 1189 TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK 1248
             L+E+++++L  Y+E T+ +I VLEEY +RL EFK RKLDLN+AV KR+ V++QL  LKK
Sbjct: 1202 ELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKK 1261

Query: 1249 TRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS 1308
             R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+
Sbjct: 1262 KRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1321

Query: 1309 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1368
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1322 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1381

Query: 1369 SLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            SLRNNMFELAQQLVG+YK +NRT S TIKN +ILN
Sbjct: 1382 SLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1592 bits (4123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/1432 (57%), Positives = 1060/1432 (74%), Gaps = 51/1432 (3%)

Query: 4    PNTKRQKVTEPESK-TPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILG 62
            P +K+QKV   E + TP Q  +D             PE    ++  +  KSHTPRKL+LG
Sbjct: 5    PLSKKQKVVSDEERITPNQNEQDNDKT--------HPE----VTASSFLKSHTPRKLLLG 52

Query: 63   QNDNRYAFSQPSVSSSS-----FQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRR 117
              DN+Y  SQP +SSSS      QVP LQPP S  SRGR D K+YSQSPPRSPGRSP R+
Sbjct: 53   SADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGR-DKKAYSQSPPRSPGRSPVRK 111

Query: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177
            LELIQLSP+KNNRI+L++LY++ N    K RL+I+KL L +FKSYAG Q+VGPF+TSFSA
Sbjct: 112  LELIQLSPIKNNRIELQKLYNSKNQN--KVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSA 169

Query: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FP++ SCSV+V F Y IDE
Sbjct: 170  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDE 229

Query: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297
            +DG +KI E +  LV+ RKAFKNNSSKYYINGKESNYT+VT+LLKEEGIDLDHKRFLILQ
Sbjct: 230  NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQ 289

Query: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357
            GEVENIAQMK KAEKE DDGLLEYLEDIIGTSKYK LIE  ++EIE+LNEIC+EKE RFE
Sbjct: 290  GEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFE 349

Query: 358  IVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN 417
            IV+ EKNSLES K+ ALEF+ KEKQLTL +SKL QY L+Q N+KL  TL KIS       
Sbjct: 350  IVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQ 409

Query: 418  VEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ 477
             E+SK + +Q+EI+++ + L E+  KI     +E++ ++ KR  +G+ VS++E++KNLTQ
Sbjct: 410  EERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQ 469

Query: 478  KKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE 537
            KK K EK +      I    S +++L+  Q  Y  E   L ++L  ER  L+ +KL LK+
Sbjct: 470  KKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKD 529

Query: 538  KTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSN 597
            KT  IS +I ++E D+EPW  K+QEK+ +IQL ES+ISLL+E Q KLK  +  L  E+ +
Sbjct: 530  KTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDD 589

Query: 598  QTALKIKREED-----LVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRAS 652
                 +++E D     + NLKK+Q S+ KE+S GE+EC+  + K KEM+ +LN  RQRA 
Sbjct: 590  -----VRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAI 644

Query: 653  EARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIV 712
            +AR AL   +N+  VL+AL +LQKSGRI GFHGRLGDLG I + YD+A+STAC RLDDIV
Sbjct: 645  DARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIV 704

Query: 713  VETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVP 772
            V++VECGQQCIEYLRKNKLGYARFILLDKLR+F    +QTP+NV RLFDL++P D KF  
Sbjct: 705  VDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSN 764

Query: 773  AFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQR 832
            AFYSVLRDTLVA D++QANRVAYG+RRYRVVTLDGKLID+SGTM+GGG+HVSKGLM L+ 
Sbjct: 765  AFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKN 824

Query: 833  KGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKII 892
                + + Y   DVE+IE+DL+++E NF++A++   EM NEL++L +++PEIELEI+K++
Sbjct: 825  SNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLL 884

Query: 893  MEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKK 952
            M++D+ + ++  KE+QL+E        +   + L  A   LQ L+ EH AL+D++++KK+
Sbjct: 885  MDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKE 944

Query: 953  KIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLL 1012
            KI +LKE+IMKIGG ELQ+QNSKV+S+ +RI I+ AK KKD+ + K+++ EL+K ++   
Sbjct: 945  KINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFK 1004

Query: 1013 TSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEE 1072
             ++ D T   +D++ +   +  I + L   +   +     K+ L  +C+ LK+K+ D+EE
Sbjct: 1005 QAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEE 1064

Query: 1073 NINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE----- 1127
            ++NE+KSFEIE+ NKLEKLN LL++ K  I++L   L    +R + Q L  +  E     
Sbjct: 1065 SMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNS 1124

Query: 1128 ------------SEAKAPNNGTLSDEQIHDQTGHELTNTA---VQDDDSMDIDNGAEVIS 1172
                        S +  PN     DE   +   ++  N      QD D MD+DN  E +S
Sbjct: 1125 VGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVS 1184

Query: 1173 NGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDA 1232
             G+P L+DD+L ++D+  +E+E++ L+ Y+E+++A+IE+LEEY++RL EFK RKLDLN  
Sbjct: 1185 KGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTT 1244

Query: 1233 VDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1292
            V +R+ VR +LE+LKKTR++EFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1245 VARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEG 1304

Query: 1293 VTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1352
            VTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1305 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1364

Query: 1353 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404
            ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T SAT+KN++ILN 
Sbjct: 1365 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1545 bits (4001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/1371 (58%), Positives = 1063/1371 (77%), Gaps = 18/1371 (1%)

Query: 44   SISPINNSKSH--TPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKS 101
            + S   N+ +H  TPRKL++G  DNRYA S  S+SSSS QVP LQPP ++SSRGR   K+
Sbjct: 38   TTSSSQNTFAHAKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQPP-ATSSRGRGS-KT 95

Query: 102  YSQSPPRSPGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKS 161
            YSQSPPRSPGRSP R+LELIQ+SP+KN+R++L+++YDA  +Q++  RL I++L L +FKS
Sbjct: 96   YSQSPPRSPGRSPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKS 155

Query: 162  YAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPD 221
            YAG+QVVGPF+TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE++P 
Sbjct: 156  YAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPS 215

Query: 222  LTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLL 281
            L SCSV+V F Y IDE  G+T+I E KP LV++RKAF+NN+SKYY+N +E+NY +VTKLL
Sbjct: 216  LPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLL 275

Query: 282  KEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIE 341
            K+EG+DLDHKRFLILQGEVENIAQMK KAE+E +DGLLEYLEDIIGT+KYK LIEK+L +
Sbjct: 276  KKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLAD 335

Query: 342  IESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSK 401
            +ESLN+ICIEKENRF+IVDREKNSLE+GK  AL FLE E++LT+SKSKL QY++  +N K
Sbjct: 336  MESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMK 395

Query: 402  LTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRIL 461
            L NTL KI+ LN++   E  KN +++ E+++ +   +E +SK+K    EEKQ L  KR L
Sbjct: 396  LKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKREL 455

Query: 462  EGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQL 521
            +G++V  +EK+KN  +K+ K EK +++ +++ISS  + + EL++ Q +Y + L+ LN+Q 
Sbjct: 456  DGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQT 515

Query: 522  QSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQ 581
            + E+  LE +K  LK+KT+GIS EI   E +LEPWN ++QEKKT+IQL ESQISL++E +
Sbjct: 516  EVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAE 575

Query: 582  VKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMK 641
             KL  +I    QE+  +    ++  ++L +L  Q  S+ +EIS GE EC + R +LKEM+
Sbjct: 576  AKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQ 635

Query: 642  NVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAV 701
            N+LN QRQ+A +AR AL+N +N+ KVLTAL +LQKSGRI GFHGRLGDLG ID  YDVA+
Sbjct: 636  NILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAI 695

Query: 702  STACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFD 761
            STACPRL+DIVVETVECGQQCIEYLRKNKLGYARFILLDKLR FN ++I TP++VPRLFD
Sbjct: 696  STACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFD 755

Query: 762  LIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGN 821
            LI PKD KF  AF+SVL +TLVA DLKQANRVAYG++R+RVVTLDG LID+SGTMSGGG+
Sbjct: 756  LIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGS 815

Query: 822  HVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRK 881
             VS+GLM + R      + Y+ E+V Q+E +L ++EKNF++A++  Y+ME +L+ L  ++
Sbjct: 816  RVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKE 875

Query: 882  PEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHL 941
            P IE  IS++ MEI+++++EIK KE Q+ E     ++   +N EL+  I+++Q LK+E  
Sbjct: 876  PAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFK 935

Query: 942  ALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSD 1001
            ++Q++TK+KK +I +LK +IM+IGG EL++Q+SKV S++QRIDI+ +KQKK+R+  KK++
Sbjct: 936  SIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTE 995

Query: 1002 TELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECD 1061
             E+ K+ K  L +  D+     +I+ +   I+ +  SLN + +S+   Q  KE L +E  
Sbjct: 996  NEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESR 1055

Query: 1062 ELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVL 1121
             L+DK+ D+ E+I  FKSFE+E+ N+LEKLN L  H+K +IK  E+ L  L +R + Q+L
Sbjct: 1056 TLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQIL 1115

Query: 1122 MAL-DEESEAKAPNNGTLSD-EQIHDQTGH------------ELTNTAVQDDDSMDIDNG 1167
              L DE + A  P+   +SD E+     G             ++ +   Q D+ MD+++G
Sbjct: 1116 HDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDG 1175

Query: 1168 AEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKL 1227
             E    GL   S+DEL  ++I  +E E+ DL+ ++++++A+I+VLEEY +RL EFK+R+L
Sbjct: 1176 GEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRL 1235

Query: 1228 DLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLD 1287
            DLN AV++R  V+++L+ELKK R++EFM GFGIISMTLKEMYQMITMGGNAELELVD+LD
Sbjct: 1236 DLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLD 1295

Query: 1288 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
            PFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1296 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1355

Query: 1348 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKN 1398
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +N+T SATIKN
Sbjct: 1356 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKN 1406

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1541 bits (3989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 821/1428 (57%), Positives = 1051/1428 (73%), Gaps = 31/1428 (2%)

Query: 4    PNTKRQKVTEPESKTPE--QGTEDQQANASLRSPLQRPEHQQSISPIN--NSKSHTPRKL 59
            P +KR K+ E      E     +DQ+ N   R  ++     Q  + ++  N KS TP+KL
Sbjct: 5    PLSKRPKLVEANLNANELDHNDDDQRYN---RQEIKVSPTTQDAAAVSHLNFKSQTPKKL 61

Query: 60   ILGQNDNRYAFSQPSVS-SSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKR-- 116
            IL   D+       ++  SSS Q P+L PP  SSSRGR   ++YSQSPPRSP RSP R  
Sbjct: 62   ILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRT-ARTYSQSPPRSPARSPARSP 120

Query: 117  --RLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTS 174
              +LELIQLSPVKN+RI L+++Y++ N + + ERL I+KL L++FKSYAG QVVGPFH+S
Sbjct: 121  TRKLELIQLSPVKNSRIALQKIYESKN-EKQIERLCIDKLVLHDFKSYAGTQVVGPFHSS 179

Query: 175  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYA 234
            FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FPDL SCSV+V F Y 
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYV 239

Query: 235  IDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFL 294
            ID+ DG T I+  K KLVI+RKAFKNN+SKYYINGKESNYT VTKLLK+EGIDLDH RFL
Sbjct: 240  IDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFL 299

Query: 295  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKEN 354
            ILQGEVENIAQMKPKAE + DDGLLEYLEDIIGT+KYK LIEK   EIE+LNEICIEKEN
Sbjct: 300  ILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKEN 359

Query: 355  RFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNE 414
            RFEIVDREK SLESGK+ ALEFLEKEK+LTL KSKL QY LWQ+N KL+ TL+K+S + E
Sbjct: 360  RFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKE 419

Query: 415  EYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKN 474
            E+   K K+ T + ++N   +  +E    IK  + +EK+    KR  + E VSL+E+ KN
Sbjct: 420  EFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKN 479

Query: 475  LTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLK 534
            + +KK K EK +    KTIS+   +I++L K++ EY  +L+ LN QLQ ER  LE +K+ 
Sbjct: 480  IMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKIS 539

Query: 535  LKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQE 594
            LK+KT   S+EI  HE +LEPWN+++Q KK++IQ+ ES+ISL++EG+VKL+NDI+ L+  
Sbjct: 540  LKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSL 599

Query: 595  VSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEA 654
            +S +   KI RE+++ +L+ + + ITKE+S G+TE  + + KL+EMK VLN  RQ+A +A
Sbjct: 600  ISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDA 659

Query: 655  RLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVE 714
            R +L+  +N+ +VL +L++LQKSGRI GF+GRLGDLG ID+ YD+A+STACPRL+D+VVE
Sbjct: 660  RTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVE 719

Query: 715  TVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAF 774
            TVECGQQCIEYLRKNKLGYARFILL+KLR+F+ N I TP NVPRLFDL+   D KF+PAF
Sbjct: 720  TVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAF 779

Query: 775  YSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKG 834
            YSVLRDTLV  +LK ANRVAYG +R+RVVTL G+LIDVSGTMSGGG   S+GLM L + G
Sbjct: 780  YSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSG 839

Query: 835  QNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIME 894
             + F  Y  EDVE+IEK+L+ +EKNFE+AN  F EME EL++L +RKP++ELEISK  +E
Sbjct: 840  NSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELE 899

Query: 895  IDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKI 954
            I ++  E +  ++QL EK    +  + +NEEL      L  L+ ++ +LQ +TK+KK +I
Sbjct: 900  ITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRI 959

Query: 955  ASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTS 1014
              LK++IMK+GGI+LQVQ+SKV SI+Q+ DIL  K KKD+   KK++TEL++  K     
Sbjct: 960  KFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSEC 1019

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
              D+   TD ++    ++ KIS SL+  +  + E +  +E      + LKD++ + EEN+
Sbjct: 1020 STDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEFEENL 1079

Query: 1075 NEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPN 1134
            N FK F++E  NK EKLN LLN IK  I++ +  L  L +R +   L  LD  +  +   
Sbjct: 1080 NSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEE 1139

Query: 1135 NGTLSDEQIHDQTGHELTNTA-----------------VQDDDSMDIDNGAEVISNGLPI 1177
            + ++ D  +     + L N+                    +D  M+ID     IS G+P 
Sbjct: 1140 DVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPR 1199

Query: 1178 LSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRE 1237
            +S+DE   +D+  +E +   L+ YI++ + NI+VLEEY +R+ E+K RKLDLN+AVD+RE
Sbjct: 1200 ISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDERE 1259

Query: 1238 TVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1297
             VR+ L++LKKTR+EEFM GFG+IS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319

Query: 1298 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1357
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379

Query: 1358 ERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405
            ERTKNAQFIVISLRNNMFELA+QLVGIYK  N+T SAT++N +I+N D
Sbjct: 1380 ERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1530 bits (3961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 803/1381 (58%), Positives = 1033/1381 (74%), Gaps = 40/1381 (2%)

Query: 53   SHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSP-- 110
            S TPRKL+LG  + +YA+SQ   +SSS  VP LQPP+   SRGR+    YSQSPPRSP  
Sbjct: 52   SPTPRKLVLGSPEKKYAYSQ-PSTSSSLSVPNLQPPNVDGSRGRR---FYSQSPPRSPHR 107

Query: 111  --GRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKK--ERLFINKLTLNNFKSYAGQQ 166
               RSP RRLELIQLSPVKNNR +L+++YD  N    +   RL I+KL+L+NFKSYAG Q
Sbjct: 108  SPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQ 167

Query: 167  VVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCS 226
            ++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +P+L SCS
Sbjct: 168  IIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCS 227

Query: 227  VDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGI 286
            VD+ F Y +DE DG T+  + KP +VI+RKAF+NNSSKYYI+GKESNYT+VT+LL+++GI
Sbjct: 228  VDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGI 287

Query: 287  DLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLN 346
            DLDHKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGT+KYK  IE  L+EI++LN
Sbjct: 288  DLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLN 347

Query: 347  EICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTL 406
            ++C+EKENRFE+V++EKNSLESGK+ ALEFLEKEK LTL KSKL QY++WQ+  KL+ TL
Sbjct: 348  DVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETL 407

Query: 407  QKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHV 466
             KIS LNE    EK+K    Q E+ + ++  N+ + ++  L+ E K     +R+++ E  
Sbjct: 408  GKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKT 467

Query: 467  SLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERE 526
            S++EK +NL +K+ K EK++ +TE +++    +++EL  SQK+Y ++L  LN+ L  ER 
Sbjct: 468  SMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERS 527

Query: 527  SLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKN 586
             L+ +KL L++KTS IS EI  HE DLEPWN ++QEKK++++L ESQI++L+E + K   
Sbjct: 528  KLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQ 587

Query: 587  DIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNM 646
            +I  L  E+         +E  +  L+ +Q++I K I  GE EC    SKL EMKNVL  
Sbjct: 588  NIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLIS 647

Query: 647  QRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACP 706
             RQRA EAR  L+NV+N+ KVL+AL +LQ+SGRI GFHGRLGDLGTID+ YDVA+STACP
Sbjct: 648  HRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACP 707

Query: 707  RLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPK 766
            RLDDIVV+ VECGQQCIE+LRKNKLGYARFI+LDKLR FN + IQTP+ VPRLFDL++ K
Sbjct: 708  RLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSK 767

Query: 767  DSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKG 826
            + KF+PAFYSVLRDTLV  DLKQANRVAYG+RR+RVVTLDGKLID SGT+SGGG HV KG
Sbjct: 768  NGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKG 827

Query: 827  LMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIEL 886
            LM   +  Q     Y PE+V+ IEK+L+++EKNF +A   F++ME  L+K  +R+PEIE+
Sbjct: 828  LM---KSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEV 884

Query: 887  EISKIIMEIDTYSAEIKSKERQLQE-KTNIDNSELQDNEELKVAIENLQKLKEEHLALQD 945
            EI+K  ++I++ S E+K K+ QL+E +T+ D   ++D  EL  A   LQ L EE+  +++
Sbjct: 885  EIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVED-RELADAESKLQVLSEEYDEIEN 943

Query: 946  KTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELE 1005
            +TK K++ I SLKEKIMKIGG +LQ+QNSKV SI ++I+I+++KQKKDRT+ KK++ +L+
Sbjct: 944  ETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLK 1003

Query: 1006 KAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKD 1065
            + +     + NDI     +I +IS    ++ + +  +D S+ E ++ KE +++E + +K 
Sbjct: 1004 RLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKT 1063

Query: 1066 KVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMAL- 1124
             + +   N ++FKS EIE+NN+LEKLNGL +HIK +IK  +D L+ L +R + Q L AL 
Sbjct: 1064 NLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALN 1123

Query: 1125 ---------------DEESE------AKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMD 1163
                           DEE +      +  PN   + +EQ  +Q   + T+  +   DSMD
Sbjct: 1124 EGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEI---DSMD 1180

Query: 1164 IDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFK 1223
            ID      SNGLP  S+ +L ++ I  VE ++ +L  Y+++   +I+VLEEY +RL E+K
Sbjct: 1181 IDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYK 1240

Query: 1224 TRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELV 1283
             RKLDLN AV KR+ VRK  EELKK R ++FM GF IISMTLKEMYQMITMGGNAELELV
Sbjct: 1241 KRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELV 1300

Query: 1284 DSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1343
            DSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAA
Sbjct: 1301 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1360

Query: 1344 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T S T++N +ILN
Sbjct: 1361 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

Query: 1404 S 1404
             
Sbjct: 1421 G 1421

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1511 bits (3912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 800/1446 (55%), Positives = 1058/1446 (73%), Gaps = 55/1446 (3%)

Query: 4    PNTKRQKVTEPESKTPEQG---------TEDQQANASLRSPLQR--PEHQQSISPINNSK 52
            P++K+++    ++ TP Q           +++  N + +S L    P+ Q S+SP++  K
Sbjct: 5    PSSKKRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPLDFKK 64

Query: 53   SHTPRKLILGQNDNRYAFSQPSVS-SSSFQVPTLQP---PDSSSSRGRKDIKSYSQSPPR 108
            + TPRKLI+G ++N+YA SQP+ S SSS QVP LQ    P S  SRGR+ IK YSQSPPR
Sbjct: 65   TVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR-IKMYSQSPPR 123

Query: 109  SPGRSPKR----RLELIQLSPVKNNRIKLRELYDAHNSQ-SKKERLFINKLTLNNFKSYA 163
            SPGRSP R    +LELIQLSP+KN+R++L++LYDAHN++  K  RL+I+KL L+NFKSYA
Sbjct: 124  SPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183

Query: 164  GQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLT 223
            G+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+F +L 
Sbjct: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243

Query: 224  SCSVDVEFLYAIDEH----DGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTK 279
             CSV+V F Y  DE+    DGDT   E +  LVI+RKAFKNNSSKY+INGKESN+T+VTK
Sbjct: 244  FCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301

Query: 280  LLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339
            LLKE+GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT  YK LIE+  
Sbjct: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361

Query: 340  IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNN 399
            +EIE++NE+CIEKENRF IVD EKNSLE  K+ ALEFLEKEKQLTL KSKL QY+L+ NN
Sbjct: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNN 421

Query: 400  SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
             K+  TL +I +L  ++  EK ++     E+   +  ++ES++ +  L  EEK  ++ KR
Sbjct: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481

Query: 460  ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519
             +  + VSL+E  KNL QK  K +  + +++  IS    E+QE  + Q+EY  E+  L++
Sbjct: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSK 541

Query: 520  QLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQE 579
            Q + E + L  +KL+LK+KT   S+EI   E +LEP N ++QEKK++I+LVE +I L+++
Sbjct: 542  QREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601

Query: 580  GQVKLKNDIKVLSQEVSNQTALKIKR-----EEDLVNLKKQQSSITKEISNGETECNDGR 634
             + K+  +I+ L +E+     LK+++     E+D+ +L K + ++ KE   G+ EC D  
Sbjct: 602  SKRKVGAEIESLKEEL-----LKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAG 656

Query: 635  SKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTID 694
             KL EMK +LN  RQ+  EAR  ++  QN+ KVLT+L ++Q+SGRI GFHGRLGDLG I 
Sbjct: 657  VKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIA 716

Query: 695  NTYDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPK 754
            + YDVA+STACPRLDD+VVE+VECGQ CIE+LRKNKLGYARF++LDKL+ F+ + IQTP+
Sbjct: 717  DQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPE 776

Query: 755  NVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSG 814
            NVPRLFDL+KPK+ +F PA YSVLRDTLVAKDLKQANRVAYG+RR+RVVTLDG+LID+SG
Sbjct: 777  NVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISG 836

Query: 815  TMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENEL 874
            TMSGGG+ V KGLM L  K     + ++ ED++++E +L+ +EK F++A+  F+ ME EL
Sbjct: 837  TMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQEL 896

Query: 875  QKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQ 934
            +KL +R+P++ELEISK +++ID  + +I+    QL EK+N     ++D ++L + + NL+
Sbjct: 897  RKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLE 956

Query: 935  KLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDR 994
             L +E   LQD++K   ++++ LK++IM+IGG ELQ+QNSKV+S+ QRIDIL AK KK +
Sbjct: 957  ALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSK 1016

Query: 995  TSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKE 1054
            T  KK +TEL+KA+K+L+ S  + T  T++I     R +   +SL +I+KS+E  Q  K 
Sbjct: 1017 TVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKI 1076

Query: 1055 TLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTL 1114
             L+ E +   DK+ +  EN+NEFK+ ++E+ NK+E+ N +L+++K +   L + L+   L
Sbjct: 1077 NLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRL 1136

Query: 1115 RKMHQVLMALDEESEAKA---PNNGT-------------LSDEQIHDQTGHELTNT--AV 1156
            R +   L  L EE   +A   P  GT              +D  + +     L+N+    
Sbjct: 1137 RDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVA 1196

Query: 1157 QDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYV 1216
             D+ SMD+D+  +++S G+P LSD ELS +D   +  E++ L+ +I +   NIE+LEEY 
Sbjct: 1197 SDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYA 1256

Query: 1217 KRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGG 1276
            KRL EFK RK+DLN++V +R  +   +EELKK RY EFM GF IISMTLKEMYQMITMGG
Sbjct: 1257 KRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGG 1316

Query: 1277 NAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1336
            NAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1317 NAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1376

Query: 1337 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK EN T +ATI
Sbjct: 1377 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATI 1436

Query: 1397 KNREIL 1402
            +NRE L
Sbjct: 1437 RNREDL 1442

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1459 bits (3778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 764/1370 (55%), Positives = 998/1370 (72%), Gaps = 36/1370 (2%)

Query: 55   TPRKLILGQNDNRYAFSQPSVSSSSFQV--PTLQPPDSSS-SRGRKDIKSYSQSPPRSPG 111
            TP KL+    D +   S+ S  S++  +  P+LQPP +   SRGR     YSQSPPRSP 
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRS---QYSQSPPRSPN 70

Query: 112  RSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPF 171
            RSP R +ELIQLSP+KN+R++L+ LYD    Q K ERL I  L L NFKSYAG+QVVGPF
Sbjct: 71   RSPGRAVELIQLSPIKNSRLELQRLYDT--KQKKVERLCIRTLVLENFKSYAGRQVVGPF 128

Query: 172  HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEF 231
            H+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSEK+PDL  CSV+++F
Sbjct: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188

Query: 232  LYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHK 291
             Y +DE DG T++   KP+L + RKAFKNN+SKYY+NGKES YT+VT+LL++EGIDLDHK
Sbjct: 189  QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHK 248

Query: 292  RFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIE 351
            RFLILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT+KYK  IE+ L+E++SLN+IC+E
Sbjct: 249  RFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICME 308

Query: 352  KENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISA 411
            KENRF++V++EK SLE GK+ AL FL+KEK LTL  SK  QY+L+ N SKL  TL  +S 
Sbjct: 309  KENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSN 368

Query: 412  LNEEYNVEKSKNQTLQNEI----NRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVS 467
               +   EK+K    Q EI    + ++QL N    ++  +    K+ L   R LE E VS
Sbjct: 369  TMNKLEQEKAKKVEAQKEIVELTDASEQLAN----RLVSMNNTNKESLAKMRQLERELVS 424

Query: 468  LDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERES 527
             +EK K+L QK++K EK + T EK+I    ++I+E     +EY   L TLN  +   +  
Sbjct: 425  NEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAE 484

Query: 528  LEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKND 587
            LE MKL L +KT  I++E+ + E +LEPW  KV+EKK+EI+LVES+IS+++E  +KL+++
Sbjct: 485  LEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESE 544

Query: 588  IKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQ 647
            I  LSQE+         REE +  L  + SSI   I  GE EC   RSKL+EMK VL   
Sbjct: 545  IANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTH 604

Query: 648  RQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPR 707
            RQR ++AR A+++ +N+ KVLTAL +LQKSGRI G+HGRLGDLGTID+ YD+A+STACPR
Sbjct: 605  RQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPR 664

Query: 708  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKD 767
            LDDIVV+TVECGQQCIE+LRKNKLGYARFILLDKLR FN     TP+NVPRLFDL+KPK+
Sbjct: 665  LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKE 724

Query: 768  SKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGL 827
             KF PAFYSVLRDTLV  DL QANRVAYG++RYRVVTLDGKLID+SGTM+GGG+  + GL
Sbjct: 725  PKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGL 784

Query: 828  MMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELE 887
            M    K       Y PE+V+++E++L+++EKNF++A   F EME+ LQ   +R+PEIE+E
Sbjct: 785  M----KSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE 840

Query: 888  ISKIIMEIDTYSAEIKSK-ERQLQ-EKTNIDNSELQDNEELKVAIENLQKLKEEHLALQD 945
            +SK  M+I+T SAE++SK ER+L+ E++N   + ++D+ EL+ A E L  L  +  +   
Sbjct: 841  LSKQKMDIETISAELESKIERKLELERSN--KTSIEDSSELRTAEEKLAALNADLNSFMS 898

Query: 946  KTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELE 1005
             +++K ++I  L+ KIM+IGG+ELQ  NSKV S+ Q+I I+ AKQKKD+T++KK++ EL+
Sbjct: 899  ASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELK 958

Query: 1006 KAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKD 1065
            +A+K  +T+K+DI     +I+++    D IS+ +  + K + + Q    TL DE    K 
Sbjct: 959  RARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKH 1018

Query: 1066 KVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALD 1125
            ++    E I+ + S EIE+  +L+KL  L N++K ++   +  LS L LR + QV++ L+
Sbjct: 1019 ELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLE 1078

Query: 1126 E----ESEAKAPNNGT--------LSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISN 1173
            E    +S + +P   T        + +  +   + +E   +  +++ SM++D  A V+ N
Sbjct: 1079 ENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLEN 1138

Query: 1174 GLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAV 1233
            GLP L D EL+ +D+  +E ++  L+ YI+++  +IE+L+EY KRL E++ R++DLN+A+
Sbjct: 1139 GLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAI 1198

Query: 1234 DKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1293
             KR+  R   E LKK R +EFM GFGIIS+TLKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1199 MKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGV 1258

Query: 1294 TFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1353
             FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1259 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1318

Query: 1354 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            NYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK  N T S T++NR+I+N
Sbjct: 1319 NYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1453 bits (3762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 786/1403 (56%), Positives = 1021/1403 (72%), Gaps = 69/1403 (4%)

Query: 42   QQSISPINNSKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDS--SSSRGRKDI 99
            ++S+     S+S TPRKL+LG  D R+AFSQP V+SSS  VP LQP  S  SSSRGR   
Sbjct: 23   EESVDVTRASRSRTPRKLVLGSPDKRFAFSQP-VTSSSSNVPYLQPLKSELSSSRGR--- 78

Query: 100  KSYSQSPPRSPGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNF 159
              YSQSPPRSP RSP R+LELIQLSP K  R++ ++           ERL IN+L+L+NF
Sbjct: 79   -VYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNF 137

Query: 160  KSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKF 219
            KSYAG QVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE  
Sbjct: 138  KSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAH 197

Query: 220  PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTK 279
            P+L SC V+V F Y  DE DG T + + +P LV++RKAFKNN+SKYY+NGKES+YT VT+
Sbjct: 198  PNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTE 257

Query: 280  LLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339
            LL++EGIDLDHKRFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGT+KYK LIE+ L
Sbjct: 258  LLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTL 317

Query: 340  IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNN 399
            ++I+ LN++C EKENR+EIV+REK+SLESGK+ ALEFLEKEK+LT  +SKLLQ+ LW+N+
Sbjct: 318  VQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNS 377

Query: 400  SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS---KIKVLEGEEKQQLK 456
             K TNT +KI  L E+ + E++K    + EI   KQL +ES+S    I+ ++  E     
Sbjct: 378  FKSTNTQEKIKTLEEKLSAERAKYTEHKREI---KQLESESKSLNVTIRGIKDSESSLTS 434

Query: 457  SKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELET 516
             KR  + + VSL+EKLKN++QKK K EK    T  +I++  ++++EL K Q +Y  EL+ 
Sbjct: 435  EKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDE 494

Query: 517  LNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISL 576
            LN+ L  E+  L+ +K+ LK KT  IS +I   E +LEPWN+K+QEK+++I+L E++IS+
Sbjct: 495  LNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISV 554

Query: 577  LQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSK 636
            L+E   K+  +I     ++SN      ++ + +  L+K+ + I ++I  G+TEC++  +K
Sbjct: 555  LKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNK 614

Query: 637  LKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNT 696
            +KEMK VL   RQR+ +A+ +L+  +N+ KVL+AL +LQ+SGRI GFHGRLGDLGTID+ 
Sbjct: 615  MKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDK 674

Query: 697  YDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNV 756
            YDVA+STACPRLDD+VVETVECGQQCIE+LRKNKLGYARFILLDKLRSFN NTIQTP NV
Sbjct: 675  YDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNV 734

Query: 757  PRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTM 816
             RLFDL+ P D+KF  AFYSVLRDTLVAKDLK+ANRVAYG++R+RVVTLDGKLID+SGTM
Sbjct: 735  SRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTM 794

Query: 817  SGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQK 876
            SGGGNH + G+M  +R   N    +  E+V QI+++L+++E+NF++A +  +EME+ LQ 
Sbjct: 795  SGGGNHRASGMMKSER--LNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQS 852

Query: 877  LNNRKPEIELEISKIIMEIDTYSAEIK---------SKERQLQEKTNIDNSELQDNEELK 927
            L +R+PEIE +ISK  MEID+  +EIK          KE++L E +  D++ ++ N    
Sbjct: 853  LKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESS--DDTLIEAN---- 906

Query: 928  VAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILT 987
                 L  LK E   L+ + K+KK KI  L+E+IMKIGG +LQ+Q S V SI QRI I  
Sbjct: 907  ---SRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITL 963

Query: 988  AKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIE 1047
             KQK+D+T+ KK++ +L++ +K       DI   T++++ I E    ISSS    D  I 
Sbjct: 964  GKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIKEL---ISSS----DNKIL 1016

Query: 1048 EFQAHKETLKDECDELKDKVVDLEENINE-------FKSFEIEVNNKLEKLNGLLNHIKN 1100
            E +A  + L+ E +E+++KV ++E  I E       F  FE+++NN+LEKLN LLNHI  
Sbjct: 1017 ELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGK 1076

Query: 1101 QIKTLEDSLSKLTLRKMHQVLMALD---------------EESEAKA--PNNGTLSD-EQ 1142
                L   L  L +R +   L  L+               + SEA++  P+NG L + + 
Sbjct: 1077 DGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDT 1136

Query: 1143 IHDQTGHELTNTAVQDDDSMDIDNGAEVIS--NGLPILSDDELSALDITLVETEVSDLEK 1200
            +    G+E   TA Q +D MD+D   E+ +  + LP L++ +L  L++  VE E+  L  
Sbjct: 1137 VEGCMGNE--PTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLND 1194

Query: 1201 YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI 1260
            ++E+  A+IEVLEEY KRL +F+ RKL+LN AV++R++VR+  + L+K R +EFM+GF  
Sbjct: 1195 FVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNT 1254

Query: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320
            ISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSL
Sbjct: 1255 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSL 1314

Query: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1380
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ
Sbjct: 1315 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1374

Query: 1381 LVGIYKCENRTHSATIKNREILN 1403
            LVGIYK  N T S  ++N++++N
Sbjct: 1375 LVGIYKNRNMTKSVALENKDLIN 1397

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1436 bits (3716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1369 (55%), Positives = 987/1369 (72%), Gaps = 29/1369 (2%)

Query: 55   TPRKLILGQNDNRYAFSQPSV-SSSSFQVPTLQPPDSSS-SRGRKDIKSYSQSPPRSPGR 112
            TP KL+ G    ++  SQ S  S+++ + P+LQPP  S  SRGR     YSQSPPRSP R
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRS---VYSQSPPRSPNR 71

Query: 113  SPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFH 172
            SP RR+ELIQLSP+KN+R++L+++YD   + +K  RL I  L LNNFKSYAG QVVGPFH
Sbjct: 72   SPARRIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFH 129

Query: 173  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFL 232
            +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L+ CSV++ F 
Sbjct: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189

Query: 233  YAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKR 292
            Y +D+ DG+TK+     +L + RK FKNN+SKYYINGKES+YT+VT+ L+ EGIDLDHKR
Sbjct: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249

Query: 293  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEK 352
            FLILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGT+KYK  I   L+E+++LN+IC+EK
Sbjct: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309

Query: 353  ENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISAL 412
            E RFE+V++EK SLE+GK  ALEF+ KEKQLTL KSK LQ+++ +   KL  TL KISA 
Sbjct: 310  EIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAF 369

Query: 413  NEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKL 472
             E+   E++K   LQ EI   ++L +  + +I  +  E+ Q +K K  L+ E VS +EKL
Sbjct: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429

Query: 473  KNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMK 532
            K+L QK+ K EK +   EK I    + I+ L ++Q E+ + L  LN+ L SER  L+A+K
Sbjct: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIK 489

Query: 533  LKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLS 592
            + L++KTS ISEE+   E +LEPW  K++ K ++I+L ES+I +++E ++KL+ +I  L 
Sbjct: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549

Query: 593  QEVSNQTALKIKREEDLVN-LKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRA 651
            +++ +    +I+  +  +N L+K+ ++IT  IS  + EC+  + KL +MK VL   RQR 
Sbjct: 550  KDIESYKD-RIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRM 608

Query: 652  SEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDI 711
            ++AR+AL+NV+N+ KVL AL +LQKSGRI GFHGRLGDLGTID+ YD+A+S ACPRLDDI
Sbjct: 609  TDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDI 668

Query: 712  VVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFV 771
            VVETVEC QQCIE+LRKNKLGYARFILLDKL+ FN   + TP+NVPRLFDL  PK+  F 
Sbjct: 669  VVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFA 728

Query: 772  PAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQ 831
            PA YSVLRDTLVAKDL QANRVAYG RR+RVVTLDGKLID+SGTMSGGG+ V KGLM   
Sbjct: 729  PALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLM--- 785

Query: 832  RKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKI 891
            +  Q   D Y  E+V+++E +L+D+E NF++A + F EME  LQK  +R+P I++EISK 
Sbjct: 786  KSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKH 845

Query: 892  IMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKK 951
             ++IDT S+E++SK+  L E  +   +  +DN  L+     L  L  E +AL+D++K K 
Sbjct: 846  KIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKN 905

Query: 952  KKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTL 1011
            ++I+ L+ +IMKIGG++LQ QNSKV S+ Q++ I+ AKQKK+RT  KK++ E+ +A K  
Sbjct: 906  EQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQK 965

Query: 1012 LTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLE 1071
            L ++NDI     ++ + +   + +   L   +  IE  +  KE L  E +  K  + D  
Sbjct: 966  LGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKA 1025

Query: 1072 ENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES--- 1128
              + +FKS EIE+   LEKL  L +HIK +I   ++ L+ L LR + Q+L  LDE +   
Sbjct: 1026 AYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPL 1085

Query: 1129 -----EAKAPNNGTLSDEQIHDQTGHELTNTA---------VQDDDSMDIDNGAEVISNG 1174
                  A  P+N  + +  + D         A           D +SMD+D  A  I  G
Sbjct: 1086 ESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPG 1145

Query: 1175 LPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVD 1234
            LP L++ EL  +DI  +  E++ L++Y+++  A+I++LEEY  RL E+K RKLDLN++V+
Sbjct: 1146 LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE 1205

Query: 1235 KRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1294
            KRE +R + E LKK+R EEFM GFGIISMT+KE+YQMITMGGNAELELVDSLDPFSEGV 
Sbjct: 1206 KREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVL 1265

Query: 1295 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1354
            FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1266 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1325

Query: 1355 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            YIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N T S T++N +ILN
Sbjct: 1326 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1423 bits (3683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/1383 (55%), Positives = 1013/1383 (73%), Gaps = 20/1383 (1%)

Query: 34   SPLQRPE-HQQSISPINNSKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSS 92
             P Q  E H Q  S   + +S TPRKLI+   D+R+  SQP++ S+  Q P+LQ P  S+
Sbjct: 48   GPYQGQEKHIQPQSQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVST 107

Query: 93   SRGRKDIKSYSQSPPRSPGRSP----KRRLELIQLSPVKNNRIKLRELYDAHNSQSKKER 148
             R  K    YSQSPPRSP RSP    K+ LELIQLSP+KNNR +L+++Y+   +Q +  R
Sbjct: 108  GREHK---FYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIR 164

Query: 149  LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
            L I +L L NFKSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +
Sbjct: 165  LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224

Query: 209  LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGD-TKISETKPKLVISRKAFKNNSSKYYI 267
            L DLIHKSEK+P+L+SCSV++ F Y ID+ +G  +KI E+K KLV+ RKAFKNNSSKYYI
Sbjct: 225  LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYI 284

Query: 268  NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
            N KES++T VT LLK EGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIG
Sbjct: 285  NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344

Query: 328  TSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSK 387
            TS YK  IE +L ++E+LNEICIEKENRF IV++EK+SL  GKN AL++L  EK L L+K
Sbjct: 345  TSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAK 404

Query: 388  SKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVL 447
            SK  Q+ L+ +N KLT+TL KI+   E Y+ E  K  T+  E+   K L +E  +  K L
Sbjct: 405  SKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKEL---KNLQDEEITLNKRL 461

Query: 448  EGEEKQQ---LKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELE 504
               +K +   L ++R    E +S  E +KN+ +KK   EK++ TTEK+I+   ++++ L 
Sbjct: 462  NETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLN 521

Query: 505  KSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKK 564
              Q++Y+ ++E LN++L+ E+  LE +K+ LK KT   S EIL +E +LEP+ I++QEK 
Sbjct: 522  NQQEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKM 581

Query: 565  TEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEIS 624
            ++IQL++S+ISLL E +  L N+I  + + +  +    ++  E +   K+Q     KE+ 
Sbjct: 582  SQIQLLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVE 641

Query: 625  NGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFH 684
            +G+ E N    K++EM++ L+  RQ+A+++R +L+NVQN+  VLTAL+KLQKSGRI GF+
Sbjct: 642  SGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFY 701

Query: 685  GRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRS 744
            GRLGDLG ID  YDVA+STACPRL+D+VV++V+CGQQCI+YLRKN+LGYARFILLDKLR 
Sbjct: 702  GRLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRK 761

Query: 745  FNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVT 804
            FN N I+TP N PRLFDLI+ ++ KF+PAFYSVLRDTLVA +L  AN+VAYG+RR+RVVT
Sbjct: 762  FNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVT 821

Query: 805  LDGKLIDVSGTMSGGGNHVSKGLMML-QRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELA 863
            LDGKLID+SGTMSGGGN+V +GLM L Q   +N F+  +PE+V+++E++L   EKNF++A
Sbjct: 822  LDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVA 881

Query: 864  NNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDN 923
             N+  EM  E+  +  + P  EL ISK  +EI+    EIK    QL+EK  I + E  +N
Sbjct: 882  YNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNN 941

Query: 924  EELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRI 983
            +E+KVA + LQ LK+E+ +L D+TK  K++I  L+++IM  GGIEL++QNSKVTS+V ++
Sbjct: 942  DEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQL 1001

Query: 984  DILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNID 1043
             I+ +KQK D+++ KK++  L+K +  L T+K++      +++   +++  +S  L  ++
Sbjct: 1002 KIVNSKQKNDKSAIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLE 1061

Query: 1044 KSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIK 1103
              I + Q  KE +    D  K+K  +LEE+   FKSFE+E+ NKL+KL  L +H++ QI 
Sbjct: 1062 SDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIG 1121

Query: 1104 TLEDSLSKLTLRKMHQVLMALDEESEA-KAPNNGTLSDEQIHDQTGHELTNTAVQDDDSM 1162
             L+  L+ LT+R++ Q L + DE  E      NG   D Q    T   L + +  + D+M
Sbjct: 1122 KLDTELNALTIREISQNLESFDERLEKYDISKNGATEDTQ---HTSSALNSVSNINTDTM 1178

Query: 1163 DIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEF 1222
            DID+    I+ G+  LS+ E++ LDI  ++ E+ +LE+ +E + ANIE+LEEYV+RL+E+
Sbjct: 1179 DIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEY 1238

Query: 1223 KTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELEL 1282
            K RK DL++++ ++ET +++ E LKK R EEF  GF IIS+TLKEMYQMITMGGNAELEL
Sbjct: 1239 KKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELEL 1298

Query: 1283 VDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1342
            VDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1299 VDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1358

Query: 1343 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            ALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK EN T SAT+ N ++L
Sbjct: 1359 ALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDML 1418

Query: 1403 NSD 1405
            N D
Sbjct: 1419 NRD 1421

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1420 bits (3675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/1395 (54%), Positives = 1001/1395 (71%), Gaps = 74/1395 (5%)

Query: 51   SKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDS--SSSRGRKDIKSYSQSPPR 108
            S+S TPRKL+LG  D R+AFSQP VSSSS  VP LQP  +  SSSRGR     YSQSPPR
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQP-VSSSSSNVPHLQPLKNELSSSRGR----VYSQSPPR 86

Query: 109  SPGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVV 168
            SP RSP R+LELIQLSP+K +R++ ++  ++       +RL I++L L+NFKSYAG QVV
Sbjct: 87   SPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVV 146

Query: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228
            GPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  PDL SC VD
Sbjct: 147  GPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVD 206

Query: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288
            + F Y  DE DG T I + KP +VI RKAF+NN+SKYY+NGKES+YT +T+LL++EGIDL
Sbjct: 207  IFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDL 266

Query: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348
            DHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGT++YK LIE  L EI  LN+I
Sbjct: 267  DHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDI 326

Query: 349  CIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK 408
            C EKENRFEIV+REK+SLE GKN ALE+LEKEK LT+ +SKLLQY+LW+N  KL +T +K
Sbjct: 327  CEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEK 386

Query: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468
            I+   E+ + EK+K      E+   K  L   +  +  L   EK+    KR  + + VSL
Sbjct: 387  IAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSL 446

Query: 469  DEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528
            +EKLKNLTQK+ K+ + + +   +IS+  ++++EL   Q+++  +L  LN  ++ E+E L
Sbjct: 447  EEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKL 506

Query: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588
            + +K  LK+K S ISE+I   E +LEPWN+K+QEKK +++L E+ IS+ +E   K++ DI
Sbjct: 507  DEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDI 566

Query: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648
             ++++ +        ++   + +L+K+Q  I ++++ G++EC++   K+KEMK +L   R
Sbjct: 567  ILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHR 626

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708
            QR+ +AR +L+  +N+ KVL AL +LQ+SGRI GFHGRLGDLGTID+ YDVA+STACPRL
Sbjct: 627  QRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRL 686

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768
            DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR+FN + I+TP+NVPRL+DL++P + 
Sbjct: 687  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNP 746

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
            KF  AFYSVLRDTLVAKDLK+AN+VAYG++RYRVVTLDGKLID+SGTMSGGGN  ++G+M
Sbjct: 747  KFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM 806

Query: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888
              +++  + F     E+V+QI+K+LS++E NF++A +  +EME  LQKL +R+PEIEL+I
Sbjct: 807  KSEQQSNSAF---TAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDI 863

Query: 889  SKIIMEIDTYSAEIKSKERQ----LQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQ 944
            SK  ++ID+ S+E+K+ E +    LQEK   ++S    NEEL  A   L+ LK E+  L+
Sbjct: 864  SKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESS----NEELSTAEVKLKSLKSEYRELE 919

Query: 945  DKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTEL 1004
            ++ ++KKK++  L+E+IMK+GG +LQ+Q+S V S+ QRI I+ AK KK +T  KK+  ++
Sbjct: 920  NEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDI 979

Query: 1005 EKAKKT-------LLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLK 1057
            ++ +K        L +   + +LI +++   S+++D++S S+N               LK
Sbjct: 980  KRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINK--------------LK 1025

Query: 1058 DECDELKDKVVDLEENINE-------FKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLS 1110
            DE +  +++V   EE+I+E       F++ EI+   +L+KL  L   +  +      SL+
Sbjct: 1026 DELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLN 1085

Query: 1111 KLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDID----- 1165
             L +R +   L ALDE  E ++ N      E   +  G E    +    D MD+D     
Sbjct: 1086 SLKIRDVTATLQALDESLENESKN------EVAAETPGEEDGEHSSSLHDPMDVDENQGE 1139

Query: 1166 -----------------NGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDAN 1208
                             N  E + NGLP L +DEL   ++  VE E+  L+ Y+E+  A+
Sbjct: 1140 STSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYAD 1199

Query: 1209 IEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEM 1268
            IE+LEEY +RL E+K RK+DLN AV +R+ VR+  E LKK R +EFM GF  I M LKEM
Sbjct: 1200 IEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEM 1259

Query: 1269 YQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1328
            YQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHK
Sbjct: 1260 YQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1319

Query: 1329 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCE 1388
            YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +
Sbjct: 1320 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNK 1379

Query: 1389 NRTHSATIKNREILN 1403
            N T S  ++N ++++
Sbjct: 1380 NMTKSVALQNTDLID 1394

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1402 bits (3629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/1410 (54%), Positives = 1013/1410 (71%), Gaps = 31/1410 (2%)

Query: 2    SLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLIL 61
            +LP+ K+QKV + ES +P      + A +   SPLQ         P+   KS+TP K+I+
Sbjct: 3    ALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVAN-----DPL---KSYTPMKVII 54

Query: 62   GQNDNRYAFSQPS-VSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSP----KR 116
              N +      PS + SSS Q P+LQ P SSSSRGR  +K+YSQSPPRSP RSP     R
Sbjct: 55   SNNHSNSISPLPSQLMSSSTQPPSLQHP-SSSSRGRA-VKAYSQSPPRSPDRSPVRSPTR 112

Query: 117  RLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFS 176
            +LELIQLSP+KN+R +L+++Y +   + K ER+ +NKL L+NFKSYAG Q +GPFH+SFS
Sbjct: 113  KLELIQLSPIKNSRSELQKIYSSK-QEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFS 171

Query: 177  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAID 236
            AVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE++PDLTSC+VDV F Y ID
Sbjct: 172  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID 231

Query: 237  EHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLIL 296
              D  TKI+ +K  L+I+R+AFKN++SKYY+NGKESNY  +T LLKEEGIDLDH RFLIL
Sbjct: 232  YPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLIL 291

Query: 297  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRF 356
            QGEVENIAQMKPKAEKE DDGLLEYLEDIIGT+KYK+LI+K  IEIE+LN+ICIE+ENRF
Sbjct: 292  QGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRF 351

Query: 357  EIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEY 416
            +I+DREK SLES K  ALE+L KEK+  + KSKL+QY +WQNN KL+NTL+KI+ L +EY
Sbjct: 352  DIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEY 411

Query: 417  NVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLT 476
            N EK+KN  L+N+I+  ++L  ++Q +++ L  +EK+ + +KR L+ ++VS  E+LKN+ 
Sbjct: 412  NQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIE 471

Query: 477  QKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLK 536
            +K  KT K I    KTISS    ++    ++K +  +L  L+  L +E + LE +KL LK
Sbjct: 472  KKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLK 531

Query: 537  EKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVS 596
            +KT G+SEEIL  E DLEPWNIK+ E K+EIQ+ ES+ +L +E + KLK +I+ L ++V+
Sbjct: 532  DKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVN 591

Query: 597  NQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656
             ++ L   R +++ NL  +  +++KE+  G  E      KL EM+ +L   RQ+A++AR 
Sbjct: 592  EKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDART 651

Query: 657  ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETV 716
            +L+NV+NR KVL AL KLQKSGRI GFHGRLG+LG ID  YDVA+STACPRL+DIVV++V
Sbjct: 652  SLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSV 711

Query: 717  ECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYS 776
            ECGQQCIEYLRKN LG+ARFILLDKL  F+   I TP+NVPRLFDLIK  D KF+PAFYS
Sbjct: 712  ECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYS 771

Query: 777  VLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQN 836
            VLR+TLVA DLK+AN VAYG+ RYRVVTL G LID+SGTMSGGGN  SKG M L      
Sbjct: 772  VLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNSTSK 831

Query: 837  YFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEID 896
                Y+ E+V +IEK+LS +EKN++ A N   EME EL+ L   +P+IELEISK+  EID
Sbjct: 832  EKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEID 891

Query: 897  TYSAEIKSKERQLQEKT---NIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKK 953
            +   E   K +QL E     +I+++   D  E+  A   L  L E+   ++ + K+KK +
Sbjct: 892  SLENECSLKRKQLNEPNASFSIEDNMSADITEMDNA---LYTLNEKQKLIESQMKSKKDR 948

Query: 954  IASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLT 1013
            I  L++KIMKIGGI+LQ+QNSKV S+ ++  IL  KQK ++    K ++++ K  K L  
Sbjct: 949  IKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKE 1008

Query: 1014 SKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEEN 1073
            S++D T + +    +   +  I   L   + ++   Q  K TL+++ +   +++ ++E  
Sbjct: 1009 SESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGL 1068

Query: 1074 INEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALD-EESEAKA 1132
            ++EFK+ E+E   K EKL  LLN IK  +K LE+  S L++R++   L  L+ +E EA+ 
Sbjct: 1069 LSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQK 1128

Query: 1133 PNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVE 1192
                  +D        +++ N      D M I++    I+ G+P   + +    DI+ +E
Sbjct: 1129 IKTELYAD--FEQNQSNDVIN------DEMIIEDNNNEIAKGIPSYMESDFKQFDISSLE 1180

Query: 1193 TEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYE 1252
             E+  L+ Y E    ++++LEEY +R+ E++ RK DLN +V++R+ VRK+LE+LKK R+ 
Sbjct: 1181 AELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFN 1240

Query: 1253 EFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1312
            EFM  F IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG
Sbjct: 1241 EFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1300

Query: 1313 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1372
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1301 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1360

Query: 1373 NMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            NMFELA+QLVGIYK  N+T SAT+KN +IL
Sbjct: 1361 NMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1330 bits (3441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1376 (53%), Positives = 971/1376 (70%), Gaps = 44/1376 (3%)

Query: 48   INNSKSHTPRKLILGQNDNRYAFSQP---SVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQ 104
            ++ S + TPRKL+LG  + +YA S     + +S++   P+LQPP + + RGR+    YSQ
Sbjct: 21   VSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGRE----YSQ 76

Query: 105  SPPRSPGRSPKR----RLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFK 160
            SPPRSP RSP R    +LELI+LSP K+ R++L+++++A+   S  +RL I+KL LNNFK
Sbjct: 77   SPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTS--QRLCIDKLVLNNFK 134

Query: 161  SYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFP 220
            SYAG Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+FP
Sbjct: 135  SYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFP 194

Query: 221  DLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKL 280
             L SCSV + F Y  D  +G+TKI  +   +V+ R+AFKNNSSKYY+NGKESNYT+VT+L
Sbjct: 195  SLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRL 254

Query: 281  LKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLI 340
            LKEEGIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGT+K+K  IEK L 
Sbjct: 255  LKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLE 314

Query: 341  EIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNS 400
            EIE+LNE+C+EKENRFE+VD+EK +LESGK  ALEFL+KE++ T+ K++LLQ  ++ +N 
Sbjct: 315  EIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNR 374

Query: 401  KLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRI 460
            KL  +  KISALN E+  EKS+ + LQ E       +N ++ +   LE E K     KR 
Sbjct: 375  KLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRS 434

Query: 461  LEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQ 520
            LE + ++ DEKLK++ +K    EK  + +E    +  +EI+ L+K+  +   EL  LN  
Sbjct: 435  LEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHS 494

Query: 521  LQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEG 580
            +  E+E L  +K+ L EKT  +S+E+   E  LEP+  ++QEK++EI+L E++I++L+  
Sbjct: 495  ISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSS 554

Query: 581  QVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEM 640
               L  +   +  ++ +    ++K++E   +L+ ++S +   IS  + EC + + +  EM
Sbjct: 555  HSNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEM 614

Query: 641  KNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVA 700
            ++VL  QRQ   EA+  L   QN+ +VL AL KLQ SGRI GFHGRLGDLGTID+ YD+A
Sbjct: 615  RDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIA 674

Query: 701  VSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLF 760
            +STACPRLDDIVVETVECGQQCI++LRKNKLGY RFILLDKLR  N + I TP+NVPRLF
Sbjct: 675  ISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLF 734

Query: 761  DLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGG 820
            DLI P    F PAFYSVLRDTLVA+DL+QANRVAYG+RR+RVVTLDGKLID+SGTMSGGG
Sbjct: 735  DLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGG 794

Query: 821  NHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNR 880
            +    GLM   R        Y+ ++VE++E  LS KE N+  A +  +EME+ LQKL +R
Sbjct: 795  SSPQSGLM---RSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDR 851

Query: 881  KPEIELEISKIIMEIDTYSAEIKSKERQLQE-----KTNIDNSELQDNEELKVAIENLQK 935
             PEI+++ISKI +E  +  AE++S  ++L +       N  N +   +EE K+ I     
Sbjct: 852  LPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDI----- 906

Query: 936  LKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRT 995
            L++      D +K  + KI  LK++IM+ GGIEL++Q +KV S+ Q I+IL  KQKK++T
Sbjct: 907  LRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKT 966

Query: 996  SKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKET 1055
              KK D +L +A +       ++ +   DI  +SE+++ I      I++ + E    K  
Sbjct: 967  RSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAE 1026

Query: 1056 LKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLR 1115
            L    ++LK +++ +E + NEFK+ E+E +++LEKL+GL  ++K Q+++ E SL  L +R
Sbjct: 1027 LNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIR 1086

Query: 1116 KMHQVLMALDE-------ESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGA 1168
             + ++L  L++       +  AK  N   +  + I D          V ++D+M+ D+G 
Sbjct: 1087 DVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITD----------VGNNDAME-DSGE 1135

Query: 1169 EVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLD 1228
                +GLP L++ EL  LD+  +E E+  L+ Y+++ + +IEVLEEY +RL E++ RKLD
Sbjct: 1136 AATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLD 1195

Query: 1229 LNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDP 1288
            LN AV KRE VR + E  K  R E+FM GFGIISMTLKEMYQMITMGGNAELELVDSLDP
Sbjct: 1196 LNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDP 1255

Query: 1289 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1348
            FSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1256 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1315

Query: 1349 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404
            VSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK  N T S T++N +IL+S
Sbjct: 1316 VSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHS 1371

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1309 bits (3387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1422 (52%), Positives = 990/1422 (69%), Gaps = 54/1422 (3%)

Query: 4    PNTKRQKVTEPESK-----TPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRK 58
            P +KRQKVTE + +     TP+  T +Q                   SP    ++ TPR 
Sbjct: 5    PVSKRQKVTEEDEEEDVIHTPKAVTFEQ-------------------SP----RAITPRN 41

Query: 59   LILGQNDNRYAFSQPSVSSSSFQVPTLQPPDS-SSSRGRKDIKSYSQSPPRSPGRSPKRR 117
            L+  +N N      P+  S + Q+P+L PP+S  S+RGR D KSYSQSPPRSPGRSP RR
Sbjct: 42   LLGSENRNVL----PTGGSQNLQIPSLLPPESLGSARGR-DFKSYSQSPPRSPGRSPTRR 96

Query: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177
            L+LI+LSP+KN+R +L++LY++     KKERLFI++L LN+FKSYAG+QV+GPFHTSFSA
Sbjct: 97   LKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSA 156

Query: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL SCSV+V F Y ID+
Sbjct: 157  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDK 216

Query: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297
             DG T I ETK  LV++RKAFKNN+SKY++NGKESNYT+VT LLK+EGIDLDHKRFLILQ
Sbjct: 217  DDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQ 276

Query: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357
            GEVENIAQMK KAEKE+DDGLLEYLEDIIGTSKYK+ IEK  +EIESLNEIC+EKENRF 
Sbjct: 277  GEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFS 336

Query: 358  IVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN 417
            IV+REKNSLESGK  AL+FL KEK+L L KSKL QYNL Q+N KL + L K + + +E  
Sbjct: 337  IVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQT 396

Query: 418  VEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ 477
             ++ + +   + I+     LN  ++ ++ +  EE    K+KR LE + V  ++ + NL  
Sbjct: 397  KQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDS 456

Query: 478  KKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE 537
            K+ + E+     +  I+S   EIQ + + Q   ++    L+  L  E+E LE +KLKL+E
Sbjct: 457  KRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLRE 516

Query: 538  KTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSN 597
            KT  ++ +I  +E +L PWN + Q+ K EI++ ES++S+++E +  L+NDI  L   + +
Sbjct: 517  KTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILS 576

Query: 598  QTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLA 657
            Q      +E+++ +L +Q++ + +E   GE EC + ++ L  ++  +   RQ+A E R  
Sbjct: 577  QKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRST 636

Query: 658  LANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVE 717
             +  +N  KVL+AL +LQKSGR+ GFHGRLGDL  ID  YDVA+STACPRL+D+VV+TVE
Sbjct: 637  YSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVE 696

Query: 718  CGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSV 777
             GQQCIEYLRKNKLGYARFILLDKL +FNTN I TP    RLFDLI  K+ +F  AFYSV
Sbjct: 697  SGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSV 756

Query: 778  LRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNY 837
            LRDTLV ++++QANRVAYG++RYRVVTLDG LID+SGTM+GGG +VSKGLM L +     
Sbjct: 757  LRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKG 816

Query: 838  FDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDT 897
               ++PE+V+ IE +L+ KE  ++ A +A++EME EL++L +R PEI+  +SK  M+I+T
Sbjct: 817  SAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIET 876

Query: 898  YSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQD---KTKAKKKKI 954
               +I S    L+EK     S    N+    +I  L KLKE    L D   +TK+ K KI
Sbjct: 877  AHNDINSNINVLEEKRKKLESMKNQNDP---SITLLAKLKELKSKLDDIDVQTKSTKDKI 933

Query: 955  ASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTS 1014
             ++K+KI+++GG EL+ Q+  VT I  +I   + + KK +++K K ++ L+K  K L  +
Sbjct: 934  KTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEA 993

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
              ++T  + + +       +I S L +I +SIE  + ++  L+ E +   +++   ++ +
Sbjct: 994  NEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVV 1053

Query: 1075 NEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE------- 1127
            +++KS  +E NNKLEKL      +K  IK   D LS+LT+R + QVL  +  E       
Sbjct: 1054 SDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDK 1113

Query: 1128 SEAKAPNNGTL---SDEQIHDQTGHELTNTAVQDDD----SMDIDNGAEVISNGLPILSD 1180
            S+ K  N   +    D+ I   + ++  N   ++DD     M+ID+    I+ G+P+LS 
Sbjct: 1114 SDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSA 1173

Query: 1181 DELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVR 1240
             EL+ +D   VE  ++ L+ +I S++AN++VLEEY  R  EF  RK DLN AV  R++V+
Sbjct: 1174 SELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVK 1233

Query: 1241 KQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1300
             +LE +K+ RY+EFM GF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPP
Sbjct: 1234 DRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPP 1293

Query: 1301 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1294 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1353

Query: 1361 KNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            KNAQFIVISLRNNMFEL +QLVGIYK EN T SA + N +++
Sbjct: 1354 KNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  273 bits (699), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 352/1315 (26%), Positives = 623/1315 (47%), Gaps = 183/1315 (13%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7    LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 214  HKSEKFPDLTSCSVDVE---FLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGK 270
            ++     D      D E   ++ A  E DG          + + R       S Y I+ K
Sbjct: 67   YRDIASADENEFGEDGERSAYVKAFYEKDGTV--------VELMRAITAGRDSVYKIDNK 118

Query: 271  ESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSK 330
             + Y   +  L  E I +  + FL+ QG+VE IA   P+        L +  E++ G+ K
Sbjct: 119  TTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPRQ-------LTKLFEEVSGSIK 171

Query: 331  YKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKL 390
            YK+  E+   +IE L+E   E       +  E    E G +   ++   +KQL +     
Sbjct: 172  YKKEYEELKEKIEKLSESAAESAKNRRRIQGEMKIYEDGISKDEKY---KKQLEVRDKLQ 228

Query: 391  LQYNLWQ----------NNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNES 440
            +   LWQ          +  KL     K+  L ++ N E++  +  +NE+ +   L  + 
Sbjct: 229  VHLALWQLFHLEQEEKLSTKKLKEVKNKVMKLTDQVNEEETNVKKAKNEVIKETSLQMKQ 288

Query: 441  QSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEI 500
            Q+++   E E+   L     ++    S +++L N+ ++     + +   +  +S    ++
Sbjct: 289  QNRLDYKEKEKDNLLSELTPIQLSQRSAEKRLANIEKRIESIARDMERQKTYVSRYEKQL 348

Query: 501  QELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKV 560
            + ++K++  + +EL+  N      R + E MKL  +     ++E     +  L   N + 
Sbjct: 349  KVVKKTKDTFEEELKQSNSNPDKYRLNDEDMKLYERLNEQYLTEGGFELDTKLSLLNNEK 408

Query: 561  QEKKTEIQLVESQISLLQ-----EGQVKLKN-DIKV--LSQEVSNQTALKIKREEDLVN- 611
            ++   E++L++ +I + +     E  VK +N +++   LS E++ + +L +    +L N 
Sbjct: 409  KDIDDELELLQKRIDMSKNRITDEFAVKGENFELQAVELSSELNEKNSLHL----NLANK 464

Query: 612  LKKQQSSITKEISNGETECNDG-RSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTA 670
            LKK QS I +  SN E E N   R  L ++ +    QR+   E +L   NV     +L  
Sbjct: 465  LKKIQSDI-ESTSNKEYELNHKLRDTLVKLDDASANQRETLKEKKLR-ENVS----MLKR 518

Query: 671  LYKLQKSGRIVGFHGRLGDLGTIDN-TYDVAVSTACPR-LDDIVVETVECGQQCIEYLRK 728
             +         G  G + DL       Y +AVST   +  D +VV+T+   Q+CI YL+K
Sbjct: 519  FFP--------GVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKK 570

Query: 729  NKLGYARFILLDKLRSF----NTNTIQTPKNVPRLFDLIKPKDS--KFVPAFYSVLRDTL 782
             + G   FI LD + +F     T  IQ    V    D  +  D   ++V +  S++ DTL
Sbjct: 571  QRAGIISFIPLDTIDAFVPTLPTTNIQGITLVLNAIDYDQEYDKAMQYVCS-DSIMCDTL 629

Query: 783  -VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGG-----GNHVSK----GLMMLQR 832
             +AK LK  + V       ++VTL+G LI  +G M+GG     GN   K    GL+ L+ 
Sbjct: 630  SIAKSLKWKHNVTS-----KLVTLEGTLIHRAGLMTGGVSKEQGNRWDKEEYQGLVTLKD 684

Query: 833  KGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKII 892
            K            + QIE+ LS+  K F +      ++E+ + +LN+   ++  +IS+I 
Sbjct: 685  KL-----------LIQIEQ-LSNNSKTFAIEAR---DLESNISQLNSSISDLRTQISQI- 728

Query: 893  MEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKK 952
                          R ++E    + +E+Q +E++         LK+E+   Q++   K +
Sbjct: 729  -------------NRSIEE----NKAEVQYHEDM---------LKKEYEPKQNQLNTKLE 762

Query: 953  KIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSK--KKSDTELEKAKKT 1010
             I   K +I  IG  EL +QN+       ++   T ++ +  + +  ++S+ EL++ +K 
Sbjct: 763  SIEKSKSEI--IGQKEL-LQNTVFKEFHNKLG-FTIQEYEHHSGEALRQSNKELQQLEKQ 818

Query: 1011 LLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDL 1070
            +L  ++ +    +  +   +R  K    L N + +IE  Q ++        E+  K+ D+
Sbjct: 819  VLNIESKLQFEVERYESTEKRHKKAQIDLENNNSTIESLQENEA-------EVVAKIKDI 871

Query: 1071 EENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSK----LTLRKMHQVLMALDE 1126
            E  +       +E+   LE  +  ++  K ++   EDSLS+    LT     ++  ++ E
Sbjct: 872  ENGM-------LEIKKVLEDFSKEIDRKKKKLAIAEDSLSEKSELLTTSTNEKI--SIKE 922

Query: 1127 ESEAK------APNNGTLSDEQIHDQTGHELTNTAVQ--DDDSMDIDNGAEVISNGLPIL 1178
            E E K         N  +S+ Q+   +  +L N  +   D+D++ I N   +    LP  
Sbjct: 923  EIEKKDLEKLGILTNCKISNIQVPVASKIDLNNLPIGKIDNDAILISNEISLDYKTLPAK 982

Query: 1179 SDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRET 1238
              +  S+   + +E E+  +E  ++    N       V R  E K R    + A D+ ET
Sbjct: 983  YKESSSSKIRSALEHEIEVVEDLLQDLQPNARA----VDRFDEAKER---FDSASDETET 1035

Query: 1239 VRKQLEEL-------KKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELEL 1282
            ++KQ  +L       KK R E F   F  +S  ++ +Y+ +T          GGNA L L
Sbjct: 1036 LKKQERKLLTQFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTL 1095

Query: 1283 VDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1342
             D  +PF  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DA
Sbjct: 1096 EDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDA 1155

Query: 1343 ALDFRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            ALD  N+  +ANYI++ +  + QFIVISL+N+MFE +  LVGI++ +    S  +
Sbjct: 1156 ALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  271 bits (693), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 336/1311 (25%), Positives = 615/1311 (46%), Gaps = 171/1311 (13%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 214  HK-------SEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
            ++       SE   D +  +    ++ A  E +  T        + + R   +N  + Y 
Sbjct: 67   YRGVITGEDSESDEDGSVNNPSTAYVKAFYEKENKT--------IELMRTISRNGDTNYK 118

Query: 267  INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
            I GK  +Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E++ 
Sbjct: 119  IGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLFEEVS 171

Query: 327  GTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---LEKEKQL 383
            G+ +YK+  ++   ++E L++   E       +  E  + + G N   E+   + K+K+L
Sbjct: 172  GSIQYKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDEEYKSKVAKKKEL 231

Query: 384  TLSKSKLLQYNLWQNNSK-------LTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQL 436
               ++ L+ + L+    K       + +T  K+S L ++ + E+   Q  +  I +   +
Sbjct: 232  ---QTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDKIHNEERNLQRAKTSIAKEMSI 288

Query: 437  LNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSL 496
            + + + KI     E+++     ++++   +S  +++ N+ ++    EK I      +   
Sbjct: 289  ITKKKDKIDYKLKEKEKIASDLKLIKLPQLSTIKRIGNIEKRIESFEKDIERQSSFVERF 348

Query: 497  TSEIQELEKSQKEYSDELETLNQQL------QSERESLEAMKLK-LKEKTSGISEEILIH 549
            T++++ + K+++ +  EL+  +           E+E+ +++  K L    S I E+I+I+
Sbjct: 349  TNQLKVVTKTKEAFERELKETSMNFDKYRLNDEEKENYQSLNEKYLTSGGSSIEEKIMIN 408

Query: 550  EHDLEPWNIKVQEKKTEIQLVESQISLLQEG-----QVKLKNDIKVLSQEVSNQTALKIK 604
            E+D        QE   E+   E  I + ++       V+L+N+ ++ + E++  T L  K
Sbjct: 409  END-------KQEVGEELNRFEKLIDISKQRINDVLMVELENN-QLRASELT--TLLNEK 458

Query: 605  ---REEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMKNVLNMQRQRASEARLALAN 660
                 E L  LK  QS I +  SN E + N   R  L ++ ++   QR+   E +L   N
Sbjct: 459  NSIHAERLKELKGLQSDI-ESASNQEYDLNYKLRETLVQIDDLSANQRESMKERKLR-EN 516

Query: 661  VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTI-DNTYDVAVSTACPR-LDDIVVETVEC 718
            V     +L  L+         G  G + DL     + Y +AVST   R  D ++V+    
Sbjct: 517  VA----MLKRLFP--------GVKGLVYDLCHPKKDKYSLAVSTCLGRNFDSVIVDNASV 564

Query: 719  GQQCIEYLRKNKLGYARFILLDKLRS-FNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSV 777
             Q+CI YL+K + G A FI L+ + S   T ++   +      + I+  D ++  A   V
Sbjct: 565  AQECIAYLKKQRAGSASFIPLETIDSEIPTLSVSNSQGCILAINAIEY-DPRYERAMQYV 623

Query: 778  LRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQN 836
              DT++   L  A R+ + +  + ++VTL+G LI  +G M+GG +  S      +   + 
Sbjct: 624  CSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALIHKAGLMTGGVSKDSNN----RWDKEE 679

Query: 837  YFDDYNPED--VEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIME 894
            Y    N +D  + QIE ++S + +   +      ++EN L  LN     + +++++I   
Sbjct: 680  YQSLMNLKDKLIHQIE-EVSQQGRASSMKAR---DLENNLSVLNTEISNVRIQLTQITRL 735

Query: 895  IDTYSAEIKSKERQLQEKTNIDNSEL-QDNEELKVAIENLQKLKEEHLALQDKTKAK--- 950
            ID    E+  + R + E+ +   SEL +    L+++I NLQ  KE+   LQD   A+   
Sbjct: 736  IDENKIELGYQNRLINEEYSPKMSELNKKKNNLEISISNLQTDKEK---LQDIIFAEFTE 792

Query: 951  -----KKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELE 1005
                  K+  S   +IM+  G +LQ   +++ ++  +   L  +Q++  T+KK+S    +
Sbjct: 793  RVGFTVKEYESHSGEIMRKQGKDLQRLQNEILNVENK---LQFEQERLFTTKKRS----Q 845

Query: 1006 KAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKD 1065
            KAK  L  +  ++  +  + K + ERI  I   + +  + ++E Q               
Sbjct: 846  KAKSDLEKANIELKDLETEEKSLQERIKIIEVEVGSQSEELDELQ--------------- 890

Query: 1066 KVVDLEENINEFKSFEIEVNNKLEKLNGL---LNHIKNQIKTLEDSLSKLTLRKMHQVLM 1122
                     N F + + ++N   E LN L   +   K Q     + + KL L ++     
Sbjct: 891  ---------NIFNAKQRDLNTTDENLNELQMNMQLCKRQKNEFTEDVEKLDLERI----- 936

Query: 1123 ALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSD-- 1180
                           L + +I + +   L++T + D     +D+ A+ I N + I  +  
Sbjct: 937  -------------SILKNCKISNVSIPLLSSTGLADLPLTSLDDEAKNIFNSIDIEYEKL 983

Query: 1181 ----DELSALDI-TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDK 1235
                 E  A  +   ++TE+ ++E+ +     N   +E +      F+    +      +
Sbjct: 984  PAKFKESGAFSLKQQLDTEMKEVEEALNVLQPNARAVERFDDAQERFEVVDTETETLKTE 1043

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITM---------GGNAELELVDSL 1286
               +  Q  ++KK R E F   F  ++  L  +Y+ +T          GGNA L L D  
Sbjct: 1044 ERKILAQFLKIKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDED 1103

Query: 1287 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD 
Sbjct: 1104 EPFNAGIRYHATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDV 1163

Query: 1347 RNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            RNV  +A YI+     N QFIVISL+N MFE +  LVG+Y+ +    S  +
Sbjct: 1164 RNVERIAAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  270 bits (691), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 364/1336 (27%), Positives = 617/1336 (46%), Gaps = 219/1336 (16%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7    LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 214  HK-------SEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
            ++       S+ + +  + S + +  Y    +    K+ E     +ISR    N  + Y 
Sbjct: 67   YRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMR--IISR----NGDTSYK 120

Query: 267  INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
            I+GK  +Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E++ 
Sbjct: 121  IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVE-------LSRMFEEVS 173

Query: 327  GTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---LEKEKQL 383
            G+ +YK+  E+   +IE L++   E       +  E  + + G N   E+   L+K+ +L
Sbjct: 174  GSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNEL 233

Query: 384  TLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSK 443
               ++    Y+L Q   +LT+   K+SALN E +       +L+ +IN   + L  S+S 
Sbjct: 234  QKFQALWQLYHLEQQKEELTD---KLSALNSEIS-------SLKGKINNEMKSLQRSKSS 283

Query: 444  -IKVLEGEEKQQLKSKRIL-EGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQ 501
             +K      KQ+ K   I  + E +  D +L  + Q+ A   K I+  EK I SL  ++Q
Sbjct: 284  FVKESAVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQAAG--KRISHIEKRIESLQKDLQ 341

Query: 502  ELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQ 561
                 QK Y +  ET   QL+    S EA + ++K+      ++  ++E+DL+ +N  + 
Sbjct: 342  R----QKTYVERFET---QLKVVTRSKEAFEEEIKQSARNY-DKFKLNENDLKTYNC-LH 392

Query: 562  EKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITK 621
            EK     L E   S+L+E    L ND + + +E+      +  +  D+      +  IT+
Sbjct: 393  EK----YLTEGG-SILEEKIAVLNNDKREIQEELE-----RFNKRADI-----SKRRITE 437

Query: 622  EIS-NGE---TECNDGRSKLKEMKNVLNMQRQ---RASEARLALANVQNRG------KVL 668
            E+S  GE   T+ ND R  L E KN L+ +R    +  ++ +  AN Q         + L
Sbjct: 438  ELSITGEKLDTQLNDLRVSLNE-KNALHTERLHELKKLQSDIESANNQEYDLNFKLRETL 496

Query: 669  TALYKLQKSGR------------------IVGFHGRLGDLGTIDN-TYDVAVSTACPR-L 708
              +  L  + R                    G  G + DL       Y +AVST   +  
Sbjct: 497  VKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNF 556

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDL----IK 764
            D ++VE +   Q+CI +L+K + G A FI LD + +    T+  P +   +  +     +
Sbjct: 557  DSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQDYILSINAIDYE 615

Query: 765  PKDSKFVPAFY--SVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGN 821
            P+  K +      S++ +TL +AKDLK    +     R ++VT++G LI  +G M+GG +
Sbjct: 616  PEYEKAMQYVCGDSIICNTLNIAKDLKWKKGI-----RGKLVTIEGALIHKAGLMTGGIS 670

Query: 822  HVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNF----ELANNA------FYEME 871
                             D  N  D E+ +  +S K+K      EL+N          E+E
Sbjct: 671  G----------------DANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVE 714

Query: 872  NELQKLNNRKPEIELEISKIIMEIDTYSAEIKSK----ERQLQEKTNIDNSELQDNEELK 927
            N +  LN+    +  ++++    +D    EIK      E+++Q K      +L D E  K
Sbjct: 715  NSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTK 774

Query: 928  VAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILT 987
               +NL K KE   ALQ+            KE   KIG                     T
Sbjct: 775  ---DNLVKEKE---ALQNNI---------FKEFTSKIG--------------------FT 799

Query: 988  AKQKKDRTSK--KKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNID-- 1043
             K+ ++ + +  ++   EL++ +K +LT +N +   TD +     R +K    L N    
Sbjct: 800  IKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVE 859

Query: 1044 -KSIEE-----------FQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKL 1091
             KS+EE            ++  E  K+  DEL+ K V  +  +N  +    ++N+ L+ L
Sbjct: 860  MKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVL 919

Query: 1092 NGLLNHIKNQIKTLE-DSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHE 1150
                + IK  I+  + + ++ L   K+  + + +  E+        T+ D  I       
Sbjct: 920  KRERDGIKEDIEKFDLERVTALKNCKISNINIPISSET--------TIDDLPI------- 964

Query: 1151 LTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIE 1210
                +  D++++ I N  ++   GLP    +  +      +E ++ ++E+ +     N  
Sbjct: 965  ----SSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNAR 1020

Query: 1211 VLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQ 1270
             LE Y +    F+    +      + + +  Q  ++KK R E F   F  +S  L  +Y+
Sbjct: 1021 ALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYR 1080

Query: 1271 MIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLA 1321
             +T          GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LA
Sbjct: 1081 ELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALA 1140

Query: 1322 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQ 1380
            L+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  
Sbjct: 1141 LLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDA 1200

Query: 1381 LVGIYKCENRTHSATI 1396
            LVG+Y+ +    S  I
Sbjct: 1201 LVGVYRQQQENSSKII 1216

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  268 bits (686), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 348/1337 (26%), Positives = 629/1337 (47%), Gaps = 215/1337 (16%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L LNNFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R + + DLI
Sbjct: 7    LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 214  HK--------SEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
            ++        + +   +TS  V   +     +   +    + +P + + R    N  + Y
Sbjct: 67   YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAISTNGDTTY 125

Query: 266  YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
             INGK   Y + ++ L+ E I +  K FL+ QG+VE IA   P         L +  E++
Sbjct: 126  KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 326  IGTSKYKQLIEKDLIEIESLNEICIEK-ENRFEI------------VDRE-KNSLESGKN 371
             G+ +YK+  ++   +IE LN+   E   NR  I             D E KN++E  K 
Sbjct: 179  SGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEYKNNIEKRKK 238

Query: 372  -------LALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQ 424
                     L  LE EK+ +L        NL    S+++    KI+  NEE N+++SK+ 
Sbjct: 239  YYMYLVLWQLYHLENEKKKSLD-------NLKNAKSEISQLKNKIT--NEEKNLQRSKSS 289

Query: 425  TLQN--EINRTKQLLN-ESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAK 481
             L+   ++N+ ++ LN + + K K+LE      L S +I      +  +++ N+ ++   
Sbjct: 290  FLKENLKVNKKREQLNYQLKEKDKLLE-----DLNSIKI---PQRAASKRINNIEKRIES 341

Query: 482  TEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL------ 535
             +K I   +  I++  ++++ + K+++ +  E++   Q   S + SL    LKL      
Sbjct: 342  IQKDIERQQGYINTFENQLKVVTKAKESFEREIKESAQN--SNKYSLSDDDLKLYESLNE 399

Query: 536  ---KEKTSGISEEILIHEHD-------LEPWNIKVQEKKTEI--QLVESQISLLQEGQVK 583
                E  S I ++I +  +D       ++  N K+   K  I  +L+ SQ  +  E    
Sbjct: 400  KYLMENGSAIEQQISLLNNDKQEVLEEMDRLNRKIDASKKRITEELLISQERIQNE---- 455

Query: 584  LKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMKN 642
               +I+++S      +    K  E    LK  Q+ I    +N E + N   R  L ++ +
Sbjct: 456  ---NIELVSSLNEKNSIFSEKTHE----LKTLQAEIESS-NNQEYDTNYKLRETLLKLDD 507

Query: 643  VLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTID-NTYDVAV 701
            +   QR+   E +L   NV       T L +        G  G + DL     + Y +AV
Sbjct: 508  LNANQRESIKEKKLR-ENV-------TMLKRF-----FPGVRGLVHDLCRPKKDKYGLAV 554

Query: 702  STACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLF 760
            ST   +  D I+V+ +   Q+CI + +K + G A FI LD + S      Q   N+P   
Sbjct: 555  STILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPLDTISSE-----QPTLNLPSSQ 609

Query: 761  DLIKP-----KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSG 814
            D I        D ++  A   V  D+++   L  A  + + +  R ++VT++G LI  +G
Sbjct: 610  DYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAG 669

Query: 815  TMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENEL 874
             M+GG   +SK             D  N  D E+ +  ++ K+K          E+  + 
Sbjct: 670  LMTGG---ISK-------------DSNNRWDKEEYQSLMTLKDKLLLQVE----EISTKS 709

Query: 875  QKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQE-KTNIDNSELQDNEELKVAIENL 933
            +  + R  ++E+E+S +  EI +   ++   +R L E KT I++     +++    +++L
Sbjct: 710  RLSSTRARDVEIELSTLNAEISSLRMQLSQVQRSLDENKTEINHQNTLLDQQYNPKLKSL 769

Query: 934  QKLKEEHLALQDKTKAKKKKIAS--LKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQK 991
            ++  +E     ++ K+ K+K+ +   KE   K+G                     T ++ 
Sbjct: 770  KEKVDEFDKSWNELKSNKEKLQNEIFKELTDKVG--------------------FTIEEY 809

Query: 992  KDRTSK--KKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEF 1049
            +  + +  +K   EL++ +K +L  +N +    + ++   +R+    S+L    ++++  
Sbjct: 810  ERHSGELLRKQSKELQQLQKEILNIENKLQFEIERLENTQKRLTSAESNLEKAHETLKSL 869

Query: 1050 QAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSL 1109
            Q      KDE +EL ++V  +E  IN  +       N+L+ +N +    +  I  +E+SL
Sbjct: 870  Q------KDE-NELAEQVKQIESEINSAR-------NELDSVNKVFTAQQLDINRMEESL 915

Query: 1110 SKL-----TLRKMHQVLMALDEESEAKAPNN----GTLSDEQIHDQTGHELTNTAVQD-- 1158
             +L     TL++        DE  E  A N+    G L + ++ +     ++ T + D  
Sbjct: 916  GELNDNSQTLKRNR------DEIKEDIAKNDLERIGILKNAKVTNIDIPVISETNLSDLP 969

Query: 1159 -----DDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLE 1213
                 +D++ + N  +V    LP    +E+ +     ++T++ ++E  ++    N    +
Sbjct: 970  IDRIDEDTISVSNEIDVDYTALPAKYKEEMGSATKNELDTKIKNVEDLLDVLQPNARAAD 1029

Query: 1214 EYVKRLTEFKTRKLDLNDAVDK-RETVRKQLEE---LKKTRYEEFMHGFGIISMTLKEMY 1269
                R TE + R   ++   +K + T RK L++   +KK R E F + F  +S  L  +Y
Sbjct: 1030 ----RFTEAQERFEIIDGETEKIKTTERKALQQFLKIKKKRKELFENAFDFVSEHLDNIY 1085

Query: 1270 QMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320
            + +T          GGNA L L D  +PF+ GV +   PP K ++++  LSGGEKT+++L
Sbjct: 1086 RELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRFKDMEYLSGGEKTVAAL 1145

Query: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQ 1379
            AL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     N QFIVISL+N MFE + 
Sbjct: 1146 ALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNLQFIVISLKNTMFEKSD 1205

Query: 1380 QLVGIYKCENRTHSATI 1396
             LVG+++ +    S  +
Sbjct: 1206 ALVGVFRQQQENSSKIV 1222

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  266 bits (680), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 353/1326 (26%), Positives = 612/1326 (46%), Gaps = 196/1326 (14%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7    LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 214  HKS----------EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSS 263
            ++               D    S + +  Y    +    K+ E     +ISR    N  +
Sbjct: 67   YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMR--IISR----NGDT 120

Query: 264  KYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 323
             Y I+ K  +Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E
Sbjct: 121  SYKIDEKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFE 173

Query: 324  DIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---LEKE 380
            ++ G+ +YK+  ++   +IE L++   E       +  E  + + G N   E+   +EK+
Sbjct: 174  EVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKK 233

Query: 381  KQLTLSKSKLLQYNLWQNNSKLTNTLQ----KISALNEEYNVEKSKNQTLQNEINRTKQL 436
             +L   ++    Y+L Q   +LT+ L     +IS+L E+ N E    Q  ++   +   +
Sbjct: 234  SELQKFQALWQLYHLEQQKEELTDKLSASNSEISSLKEKINHEMKSLQRSKSSFVKESAV 293

Query: 437  LNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSL 496
            +++ +SK+  +            I + E +  D +L  + Q+ A   K +   EK I SL
Sbjct: 294  ISKQKSKLNYI------------IKDKEKLVSDLRLIKVPQQAAG--KRVLHIEKRIESL 339

Query: 497  TSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPW 556
              ++Q     QK Y +  ET   QL+   +S +  + ++KE      ++  ++E+DLE +
Sbjct: 340  QRDLQR----QKAYVERFET---QLKVVTKSKKTFEEEIKESARNY-DKFKLNENDLETY 391

Query: 557  NIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQ 616
            N   ++  TE        S+L+E      ND + + +E+      +  +  D+      +
Sbjct: 392  NCLHEKYLTE------NGSILEEKIALYNNDKQEIQEELD-----RFNKRADI-----SK 435

Query: 617  SSITKEIS-NGE---TECNDGRSKLKEMKNVLNMQRQ---RASEARLALANVQNRG---- 665
              IT+E+S  GE   T+ ND R+ L E KN ++ +R    +  ++ +  AN Q       
Sbjct: 436  RRITEELSVTGEKLDTQLNDLRASLNE-KNAVHTERLHELKKLQSDIESANNQEYDLNFK 494

Query: 666  --KVLTALYKLQKSGR------------------IVGFHGRLGDLGTIDN-TYDVAVSTA 704
              + L  +  L  + R                    G  G + DL       Y +AVST 
Sbjct: 495  LRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTI 554

Query: 705  CPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDL- 762
              +  D ++VE +   Q+CI +L+K + G A FI LD + +    T+  P +   +  + 
Sbjct: 555  LGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQEYILSIN 613

Query: 763  IKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGN 821
                + ++  A   V  D+++   LK A  + + +  R ++VT++G LI  +G M+GG +
Sbjct: 614  AIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNKGVRAKLVTIEGALIHKAGLMTGGIS 673

Query: 822  HVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNF----ELANNA------FYEME 871
                             D  N  D E+ +  +S K+K      EL+N+         E+E
Sbjct: 674  G----------------DANNRWDKEEYQSLMSLKDKLLVQIDELSNSQRSNSIRAREVE 717

Query: 872  NELQKLNNRKPEIELEISKIIMEIDTYSAEIKSK----ERQLQEKTNIDNSELQDNEELK 927
            N +  LN+    +  ++++    +D  + EIK      E+++Q K      +L D E  K
Sbjct: 718  NSVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHNDLLEKEIQPKITELEKKLDDLENTK 777

Query: 928  VAIENLQKLKEEHLALQDKTKAKKKKIA-SLKEKIMKIGGIELQVQNSKVTSIVQRIDIL 986
              +E     KE+ +   D  K    KI  S+KE     G  EL  Q SK    +Q+  IL
Sbjct: 778  NGLE-----KEKEILQNDIFKEFTSKIGFSIKEYENHSG--ELMRQQSKELQQLQK-QIL 829

Query: 987  TAKQKKDRTSKKKSDTE--LEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDK 1044
            T + K    + + + T+   EKA+K L  ++ +++ + +    I  +I+ I S L     
Sbjct: 830  TVENKLQFETDRLNTTQRRYEKARKDLEKAQVEMSSLEEQEHAIEMKIESIGSKL----- 884

Query: 1045 SIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKT 1104
                     E  K+   EL+ K+V  + ++N  +    ++N+ L+ L    + IK  ++ 
Sbjct: 885  ---------EENKNHLVELEKKLVTKQSDLNSSEDILEDMNSNLQVLKRERDGIKEDVE- 934

Query: 1105 LEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDI 1164
             ++ L K+T  K  ++       S    P         I  QT  +    + +D D++ I
Sbjct: 935  -KNDLEKVTALKNCKI-------SNINLP---------ILSQTTLDDFPISSRDSDAITI 977

Query: 1165 DNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKT 1224
             N   V   GLP    +  S      +E ++ ++E+ +     N   +E Y +    F+ 
Sbjct: 978  SNSIVVDYKGLPKKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERYDEAEGRFEV 1037

Query: 1225 RKLDLNDAVDKRETVRK----QLEELKKTRYEEFMHGFGIISMTLKEMYQMIT------- 1273
                +N+  ++ +T  K    Q  ++K+ R E F   F  +S  L  +Y+ +T       
Sbjct: 1038 ----INNETEQLKTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNV 1093

Query: 1274 --MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKP 1331
               GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P
Sbjct: 1094 ELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQP 1153

Query: 1332 TPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKCENR 1390
            +P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+ +  
Sbjct: 1154 SPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQE 1213

Query: 1391 THSATI 1396
              S  I
Sbjct: 1214 NSSKII 1219

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  266 bits (680), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 338/1310 (25%), Positives = 622/1310 (47%), Gaps = 164/1310 (12%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 43   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 214  HKS----------EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSS 263
            ++           +   D  + + +    Y    +    K+ E      ++R   +N  +
Sbjct: 103  YRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVE------LTRLISRNGDT 156

Query: 264  KYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 323
             Y I+GK   Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E
Sbjct: 157  TYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT-------DLSRMFE 209

Query: 324  DIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---LEKE 380
            ++ G+ +YK+  ++   +IE L++   E       +  E  + + G N   E+   ++K+
Sbjct: 210  EVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVDKK 269

Query: 381  KQLTLSKSKLLQYNLWQNNSKLTNTLQ----KISALNEEYNVEKSKNQTLQNEINRTKQL 436
             +L   ++    Y+L Q   +LT+ L     +I +L E  N E    Q  ++   +   +
Sbjct: 270  NELQKFQALWKLYHLEQKKEELTDKLSASNSEIMSLKERINNETKSLQRSKSSFVKESTV 329

Query: 437  LNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSL 496
            +++ +SK+  +  ++++ +   R+++    +   ++ ++ ++    ++ +   E  +   
Sbjct: 330  ISKQKSKLDYIVKDKEKLMSDLRLIKVPQQAAGRRISHIEKRIGSLQRDLERQESYVERF 389

Query: 497  TSEIQELEKSQKEYSDELETLNQQL------QSERESLEAMKLK-LKEKTSGISEEILIH 549
             ++++ + KS+K + +E++   +        +S+ ++ +++  K L +  S + E+I + 
Sbjct: 390  ETQLKVITKSKKTFEEEIKESARNYDKFKLNESDLKTYDSLHEKYLTQGGSILEEKISLS 449

Query: 550  EHD-------LEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALK 602
             +D       L+ +N     K+ +I        L   G+ KL   +  L   ++ + AL 
Sbjct: 450  NNDKQEIVDELDRFN-----KRADISKRRITEELFITGE-KLDTQLNDLRASLNEKNALH 503

Query: 603  IKREEDLVNLKKQQSSITKEISNGETECN-DGRSKLKEMKNVLNMQRQRASEARLALANV 661
             +R   L  LKK QS I +  +N E + N   R  L ++ ++   QR+   E +L   N+
Sbjct: 504  TER---LNELKKLQSDI-ESANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLR-ENI 558

Query: 662  QNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDN-TYDVAVSTACPR-LDDIVVETVECG 719
                 +L   +         G  G + DL       Y +AVST   R  D ++VE +   
Sbjct: 559  A----MLKRFFP--------GVKGLVHDLCHPKKEKYGLAVSTILGRNFDSVIVENLTVA 606

Query: 720  QQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDL----IKPKDSKFVPAFY 775
            Q+CI +L+K + G A FI LD + +    T+  P +   +  +     +P+  K +    
Sbjct: 607  QECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVC 665

Query: 776  --SVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQR 832
              S++ +TL +AKDLK    V     R ++VT++G LI  +G M+GG +           
Sbjct: 666  GDSIICNTLNIAKDLKWKKGV-----RAKLVTIEGALIHKAGLMTGGISG---------- 710

Query: 833  KGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKII 892
                  D  N  D E+ +  +S K+K     +    E+ N  +  + R  E+E  +S + 
Sbjct: 711  ------DTNNRWDKEEYQSLMSLKDKLLIQID----ELSNSQRSSSIRAREVENSVSLLN 760

Query: 893  MEIDTYSAEIKSKERQLQE-KTNID-NSELQDNE------ELKVAIENLQK----LKEEH 940
             +I +   ++  ++R L E K  I  +++L DNE      EL+  +E+L+K    L++E 
Sbjct: 761  SDIASLRTQVTQQKRSLDENKLEIKYHNDLIDNEIQPKITELEKKLEHLEKTKNELEKEK 820

Query: 941  LALQDKT-KAKKKKIA-SLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKK 998
             ALQ +  K   +KI  S+KE     G  EL  Q SK    +Q+  ILT + K    + +
Sbjct: 821  EALQSEVFKEFTEKIGFSIKEYESHSG--ELMRQQSKELQQLQK-QILTVENKLQFETDR 877

Query: 999  KSDTE--LEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETL 1056
             + T+   EKA++       D+  +  ++K + E+ +   + +  I+  +EE + H    
Sbjct: 878  LNTTQRRYEKAQR-------DLANVQIEMKSLEEQEETTETKIKAIESKLEENKMH---- 926

Query: 1057 KDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRK 1116
                DEL+ K +  + ++N  +    ++NN L+ L    + IK  I+  +  L ++T  K
Sbjct: 927  ---LDELQKKFIANQSDLNSTEDILEDLNNNLQALKRERDGIKEDIEKFD--LERVTALK 981

Query: 1117 MHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLP 1176
              ++       S    P    LS+  I D         +  D +++ I N  +V   GLP
Sbjct: 982  NCKI-------SNINLP---ILSETTIDDLP------ISSGDSEAISISNNIDVDYQGLP 1025

Query: 1177 ILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKR 1236
                +  +      +E ++++ ++ +     N   +E Y +    F     +  +   + 
Sbjct: 1026 KKYKENSNDSARKELEQKITEADEILNELQPNARAVERYDEAEERFDVINNETEELKSEE 1085

Query: 1237 ETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLD 1287
            + +  Q  ++KK R E F   F  +S  L  +Y+ +T          GGNA L + D  +
Sbjct: 1086 KKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDE 1145

Query: 1288 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
            PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  
Sbjct: 1146 PFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDIT 1205

Query: 1348 NVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+ +    S T+
Sbjct: 1206 NVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  261 bits (668), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 344/1342 (25%), Positives = 623/1342 (46%), Gaps = 233/1342 (17%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7    LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 214  HK------SEKFP-DLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
            ++      SE+ P D         ++ A  E DG  K+ E    + I      N  + Y 
Sbjct: 67   YRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMDG--KVVELMRTINI------NGDTTYK 118

Query: 267  INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
            I+ K  +Y      L++E I +  K FL+ QG+VE IA        +S   L +  E+I 
Sbjct: 119  IDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QSALDLSKLFEEIS 171

Query: 327  GTSKYKQLIEKDLIEIESLNEICIEK-ENRFEIVDREKNSLESGKNLALEFLEKEKQLTL 385
            G+ +YK+  +    E+E L +   E   NR  I       L++ K    E + K+++   
Sbjct: 172  GSIQYKKEYDSLKDELEKLGKSTTESIRNRRRI----HGELKTYK----EGISKDEEYKN 223

Query: 386  SKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIK 445
            +  K  +Y ++        TL K+  L+ +    K K +  + E+++ K+ +N       
Sbjct: 224  NVEKKKKYEMY-------FTLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEKIN------- 269

Query: 446  VLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIA----------TTEKTISS 495
                EEK   +SK     E+  L +K   L     + EK+I+           + K I +
Sbjct: 270  ---NEEKHLTRSKSAFLKENSILTKKRSQLDYTVKEKEKVISQCNSIKIPLRASSKRIMN 326

Query: 496  LTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEP 555
            +   I+  ++  +   D + T   QL+   ++ E  ++++K K++   ++  + + DL+ 
Sbjct: 327  IEKRIESFKRDIERQKDYVSTFENQLKVVTKAKELFEVEIK-KSARNHDKFRLTDTDLK- 384

Query: 556  WNIKVQEK--KTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLV--N 611
            W  ++ EK   T   L+E +ISLL   + +  +++++L++ + + +  ++  E ++   N
Sbjct: 385  WYEQLNEKYLSTGGSLLEQKISLLNNDKQEKTDEMELLNRHI-DVSKNRVTEELNITGEN 443

Query: 612  LKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTAL 671
            L+ Q + +T  ++       +   KLK+ +    MQ + ++     L N + R + L  L
Sbjct: 444  LQNQVTDMTSTLNEKNATYAEQMKKLKDYQ----MQVESSNNQEYDL-NYKLR-ETLVKL 497

Query: 672  YKLQKSGR------------------IVGFHGRLGDLGTIDN-TYDVAVSTACPR-LDDI 711
              L  + R                    G  G + DL       Y +AVS    +  D I
Sbjct: 498  DDLSANQRESLKEKKLRENVTMLKRFFPGVKGLVHDLCRPKKEKYGLAVSVMLGKNFDSI 557

Query: 712  VVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRL-------FDLIK 764
            +VE +   ++CI +L+K + G A FI LD + S    T+  P +   +       +DL  
Sbjct: 558  IVENLSVARECISFLKKQRAGTASFIPLDTIDS-EQPTLSAPPSQEYILTINAIEYDLAY 616

Query: 765  PKDSKFVPAFYSVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHV 823
             +  ++V    S++ DTL +A+DLK    V     R ++V+LDG LI  +G M+GG +  
Sbjct: 617  ERAMQYVCG-DSIICDTLDIARDLKWNRGV-----RSKLVSLDGSLIHKAGLMTGGISKD 670

Query: 824  SK---------GLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENEL 874
            SK          LM L+ K          E+V  + +D + K +          E+E+ L
Sbjct: 671  SKNRWDKEEYQSLMTLKDKLL-----IQIEEVSTVGRDAAAKAR----------ELESSL 715

Query: 875  QKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQ 934
              LN     +  ++ ++   ++  + EI    + L E+                    L+
Sbjct: 716  SLLNAELSSLRTQLVQVKRSVEENANEINYHNKLLTEQYT----------------PKLE 759

Query: 935  KLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDR 994
             L+EE  A+++   +   +  SL+E I K    EL     KV   +Q  +  +    +++
Sbjct: 760  SLQEEIQAIENSISSITAEKVSLQETIFK----EL---TDKVGFSIQDYERYSGDLMREQ 812

Query: 995  TSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKE 1054
            +       EL++ +K +L  KN +   ++ +K       K  +SL    +S+E  +++ +
Sbjct: 813  SK------ELQQLQKQILNIKNKLQFESERLKTTE---GKYHASL----ESLESAKSNLQ 859

Query: 1055 TLKDECDELKDKVVDLEENINE-----------FKSFEIEVNN---KLEKLNGLLNHIKN 1100
            +L++E +E + K   +E++I+E           + + +++ NN    L + N  L  +K+
Sbjct: 860  SLEEEENECQQKRKQIEQHISEDEAELNRLQRVYDARQLDFNNLDDVLAEYNNELQSLKH 919

Query: 1101 QIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQ--D 1158
                + + + K+ L ++  +              N  +++ +I   +   L+N  +   D
Sbjct: 920  NRNQIREDMEKIDLERVGVL-------------KNCKITNMEIPILSDINLSNLPIDKID 966

Query: 1159 DDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKR 1218
            +D++ I N  +V  N LP     E SA  I        +LE +I S +  + VL+   + 
Sbjct: 967  EDTIAISNEIDVDYNDLPA-KYKESSATTIR------EELENHIRSIEDTLNVLQPNARA 1019

Query: 1219 LTEFKTRKLDLNDAVDKRETVRKQLEEL--------------KKTRYEEFMHGFGIISMT 1264
            +  F       +DA ++ E V K+ E+L              KK R E F + F  ++  
Sbjct: 1020 VERF-------DDAQERFEVVEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNEH 1072

Query: 1265 LKEMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEK 1315
            L  +Y+ +T          GGNA L L D  +PF+ G+ +  MPP K ++++  LSGGEK
Sbjct: 1073 LDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGEK 1132

Query: 1316 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNM 1374
            T+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     + QFIVISL+N M
Sbjct: 1133 TVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTM 1192

Query: 1375 FELAQQLVGIYKCENRTHSATI 1396
            FE +  LVG+Y+ +    S  +
Sbjct: 1193 FEKSDALVGVYRQQQENSSKIV 1214

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  259 bits (661), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 338/1327 (25%), Positives = 602/1327 (45%), Gaps = 198/1327 (14%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   VG    +F++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7    LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 214  HKSEKFPDLTSCSVDVE-----------FLYAIDEHDGDTKISETKPKLVISRKAFKNNS 262
            ++  +  D      +             ++ A    +G     E  P +   R   ++  
Sbjct: 67   YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEG-----EESP-IEFMRTISRSGE 120

Query: 263  SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
            S Y +NGK   Y D T +L++E I +  + FL+ QG+VE IA        +S   L +  
Sbjct: 121  SAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIAS-------QSAGELTKLF 173

Query: 323  EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQ 382
            E I G+ +YK+       E E LN+    K       D    SL   K +  E     KQ
Sbjct: 174  EQISGSVQYKR-------EYEILNDEY--KAAAMATAD----SLSRRKRIHAEL----KQ 216

Query: 383  LTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS 442
                  K  QY  +  + K    LQK  AL E Y++E+ +N +L +E+  +K  L++ + 
Sbjct: 217  YKEGVVKDEQYKGYAQDKK---KLQKNFALWELYHLERKRN-SLIDELQVSKSKLSDLKG 272

Query: 443  KIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIAT----------TEKT 492
            K   L  EE    +SK     E +++ +    L  K+   EK+ ++          T K 
Sbjct: 273  K---LSTEESLLQRSKGSFAKEELAITKYRSKLIGKRNNVEKLTSSLLPVRSSKQATTKR 329

Query: 493  ISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHD 552
            I+++   I+ L++     +  +E    QL+   ++    + +++E +   ++ IL     
Sbjct: 330  IANIERRIESLQRDIDRQTSYVENFEHQLKVVTKTKNNFQNEIEESSKNFNKYIL----- 384

Query: 553  LEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREE----- 607
              P +++  E   E+ L     +L ++  V+  N  + L +    Q  + + +       
Sbjct: 385  -SPEDLRQYEHLKEMYLSSGGSNLEEKINVENNNKQEFLEEIERFQKRIDVSKSRTTEEL 443

Query: 608  --DLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRG 665
              +   L  Q S  T+ +++  T  +     LKE+++ +     +  E    L  V  + 
Sbjct: 444  NVEYERLNSQASDTTQSLNDKNTLLSRKIKDLKELQSKIESTNSKEYELNYKLREVLVKL 503

Query: 666  KVLTALYKLQKSGR------------IVGFHGRLGDLGTID-NTYDVAVSTACPR-LDDI 711
              L+A  +     R              G  G + DL     + Y VAVST   +  D +
Sbjct: 504  DDLSANQRETNKERKLRENVATLKRLFPGVRGLVHDLCHPKKDKYAVAVSTVLGKNFDSV 563

Query: 712  VVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTN-TIQTPKNVPRLFDLIKPKDSKF 770
            +V+     Q+CI YL++ + G A FI LD + +   N  +   K      D I   DS+ 
Sbjct: 564  IVDNFSVAQECISYLKRQRSGVASFIPLDTIDAITANLPVSNTKGCILAIDSI-SYDSEL 622

Query: 771  VPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM 829
              A   V  D+++   L  A  + + +  R ++VTL+G LI  +G M+GG +        
Sbjct: 623  EKAMQYVCSDSIICDSLDLAKDLKWNRGIRSKLVTLEGALIHKAGLMTGGAS-------- 674

Query: 830  LQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKP-EIELEI 888
              R+G N +D    + +  ++  L+ +  + EL ++         ++L++ K  E+E EI
Sbjct: 675  --REGNNRWDKEEYQGLLALKNRLTSE--STELISH---------ERLDSAKARELENEI 721

Query: 889  SKIIMEIDTYSAEIKSKERQLQE-KTNIDNSELQDNEELKVAIENLQ-----------KL 936
            S +  EI     ++   +R L+E K  I   E    +E    I++L+           + 
Sbjct: 722  SVLNTEISGLRTQLNQIQRSLKENKVEIQYHEDMVKKEYIPKIDSLRNKAAQCEARVSQF 781

Query: 937  KEEHLALQDKT-KAKKKKIA-SLKE------KIMKIGGIELQVQNSKVTSIVQRIDILTA 988
            + E   LQ++  K   +K+  S+KE      +IM+    ELQ    ++ +I  +++    
Sbjct: 782  EHEKETLQERIYKGITEKLGFSIKEYEQHSGEIMRKQAKELQQLQKQIMNIKNKLEFENE 841

Query: 989  KQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEE 1048
            + +  R   +KS  +LEK K+ L + +++   I DDI ++ + I K +  L  + K IE 
Sbjct: 842  RLESTRARHEKSTKDLEKVKEELKSLESEEVKILDDINKLEDCIAKDNEEL--VQKQIE- 898

Query: 1049 FQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDS 1108
                        D+       LEE I       +E++N ++         K + + L++ 
Sbjct: 899  -----------LDKKSLTTNSLEETI-------VEISNSMQ-------MTKREYEELKED 933

Query: 1109 LSKLTLRKMHQVLMALDEESEAKAPN-NGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNG 1167
            + KLTL +++ +          K  N +  +    + D    ++ +  ++  +S+DID  
Sbjct: 934  IEKLTLERVNTL-------KNCKITNIDLPVRSSSLEDLPMDKMDSATIEIANSIDIDYT 986

Query: 1168 AEVI----SNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFK 1223
                    SNG               LV  +  +  K IE     ++   + V+R  E +
Sbjct: 987  KLTAKYKESNG--------------DLVRQDFQESLKKIEHALLELQPNSKAVERYEETQ 1032

Query: 1224 TRKLDLNDAVD----KRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT------ 1273
             R   +N   +    K + +R+Q  ++K++R E F   +  +S  + ++Y+ +T      
Sbjct: 1033 MRYDVINGETESLKAKEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHST 1092

Query: 1274 ---MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1330
                GG+A L L D  +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+
Sbjct: 1093 AALAGGSASLTLEDEDEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQ 1152

Query: 1331 PTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKCEN 1389
            P+P +V+DE+DAALD  NV  +A YIK   + N QFIVISL+N+MFE +Q LVG+++ + 
Sbjct: 1153 PSPFFVLDEVDAALDNTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQ 1212

Query: 1390 RTHSATI 1396
               S  I
Sbjct: 1213 ENTSKVI 1219

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  255 bits (651), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 356/1329 (26%), Positives = 613/1329 (46%), Gaps = 200/1329 (15%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7    LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 214  HKS--------------EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFK 259
            ++                   D T+ +    ++ A   +    K+ E     +ISR    
Sbjct: 67   YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAF--YQKGNKLVELMR--IISR---- 118

Query: 260  NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLL 319
            N  + Y I+GK  +Y D +  L+ E I +  K FL+ QG+VE IA   P         L 
Sbjct: 119  NGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LS 171

Query: 320  EYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFL-- 377
            +  E++ G+ +YK+  ++   +IE L +   E       +  E  + + G N   E++  
Sbjct: 172  KMFEEVSGSIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNEEYIKQ 231

Query: 378  -EKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQL 436
             +K+ +L   ++    Y+L Q   +L   + K+SA N E +       +L+ +IN   + 
Sbjct: 232  VDKKNELQRFQALWQLYHLEQQKEEL---MDKLSASNSEVS-------SLKEKINNEMKS 281

Query: 437  LNESQSKIKVLEGE--EKQQLKSKRIL-EGEHVSLDEKLKNLTQKKAKTEKIIATTEKTI 493
            L  S+S   V EG    KQ+ K + I+ + E +  D +L  + Q+ A   K I+  EK I
Sbjct: 282  LQRSKSSF-VKEGTIISKQKSKLEYIVKDKEKLVSDLRLIKVPQQAAG--KRISHIEKRI 338

Query: 494  SSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDL 553
             SL  ++      Q+ Y +  ET   QL+   +S +  + ++KE      E+  ++E+DL
Sbjct: 339  ESLQRDLGR----QEAYVERFET---QLKVVTKSKKTFEEEIKESARNY-EKFKLNENDL 390

Query: 554  EPWNIKVQEKKTEI-QLVESQISL------------------------------LQEGQV 582
            + +++  ++  T+   ++E +ISL                              L  G+ 
Sbjct: 391  KTYDLLHEKYLTQGGSVLEEKISLSNNHKQEILDELDRFNKRADISKRRITEELLITGE- 449

Query: 583  KLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECN-DGRSKLKEMK 641
            KL   +  L   ++ + AL  +R   L  LKK QS I +  +N E + N   R  L ++ 
Sbjct: 450  KLDTQLNDLRASLNEKNALHTER---LNQLKKLQSDI-ESANNKEYDLNFKLRETLVKID 505

Query: 642  NVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDN-TYDVA 700
            ++   QR+   E +L   N+     +L   +         G  G + DL       Y +A
Sbjct: 506  DLSANQRETMKERKLR-ENIA----MLKRFFP--------GVKGLVHDLCHPKKEKYGLA 552

Query: 701  VSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRL 759
            VST   R  D ++VE +   Q+CI +L+K + G A FI LD + + +  T+  P +   +
Sbjct: 553  VSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLPDSQDYI 611

Query: 760  FDL-IKPKDSKFVPAFYSVLRDTLV------AKDLKQANRVAYGQRRYRVVTLDGKLIDV 812
              +     DS++  A   V  D+++      AKDLK    V     R ++VT++G LI  
Sbjct: 612  LSINAIDYDSEYEKAMQYVCGDSIICNTLNIAKDLKWKKSV-----RAKLVTIEGALIHK 666

Query: 813  SGTMSGG-----GNHVSK----GLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELA 863
            +G M+GG      N   K    GLM L+ K     D+            LS+ +++  + 
Sbjct: 667  AGLMTGGISGDANNRWDKEEYQGLMSLKDKLLIQIDE------------LSNSQRSNSIR 714

Query: 864  NNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDN 923
                 E+EN +  LN+    +  ++++    +D  + EIK     ++++     +EL+  
Sbjct: 715  AR---EVENSVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHNDLIEKEIQPKITELE-- 769

Query: 924  EELKVAIENLQKLKEEHLALQ-DKTKAKKKKIA-SLKEKIMKIGGIELQVQNSKVTSIVQ 981
            E+LK        L++E  ALQ D  K    KI  S+KE     G  EL  Q S+    +Q
Sbjct: 770  EKLKNLENTRNDLEKEKEALQNDIFKKFTDKIGFSIKEYENHSG--ELMRQQSRELQQLQ 827

Query: 982  RIDILTAKQK----KDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISS 1037
            +  ILT + K    KDR         L   ++    ++ND+     ++K + E+ +    
Sbjct: 828  K-QILTVENKLQFEKDR---------LNTTQRRYEKAQNDLKSAQIEMKSLEEQEEAAEM 877

Query: 1038 SLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNH 1097
             + +++  +EE + H E L+ +      K  DL  N            + LE +N  L  
Sbjct: 878  KIKSLESKLEENKIHLEGLQRK---FTAKQSDLNSN-----------EDVLEDMNSNLQI 923

Query: 1098 IKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQ 1157
            +K +   +++   K  L ++  +     +  +    N   LS+  I D         A  
Sbjct: 924  LKRERDGIKEDTEKFDLERVTAL-----KNCKISNINLPILSETTIDD------LPIASG 972

Query: 1158 DDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVK 1217
            D +++ I N  +V   GLP    +  +      ++ ++ ++E+ +     N    E Y +
Sbjct: 973  DSEAISISNKIDVDYKGLPKKYKESNTDSAKKGLDEKIREVEEILNELQPNARAEERYDE 1032

Query: 1218 RLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---- 1273
                F+    +  +   + + +  Q  ++K+ R E F   F  +S  L  +Y+ +T    
Sbjct: 1033 AEERFEVINNETEELKAEEKKILSQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPN 1092

Query: 1274 -----MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1328
                  GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ 
Sbjct: 1093 SNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINS 1152

Query: 1329 YKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKC 1387
            Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+ 
Sbjct: 1153 YQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQ 1212

Query: 1388 ENRTHSATI 1396
            +    S TI
Sbjct: 1213 QQENSSKTI 1221

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  252 bits (644), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 354/1345 (26%), Positives = 605/1345 (44%), Gaps = 240/1345 (17%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7    LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 214  HK----------------------SEKFPDLTSCSVD------VEFLYAIDEHDGDTKIS 245
            ++                      SE  P+  + S +      V  +Y  D+ D  TK +
Sbjct: 67   YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFT 126

Query: 246  ETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQ 305
                     R    +  S Y IN +  +Y    + L+ E I +  K FL+ QG+VE IA 
Sbjct: 127  ---------RTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIAS 177

Query: 306  MKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIE-SLNEICIEKENRFEIVDREKN 364
              P++       L   LE + G+  YK   EK   E + +L E      +R ++    +N
Sbjct: 178  QGPES-------LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKV----QN 226

Query: 365  SLESGKNLALEFLEKEKQL--TLSKSKLLQYN--LWQNNSKLTNTLQKISALNEEYNVEK 420
             L+S K    E +++++Q   +L     L++N  LW+    L + L++   L +   V K
Sbjct: 227  DLKSFK----EGVQRDEQYRTSLEIRDQLKHNFILWE----LFHILKRRKKLVDSLTVSK 278

Query: 421  SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR----ILEGEHVSLDEKLKNLT 476
            ++   L+N+++  +++L    +KIK    + + QL   +     LE E  SL   L  + 
Sbjct: 279  TETTALKNKLSDEERIL----TKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVG 334

Query: 477  QKKAKTEKIIATTEKTISSLTSEIQE--------------LEKSQKEYSDELETLNQQLQ 522
             ++  T K I   EK ISS   +++               + K++K +  ELE ++  L 
Sbjct: 335  SERLATIKRIHNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLN 394

Query: 523  SERESLEAMK----LKLKEKTSG---ISEEILIHEHDLEPWNIKVQEKKTEIQLVESQIS 575
                S E +K    LK K  +SG   I E++ I ++D    N + +     ++    +IS
Sbjct: 395  KFNLSEEDLKQYELLKEKYLSSGGSHIEEKLAILKNDEFELNEESELINKRLKTTRERIS 454

Query: 576  -LLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDG- 633
              LQ     L+ D+  ++Q ++++ ++   + ++   ++    S+     N E E N   
Sbjct: 455  DELQVDVDALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLESL----KNKEYELNFSL 510

Query: 634  RSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTI 693
            R  L ++ ++   QR+   E +L   NV     +L  LY         G  G + DL   
Sbjct: 511  RDVLLKIDDLNADQRETKKERKLR-ENVS----MLKRLYP--------GVKGLVHDLCHP 557

Query: 694  DN-TYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQ 751
                Y +AVST   +  D I+V+++    +CI YL+K + G A FI LD   + + N   
Sbjct: 558  KKEKYAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLD---TIDVNPPS 614

Query: 752  TP-KNVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDG 807
             P  NV      I     +     A   V  D+++  +L  A  + + +  + ++VTL+G
Sbjct: 615  LPVSNVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNG 674

Query: 808  KLIDVSGTMSGGGNHVSKGLMMLQRKGQNYF--DDYNPEDV--EQIEKDLSDKEKNFELA 863
             LI  +G M+GG            +K QN +  D+Y    V  +QI ++L+     F   
Sbjct: 675  ALIHKAGQMTGGT----------AQKNQNRWNKDEYQGLMVLKDQITEELTALSDKFRAD 724

Query: 864  NNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNID-NSELQD 922
            N    E+ENE+  LNN    +  +I+++   +   + EIK  E  +  +      S  Q 
Sbjct: 725  NMKSRELENEISLLNNEISSLRTQITQLERTLSGKNVEIKHNEDLITTEYEPQLKSFTQR 784

Query: 923  NEELKVAIENLQKLKEEHLALQ--------DKTKAKKKKIASLKEKIMKIGGIELQVQNS 974
             EELK     L KL+ E   LQ        DK     K       +IM+    ELQ    
Sbjct: 785  IEELK---SKLTKLESEKDVLQEQIFRPFTDKYGFSIKDYEQGTGEIMRKHSKELQQFQK 841

Query: 975  KVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDK 1034
            ++ +I  +++    +         K+ ++++K K+ L + +    +IT+ IK        
Sbjct: 842  QILTIENKLEFEKDRLGATAARHTKALSDMDKLKEALGSLEKQEDIITEKIK-------- 893

Query: 1035 ISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGL 1094
                  N D  I + Q      + E DE    ++  + NI E +S        ++     
Sbjct: 894  ------NADSKISQEQQLVAIQQKELDEKVHNLISFDSNIAEIQS-------SMQAARRK 940

Query: 1095 LNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNT 1154
            ++ IK  I+TL+  L +L + K  +V       S  + P                 L ++
Sbjct: 941  VDEIKEDIETLD--LEQLGILKNCKV-------SNIELP-----------------LLDS 974

Query: 1155 AVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDL-EKY------------ 1201
            +++D  S+D+     + SN   I+SD          +E + + L EKY            
Sbjct: 975  SLEDI-SIDV-----LDSNNTGIISD----------LEYDFTSLPEKYRLNDGEEVKEEF 1018

Query: 1202 ---IESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVR-------KQLEELKKTRY 1251
               I+  +  +E+L+   K +  +   K  L+   ++ E +R       ++  E+K  R 
Sbjct: 1019 ESEIKKVEEKLEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRK 1078

Query: 1252 EEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKK 1302
            E F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K
Sbjct: 1079 ELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLK 1138

Query: 1303 SWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK- 1361
             ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     
Sbjct: 1139 RFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANP 1198

Query: 1362 NAQFIVISLRNNMFELAQQLVGIYK 1386
            NAQFIVISL+N MFE +Q LVGI++
Sbjct: 1199 NAQFIVISLKNAMFEKSQSLVGIFR 1223

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  251 bits (642), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 349/1344 (25%), Positives = 615/1344 (45%), Gaps = 226/1344 (16%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L LNNFKSY G+  +G   ++F++++GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7    LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 214  HK--------------SEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFK 259
            ++              SE  P+    S  V+  Y+   ++ D         + +SR   +
Sbjct: 67   YRGTLSEEEASSADFESENHPN----SAYVKAFYSPSNNEDDV--------VELSRTVTR 114

Query: 260  NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLL 319
            +  S Y I+GK   Y   ++ L+ E I +  + FL+ QG+VE +A  KP+        L 
Sbjct: 115  SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 320  EYLEDIIGTSKYKQ---LIEKDLIEIESLNEICIEKENRFEI--------VDRE---KNS 365
            +  E + G+ +YKQ    I ++L    S    CI+   R  I        VD++   +  
Sbjct: 168  DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHIGLKSFKEGVDKDEEYRKH 227

Query: 366  LESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQT 425
            LE   NL              + +L+ + L+   +K  N + K+    E         Q 
Sbjct: 228  LEDRNNL--------------QQQLIVWQLFHLQAKRENLIDKLKHSKEVL-------QN 266

Query: 426  LQNEINRTKQLLN---ESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKT 482
            LQ+  NR  ++L     S +K + L  ++K +L ++  ++ + +     L     K+  +
Sbjct: 267  LQSNFNREDKILKTRKSSYTKTQALVVKQKSKLSAR--MKAKDLLTSSVLPIKLSKEGVS 324

Query: 483  EKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQ---LQSERESLEAMKLKLKEKT 539
            ++I+A  E  I SL  +I   E   K+Y  +L+ + +    LQ+E E           K+
Sbjct: 325  KRIVAA-ETKIESLQKDIDRQEILVKQYRRQLKVVEKAKDTLQTEIEE--------SHKS 375

Query: 540  SGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQT 599
            SG   + ++ E  L+ +      +K +   + S  S L+E  +  KN+ + L +E+   T
Sbjct: 376  SG---DFMLSEDKLKAY------EKLKETFLSSGGSTLEEQLLLKKNEQQELLEEIEMYT 426

Query: 600  ALKIKREEDLV--------NLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRA 651
                  +E L         NL+ +   ITK       E +    KLKE+++       R 
Sbjct: 427  KRLDSSKEKLAEELGSEKENLEIEVQDITKSFDKKSHETSRTVKKLKELQSRAESNNNRE 486

Query: 652  SEARLALANVQNRGKVLTALY-------KLQKSGRIV-----GFHGRLGDLGTIDN-TYD 698
             E    L     +   + A+        KL+++  ++     G  G + DL       + 
Sbjct: 487  YEINYKLKETLTKLDDMNAVQRESAKEKKLRENVSMLRRLFPGVRGLVHDLCHPKKEKFA 546

Query: 699  VAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTP-KNV 756
            VAVST   +  D ++V+     QQC+ +L+K + G   FI LD +       I +  K  
Sbjct: 547  VAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPLDTVDVSKVPMIASEFKGC 606

Query: 757  PRLFDLI--KP---KDSKFVPAFYSVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLI 810
                D I  +P   +  ++V +  S++ DTL +AKDLK  + +     R ++V+++G ++
Sbjct: 607  ILAIDAIDYEPDLERAMQYVCS-DSIICDTLQIAKDLKWKHNI-----RSKLVSINGSIV 660

Query: 811  DVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYE- 869
              +G M+GG    SKG       G N +D    + +  + KD+  KE + EL+  +  + 
Sbjct: 661  HRAGLMTGGA---SKG-------GNNRWDKEEYQSLMSL-KDVFLKELS-ELSAASISDA 708

Query: 870  -----MENELQKLNNRKPEIELEISK-----------IIMEIDTYSAEIKSKERQLQEKT 913
                 +EN+L  LN     ++ ++++           I  +ID    EI+ + + L++  
Sbjct: 709  ERIRILENDLSILNTDLMSLKTQLAQSKRMLKEKETEIQYQIDLAEGEIEPRIKTLKDDL 768

Query: 914  NIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQN 973
            +  N E+ D E+ K  ++N   +  +       T  + +  + +   I+K    +L+   
Sbjct: 769  HRYNQEIADLEKQKAKLQN--SVYADVFRDVGFTAVEYEMHSGI---ILKKQAEDLRKLQ 823

Query: 974  SKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERI- 1032
             ++ SI ++++    +    +  ++K+  +LEKAK  L    ND   I   I E+ ERI 
Sbjct: 824  MQMVSIDKKLEFEVERLHATQERQQKAQVDLEKAKIKLEALNNDEESINLKI-EMEERII 882

Query: 1033 DKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLN 1092
            D+    L+++     +  A    L ++  E+ D +    +  NE  S ++E N  LE+LN
Sbjct: 883  DEEQKQLDSLQDEASQNLAGLNALDEQIQEINDDL-SASKRKNEALSEDLETNT-LERLN 940

Query: 1093 GLLNHIKNQIKTLE--DSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHD---QT 1147
             L N     IK  E   SL +L L K+ +  +         A N+ +++   +     Q+
Sbjct: 941  VLKNCKMQNIKLPEGSSSLDELPLDKVDEFTL--------NAANDVSINYAGLSKKLRQS 992

Query: 1148 GHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDA 1207
            G E T   ++                     S DEL+ L +T+++       +Y    DA
Sbjct: 993  GEEETGAGLKK--------------------SIDELNEL-LTILQPNSKAAGRY---EDA 1028

Query: 1208 NIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKE 1267
             +    E + + TE             K + V +    +K+ R E F   F  +S ++ E
Sbjct: 1029 KLRY--ESIYKETE---------KCKAKEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDE 1077

Query: 1268 MYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLS 1318
            +Y+ +T          GGNA L L D  +P+  G+ +   PP K ++++  LSGGEKT++
Sbjct: 1078 IYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIA 1137

Query: 1319 SLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRNNMFEL 1377
            +LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI+ +   + QFIVISL+N MFE 
Sbjct: 1138 ALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQFIVISLKNTMFEK 1197

Query: 1378 AQQLVGIYK-CENRTHSATIKNRE 1400
            +Q LVG+++  +N T  A   N E
Sbjct: 1198 SQALVGVFRQQQNNTSKALTLNLE 1221

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  245 bits (625), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 346/1319 (26%), Positives = 616/1319 (46%), Gaps = 190/1319 (14%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L LNNFKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7    LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 214  HKSEKFPD------LTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
            ++  +  D       +  S  V+  Y  D++       E   K+   R       S Y I
Sbjct: 67   YRG-RMDDRSDEHVASPKSAYVKAFYLKDDN------GEQGTKIEFMRIIQNTGDSVYRI 119

Query: 268  NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
            +GK  ++    + L+ E I +  + FL+ QG+VE IA        +S   L +  E + G
Sbjct: 120  DGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVSG 172

Query: 328  TSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLAL------EFLEKE- 380
            + +Y++       E E L      KE   +  +   +SL+S + + +      E + KE 
Sbjct: 173  SVQYQR-------EYERL------KEEYQKATEEYGDSLKSKRKMQIDLKSFKEGVHKEQ 219

Query: 381  --KQLTLSKSKL-LQYNLWQ------NNSKLTNTLQ----KISAL-----NEEYNVEKSK 422
              K L   ++KL  QY LWQ        S L ++L+    K++ L     NEE+ + KSK
Sbjct: 220  HYKNLLSERTKLNRQYVLWQLYHLEDRRSGLISSLKDSKSKLAQLKSKLTNEEHILHKSK 279

Query: 423  NQTLQNEI--NRTKQLLNESQSKIKVLEGE-----EKQQLKSKRILEGEHVSLDEKLKNL 475
            +Q  ++EI   R K+ L++ Q +   L  E       +Q  SKRI    H+  ++++ +L
Sbjct: 280  SQAAKDEIVITRKKEKLSQLQQERSKLNSELLPVGSSRQSASKRI---NHI--EKRIDSL 334

Query: 476  TQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535
             +   + E  +   +  +  +T     LE   K  S     L+++   E ESL+  +  L
Sbjct: 335  KRDITRQESYVQQFQNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKEYESLK--ETYL 392

Query: 536  KEKTSGISEEILIHEHDLEPW--NIKVQEKKTEIQLVESQISL-LQEGQVKLKNDIKVLS 592
                S + E++ + ++  E     I + E++  I   +S+IS+ L   + KL+ ++  ++
Sbjct: 393  CSGGSALEEKMTLLQNKREELLEEISLYERRANIS--KSRISVELNVEREKLELELSEVT 450

Query: 593  QEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKE----MKNVLNMQR 648
            + ++++ AL   + ++    K+ QS+I +  +N E E N    KLKE    + ++   QR
Sbjct: 451  RVLNSKNALHSAKVKEW---KEVQSAI-ESANNKEYELN---YKLKEVLVKLDDLTADQR 503

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTID-NTYDVAVSTACPR 707
            +   E +L       R  V T L +L       G  G + DL     + Y +AVS+   +
Sbjct: 504  ESNKERKL-------RENVAT-LKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGK 550

Query: 708  -LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTP-KNVPRLFDLIKP 765
              D IVV++V   QQCI YL+K++ G A FI LD   + + NT   P +N+      +  
Sbjct: 551  NFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLD---TIDINTPTLPVRNLKGCILTVNA 607

Query: 766  --KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNH 822
               DS+   A   V  D+++   L  A  + + +  + ++VT+ G LI  +G M+GG   
Sbjct: 608  IEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGG--- 664

Query: 823  VSKGLMMLQRKGQNYFDDYNPEDV----EQIEKDLSDKEKNFELANNAFYEMENELQKLN 878
                   + R   N +D    + +    E++   +S+   +    +      ENEL  LN
Sbjct: 665  -------VGRNNTNRWDKAEYQSLLLLKEKVSGQISELVTSIRQNSVLSRGFENELSLLN 717

Query: 879  NRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDN-EELKVAIENLQKLK 937
            +    +  ++ +I   I+    EI   E  +  + +   S L ++ +EL   + N+ K K
Sbjct: 718  SELVTLRTQLVQINRLIEEKKVEINYHEDLINSEYSPKISALNNSMKELDEQLSNISKNK 777

Query: 938  EEHLALQDKTKAKKK--KIASLKE---KIMKIGGIELQVQNSKVTSIVQRIDILTAKQKK 992
            E       K  A K    IA  +E   + ++    ELQ    ++ +I  +++  T + + 
Sbjct: 778  ETLQGSIYKDFANKVGFTIAEYEEHTGETLREHSRELQQLQKQIMTIENKLEFETERLQG 837

Query: 993  DRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAH 1052
             R   +K+  +LEK K+              + + + E+  KI S +  +D  I +    
Sbjct: 838  TRVRHEKTIGDLEKVKQ--------------ETESLEEQESKIQSQIEQVDSQISQHNEE 883

Query: 1053 KETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKL 1112
             E L++   +    V  LEE  N+              LN ++   K ++  L+D + K 
Sbjct: 884  IEHLQEASRKKYQSVKALEEIAND--------------LNEMVQTSKREVDQLKDDIEKT 929

Query: 1113 TLRKMHQVLMALDEESEAKAPNNGTLSDE---QIHDQTGHELTNTAVQDDDSMDIDNGAE 1169
             + +++  L    + +  + P + +  DE   +  D    E+ N+   D  S+D +   E
Sbjct: 930  GIERVN--LFKNCKMTNVELPTDKSTLDELPIERIDSEAIEMANSITVDYSSLD-NKYKE 986

Query: 1170 VISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDL 1229
              SN    L+ +E         E  + D+E  +     N + +E + +   +F    +D 
Sbjct: 987  SGSN----LTREEF--------EDSIKDIENTLRELQPNSKAVERFDEAKEQFSV-AIDE 1033

Query: 1230 NDAVDK--RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNA 1278
            ++ + +  RE+  K L+ +K+ R + F+  F  ++  +  +Y+ +T          GG+A
Sbjct: 1034 SEKLKEIERESKEKYLK-IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSA 1092

Query: 1279 ELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1338
             L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++D
Sbjct: 1093 SLTLEDEDEPYLAGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILD 1152

Query: 1339 EIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            E+DAALD  NV  +A YIK   +   QFIVISL++N+F  +Q + G+++ +    S  I
Sbjct: 1153 EVDAALDVTNVERIAAYIKRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  243 bits (620), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 341/1339 (25%), Positives = 614/1339 (45%), Gaps = 227/1339 (16%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L NFKSY G   V    ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 214  HKSEKFPDLTSCSVD-------VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
            ++     + T    D         ++ A  E+DG  K+ E     +ISR       + Y 
Sbjct: 67   YRDIISRENTPTGADNDENGNRTAYVKAFYEYDG--KVVELMR--LISRLG----DTSYK 118

Query: 267  INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
            ++G    Y + ++ L+ + I +  K FL+ QG+VE IA   P        GL + +E++ 
Sbjct: 119  LDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEVS 171

Query: 327  GTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLS 386
            G+ +YK+  E+   + + + +   E   +   +  E  + + G +      ++E +  + 
Sbjct: 172  GSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSR-----DEEYRKYVQ 226

Query: 387  KSKLLQYNL--WQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKI 444
            K K +Q NL  WQ                  Y++E  + Q LQ         L ESQ+ +
Sbjct: 227  KKKRVQTNLSLWQ-----------------LYHMEDERYQCLQK--------LEESQNDV 261

Query: 445  KV----LEGEEKQQLKSKRILEGEHVSLDEK---LKNLTQKKAKTEKIIATTEKTISSLT 497
             V    LE EEK     K+ L  E V L +K   +++++++K K E  +   +   ++  
Sbjct: 262  DVIREKLEAEEKNLEVFKKALSKEAVLLTKKKNHIRSISKEKEKAESDLKVVKIPQNASI 321

Query: 498  SEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKT---SGISEEIL------- 547
            + ++ L+K        +++L + L+ E  +LE  K +LK  T   +   +EIL       
Sbjct: 322  NRLKNLDK-------RVDSLQKDLEREEANLEKYKHQLKVVTDSKNAFEQEILSKSKNNN 374

Query: 548  ---IHEHDLEPWN-IKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQ--EVSNQTAL 601
               + E DL+ ++ +K +        +E  ++LL   + ++  D+K+++   E+S Q   
Sbjct: 375  KFTLSEDDLKLYDELKGEYLNNGGIEIEDTLNLLDNKKEEITADLKIINDKVEISKQ--- 431

Query: 602  KIKREEDLVNLKKQQSSITKEISNGETECNDGRS-KLKEMKNV-------------LNMQ 647
              + E++LV  K++Q +  ++ +    E ND  S KL E++               LN  
Sbjct: 432  --RIEDELVTKKEEQDAKIRDSTLLLNEKNDLHSHKLDELRKTQKDIEYWNNKEFDLN-H 488

Query: 648  RQRASEARLALANVQNR-----GKVLTALYKLQKSGRIVGFHGRLGDLGTID-NTYDVAV 701
            + R +  +L   N   R      K+   +  L++     G  G + +L     + Y +AV
Sbjct: 489  KLRDTLVKLDDLNATQRESNKERKLRENVAMLKRF--FPGVRGLVHELCKPKRDKYKLAV 546

Query: 702  STACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPR-- 758
            ST   +  D ++V+++   Q+CI +L+K + G   FI LD   + +  T + P  VP   
Sbjct: 547  STVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLD---TIDAATPRMP--VPESE 601

Query: 759  ----LFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVS 813
                  + ++ KD   V A Y V  DT++  +L  A  + + +    ++VTLDG LI+ +
Sbjct: 602  TYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKT 660

Query: 814  GTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENE 873
            G M+GG          +     N +D    +D  Q   DL DK     L  +   E  N+
Sbjct: 661  GLMTGG----------ITSDSANRWD----KDEYQSLLDLKDK-----LIVDV-EEAANK 700

Query: 874  LQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQE-KTNIDN-SELQDNEELKVAIE 931
             ++      E+E+ +S +  EI     +I   +R ++E +T I++ + L D E     I 
Sbjct: 701  SRQSTLIARELEISLSSLTSEISYIRTQITQTKRAVEETETEINHHNNLIDRE----FIP 756

Query: 932  NLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQK 991
             ++ L+ +   L+D+ +    K  +L+EK             +++T  V      T K  
Sbjct: 757  QVKDLENKISGLEDEIRDWNTKREALQEKCF-----------ARLTEKVG----FTMKDY 801

Query: 992  KDRTSK--KKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEF 1049
            +  T +  +K   EL+  +K +L  +N +   T       +R+  +  + N++   + E 
Sbjct: 802  ESHTGEMIRKQTKELQILQKQILNLENKVEFETGRCNATKDRLQNVQETKNSVQHELNEL 861

Query: 1050 QAHKETLKDECDELKDKVVDLEENINEFKS-FEI-------------EVNNKLEKLNGLL 1095
               ++++K   + L+ ++    E +   K+ F+              E NN+L  +    
Sbjct: 862  VDQEKSIKLSIETLEGELDGKNEELKSIKAAFDSKQKDASATEDIISEYNNRLASIESDR 921

Query: 1096 NHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTA 1155
            N IK+ I  L+  L K+++ K  QV       S    P         +  + G E    +
Sbjct: 922  NEIKDDITRLD--LEKMSILKNCQV-------SGIIVP---------VVSEVGLEELPAS 963

Query: 1156 VQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEY 1215
              DD++++I    E+  + LP    +  SA     +  ++ D++  +E    N   +E  
Sbjct: 964  KVDDEAIEIAKKIEIDFSKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPNARAVE-- 1021

Query: 1216 VKRLTEFKTRKLDLNDAVDK-----RETVRKQLEEL---KKTRYEEFMHGFGIISMTLKE 1267
              R  + K+R     D VDK     +   RK  +E    K+ R E F + F  I+  L  
Sbjct: 1022 --RFDDAKSR----FDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDA 1075

Query: 1268 MYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLS 1318
            +Y  +T          GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT++
Sbjct: 1076 IYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVA 1135

Query: 1319 SLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFEL 1377
            +LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE 
Sbjct: 1136 ALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEK 1195

Query: 1378 AQQLVGIYKCENRTHSATI 1396
            +  LVG+++ +    S  +
Sbjct: 1196 SDALVGVFRQQQENSSKIV 1214

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  239 bits (609), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 354/1346 (26%), Positives = 616/1346 (45%), Gaps = 230/1346 (17%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7    LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 214  HKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESN 273
            H+S +    ++      ++ A  +    ++I+E    + +S +        Y INGK ++
Sbjct: 67   HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITELMRIVNLSGETI------YKINGKTTS 120

Query: 274  YTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQ 333
            + + +  L +E I +  K FL+ QG+VE IA        +S   L +  E + G+ +YK+
Sbjct: 121  FKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGSIQYKK 173

Query: 334  ---LIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKS-- 388
               L+++DL +I  L    I+   R   ++ E    + G     ++ E+   +   K   
Sbjct: 174  EYDLLKEDLNKINRLTNDAIKNRRR---INGELKIYKEGIKKNNQYNEQINNIIQLKKFF 230

Query: 389  KLLQ-YNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVL 447
             LLQ Y+L    S     L+KI    +E N     N+  Q+ ++  K++  +    I   
Sbjct: 231  VLLQLYHLSNEKSTFEKNLKKILVDFDELN---DTNKEFQSNLSNLKKIFIKEDLLIIKQ 287

Query: 448  EGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKS- 506
                 Q+LK+   L  + + +    KNL +K   + KI+   +  I+     I+ LEK+ 
Sbjct: 288  NSLIDQKLKNLNQLNNKFLPIKISSKNLNKKIKNSNKILENLDLDITRQLDSIKLLEKNL 347

Query: 507  ---QKEYSDELETLNQ--------QLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEP 555
               +  Y +    +NQ        Q +   + LE   L  K   +G  E         E 
Sbjct: 348  STIKLTYDNFKLEINQSNEKNSTYQFKDSNDELEYSNLNAKYLNNGGFEL-------EEK 400

Query: 556  WNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQ 615
             N+ + EK    ++++ +  L+ E  +   N+ K+L++   N  +L +K E+   NL ++
Sbjct: 401  LNLLINEKN---EIIDQK--LIVEKLINNSNE-KILNEFNINIDSLNLKIEDLNSNLTEK 454

Query: 616  QSSITKEI-------------SNGETECN-DGRSKLKEMKNVLNMQRQRASEARLALANV 661
             S++  +I             +N E + N   R  L ++ N+   +R+   E +L     
Sbjct: 455  NSTVKAKIKSLKSLQSIIESSNNKEYDLNFKLRDTLLKLDNINATKRESNKEKKL----- 509

Query: 662  QNRGKVLTALYKLQKSGRIV-GFHGRLGDLGTID-NTYDVAVSTACPR-LDDIVVETVEC 718
              R  VLT         RI  G  G + DL     + Y +A+ T   +  + ++V+++  
Sbjct: 510  --RENVLTL-------KRIFPGVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVDSLSV 560

Query: 719  GQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIK--PK---DSKFV-- 771
             Q+CI YL+K + G   FI LD + +           +P L  +I+  PK   DS  +  
Sbjct: 561  AQECISYLKKQRAGIISFIPLDTIEA----------QIPSLPTIIQNNPKYNNDSNCILT 610

Query: 772  -------PAF---------YSVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSG 814
                   P F          S++ D L +AKDLK    V    +  + VTLDG +I  S 
Sbjct: 611  INAIEYEPEFERAMQYICSNSIICDNLDIAKDLKWNQNV----KNVKFVTLDGSIIHKSN 666

Query: 815  TMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEME--- 871
             M+GG +  S     +Q   +   D+Y+                   L +N   E+E   
Sbjct: 667  LMTGGASKNS-----MQSNNRWDKDEYSSL---------------MTLKDNLILEIETIS 706

Query: 872  --NELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVA 929
              N+L  +N+R  E+E EIS +  EI     ++    R L++    +N+EL  ++ L + 
Sbjct: 707  KENKLASINSR--ELETEISLLNSEITNLKTQLTQLTRNLKD----NNTELLYHQNL-IK 759

Query: 930  IENLQKLKEEHLALQD---KTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDIL 986
            ++   KLK+ +  + D   K K  + +  SL+ +  K    EL++  S        ++I+
Sbjct: 760  LDYDPKLKDLNHKIIDIDSKMKIIEDERESLENETFK--DFELKIGFSIKDYKKYSVNII 817

Query: 987  TAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISER-------IDKISSSL 1039
            T + K           +L+K  K +L  +N +    + ++    R       I+K +  L
Sbjct: 818  TEQSK-----------DLQKLAKDILNIENKLQFEKERLESTQLRKEKTLANIEKYNQEL 866

Query: 1040 NNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKL---NGLLN 1096
            N++ +   +    KE      ++ K ++ ++E+NI   K   IE+N K E +      LN
Sbjct: 867  NDLTEQENQLNIQKENDSKLIEKEKTELKEIEKNIQNKK---IEINEKEEVIKQNQNELN 923

Query: 1097 HIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAV 1156
             I+ +I  L +++SK+ L ++  +              N  +S+ +I   +   L N  +
Sbjct: 924  SIQKKIDALNENISKIDLERIGIL-------------KNCKISNIEIPITSAVNLNNLPI 970

Query: 1157 QDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYV 1216
                   ID+ A +ISN + + S +ELS         +  D EK +E     I+  E+ +
Sbjct: 971  DK-----IDDDAILISNDIKV-SFNELSK-----KYKKKQDYEKNLEDISNEIKETEDIL 1019

Query: 1217 KRLTEFKTRKLDLNDAVDKRETVRKQLEELK--------------KTRYEEFMHGFGIIS 1262
              L         L++A DK E +  + E LK              K R E F   F  ++
Sbjct: 1020 LELQPNAKAHDRLDEAKDKFEVIDNETETLKTEEKEILTKFLNIKKKRKELFESCFDFVN 1079

Query: 1263 MTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG 1313
              ++ +Y+ +T          GG A L L D  +PF+ GV +   PP K ++++  LSGG
Sbjct: 1080 EHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYHATPPLKRFKDMEYLSGG 1139

Query: 1314 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRN 1372
            EKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI K   K+ QFI+ISL+N
Sbjct: 1140 EKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYIRKHGNKDLQFIIISLKN 1199

Query: 1373 NMFELAQQLVGIYK--CENRTHSATI 1396
             MFE +  LVG+++   EN + + T+
Sbjct: 1200 TMFEKSDALVGVFRQQTENSSKALTL 1225

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  238 bits (606), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 338/1323 (25%), Positives = 595/1323 (44%), Gaps = 201/1323 (15%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L NFKSY G   VG   ++F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7    LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 214  HKS----EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            ++     E   D    +  V+  Y            ++   + +SR   +N  ++Y +NG
Sbjct: 67   YRGVEGEEDEEDGEGRTAYVKAFYL-----------KSDSTVELSRSISRNGDTQYKMNG 115

Query: 270  KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
            K   Y    + L+EE I +  + FL+ QG+V  IA        +S   L +  E+I G+ 
Sbjct: 116  KNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLFEEISGSI 168

Query: 330  KYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---LEKEKQLTLS 386
            +YK+  +    +++SLN+   E       +  E  S   G +   EF   +EK K+L   
Sbjct: 169  QYKKEYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQVEKRKELQR- 227

Query: 387  KSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKI-- 444
                  Y LWQ    L +   +   L ++    K+  +T++ +    +Q+L  S++    
Sbjct: 228  -----HYALWQ----LYHLETQRHELEDKLANLKNSIKTIRGKETSQEQILQRSRASFAR 278

Query: 445  ---KVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQ 501
                +L+   K + KS+     E   ++++L  +   +    K IA  +K ISSL  +I 
Sbjct: 279  ESASILKQRSKMESKSR-----EKEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDID 333

Query: 502  ELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHD---LEPWNI 558
                 Q+EY   +E    QL    ++    + ++KE +          +HD   L   + 
Sbjct: 334  R----QREY---VERFENQLNVVTKAKSDFEKEIKESSK---------DHDKYKLNEDDT 377

Query: 559  KVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKRE---EDLVNLKKQ 615
            K+     E  L +   SL  + Q+ L +  +++ +  + +    I R    ++L  + ++
Sbjct: 378  KLYASLNEKYLNQGGFSLESQKQLTLNDKQELMDEMETLKKRNDISRSRVTDELSVIAEK 437

Query: 616  QSSITKEISNGETECNDGRS-KLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKL 674
              S   EIS+   E N   S K+KE++  L+ Q + +S     L N + R +VL  + +L
Sbjct: 438  LESQLSEISSTLNERNSTHSDKVKELQK-LHSQIESSSNKEYDL-NYKLR-EVLVKIEEL 494

Query: 675  QKSGR------------------IVGFHGRLGDLGTID-NTYDVAVSTACPR-LDDIVVE 714
              S R                    G  G + DL     + Y +A+ST   +  D ++V+
Sbjct: 495  SASQRETVKERKLRENIATLKRFFPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVD 554

Query: 715  TVECGQQCIEYLRKNKLGYARFILLDKLR-SFNTNTIQTPKNVPRLFDLIKPKDSKFVPA 773
             V   Q+CI YL+K + G A FI LD +     T T+   +      + I   + ++  A
Sbjct: 555  NVMVAQECIAYLKKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAI-DYEQEYERA 613

Query: 774  FYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQR 832
               V  D+++  D+  A  + + +  R ++VTL+G LI  +G M+GG   +SK       
Sbjct: 614  LQYVCSDSIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGG---ISK------- 663

Query: 833  KGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKII 892
                  +  N  D E+ +  ++ K+K  +    A  E +N    L  R  E+E  +S + 
Sbjct: 664  ------NTSNRWDKEEYQSLMTLKDKLLQQVEEAALEGKN--ASLMAR--ELESTLSLLN 713

Query: 893  MEIDTYSAEIKSKERQLQEKT-NIDNSELQDNEELKVAIENLQ-KLKEEHLALQDKTKAK 950
             EI     ++   +R L+E T   D  E    EE +  + NL+ +++  + ALQ+    K
Sbjct: 714  TEISELRTQLTLTQRTLKENTVERDYHEKLIKEEYEPELLNLEERIQNFNFALQELDSQK 773

Query: 951  KKKIASLKEKIMKIGGI----------ELQVQNSKVTSIVQRIDILTAKQK----KDRTS 996
            +K    + E+     G           E+  Q SK    +QR  IL  + K    KDR S
Sbjct: 774  EKLQNEIFEEFTNRVGFTVKDYESHSGEIMRQQSKELQQLQR-QILNVENKLQFEKDRLS 832

Query: 997  KKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETL 1056
               ++    KA + +   + ++T +    KE   RI++I   L +  K +E+FQ   +  
Sbjct: 833  T--TERRFGKAHEDMAKIEFELTQLERQEKETESRINQIDQELADQKKELEQFQKKLDAK 890

Query: 1057 KDECDELKDKVVDLEENINEFKSFEIEVNNKLEKL---------NGLLNHIKNQIKTLED 1107
              + D  +D + ++  N+   K  + E+   +EK+         N  L++I   I  L D
Sbjct: 891  HGDIDSTEDALHEVTANLQALKRHKDELKEDVEKVDMEKVCVLKNCKLSNIT--IPVLSD 948

Query: 1108 S-LSKLTLRKMHQVLMALDEESEA---KAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMD 1163
            + L +L + ++ +  +A+  E E    + P          + ++G E     +++D    
Sbjct: 949  TDLDQLPIDRIDEETIAIAHEIEIDFHELPAK--------YKESGAE----TIREDFEKS 996

Query: 1164 IDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFK 1223
            I +  +++++  P    +E             S+ +   E+ D   E L+   KR     
Sbjct: 997  IKHAEDILNDLQPNAKANE-----------RFSEAQNKFEAIDYETEELKSEEKR----- 1040

Query: 1224 TRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------M 1274
                           V  Q  ++KK R   F   F   S  +  +Y+ +T          
Sbjct: 1041 ---------------VIAQFLKIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELA 1085

Query: 1275 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1334
            GG+A L L D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ ++P+P 
Sbjct: 1086 GGSASLTLEDEDEPFNAGIRYHATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPF 1145

Query: 1335 YVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHS 1393
            +V+DE+DAALD  NV  +A YI +   ++ QFIVISL+N MFE +  LVG+Y+ +    S
Sbjct: 1146 FVLDEVDAALDSTNVDRIAAYISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSS 1205

Query: 1394 ATI 1396
              +
Sbjct: 1206 KIV 1208

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  231 bits (588), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 347/1337 (25%), Positives = 593/1337 (44%), Gaps = 240/1337 (17%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7    LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 214  HKS----EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            ++     E+         D    Y    +    + S  + K  IS    KN  S Y I+ 
Sbjct: 67   YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKGPQESTVELKRTIS----KNGDSTYQIDR 122

Query: 270  KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
            ++  Y   ++ L+ + I +  K FL+ QG+VE +A   P         L +  E++ G++
Sbjct: 123  RQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSGSA 175

Query: 330  KYKQLIEKDLI--EIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---LEKEKQLT 384
            +YK+  E DL+  ++E L+    E       V  E  S   G +   E+   LE +K+L 
Sbjct: 176  QYKK--EYDLLKDQLEQLSHSATESIKDRRRVHSELKSYREGVSKDEEYKKNLENKKELE 233

Query: 385  LSKSKLLQYNLWQNNSKL----TNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNES 440
               +    Y+L     KL     NT   +S L +E    +++  TLQ          +E+
Sbjct: 234  KIFAMWKLYHLQMGKDKLLADMANTESTMSKLRKEI---RTREATLQKS---KASFASET 287

Query: 441  QSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEI 500
             + +K+     K +L  K + + E V  D +L  L Q+   T   I   EK I  L +E+
Sbjct: 288  AALLKL-----KNKLDYK-VRDREKVLSDIRLIKLPQRA--TANRIRNIEKRIDLLQNEL 339

Query: 501  QELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKV 560
                + Q+ Y    ET   QL+   ++  + + +LK +T+G      + + DL  +    
Sbjct: 340  ----RRQESYVARFET---QLEVATKTKVSFEAELK-RTAGDENRYRLTDADLALY---- 387

Query: 561  QEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTAL----KIKREEDL-VNLKKQ 615
            QE   +  L E   S ++E    L ND + +  E+     +    K +  E+L VNL+K 
Sbjct: 388  QELMGKY-LSEGNGSTIEEKLALLLNDKQEVDDELDRYYRMTDVAKSRINEELQVNLEKI 446

Query: 616  QSSITKEISNGETECNDGRSK-LKEMKNVLNMQRQRASEARLALANVQNRGKVLTAL-YK 673
            +   T E+S+   E N   ++ LKE+KN+               + +++RGK    L YK
Sbjct: 447  EMQAT-ELSSSLNEKNALNAENLKELKNLQ--------------SEIESRGKQEYDLNYK 491

Query: 674  LQKS---------------------------GRIV-GFHGRLGDLGTID-NTYDVAVSTA 704
            L+++                            R+  G  G + DL     + Y V+V+T 
Sbjct: 492  LRETLVKIDELSANQRETVRERKLRENVVSLKRLFPGVKGIVSDLCHPKKDKYSVSVATV 551

Query: 705  CPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDK-------LRSFNTNTIQTPKNV 756
              +  D ++V+++   Q+CI YL+K + G   FI LD        L S N       KN 
Sbjct: 552  LGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPLDTVDSAVATLPSVNIQGYLLAKNA 611

Query: 757  PRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGT 815
                      +S++  A   V  D ++   L  A ++ +    + +++ LDG LI  +G 
Sbjct: 612  MEY-------ESQYERAINYVCGDAIICDTLDLAKKLKWDHGFKNKLIALDGSLIHRAGL 664

Query: 816  MSGGGNHVSKGLMMLQRKGQNYFD--DYNP------EDVEQIEKDLS----------DKE 857
            M+GG          + + G N +D  +Y        + ++QIE   +          + E
Sbjct: 665  MTGG----------ISKDGNNRWDKEEYQSLMTLKDKILQQIEDTAAYGRSASIQARELE 714

Query: 858  KNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDT-YSAEIKSKERQLQEKTNID 916
             N  L N     +  +L ++N    E ++EI+  I  +D  YS  I S +++ +      
Sbjct: 715  SNISLLNAEIASIRTQLTQINRSIEENKVEINHQIHLVDKEYSPMILSLKKKKESILKQS 774

Query: 917  NSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKV 976
            N   ++ + ++V I           A  DK     +   S   ++M+        QN+K 
Sbjct: 775  NELTEEKDRVQVVI---------FKAFTDKVGFSVRDYESHSGEVMR--------QNAKE 817

Query: 977  TSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKIS 1036
               +Q+ +ILT + K     ++     LE  +  LL ++ DI     ++  + E+  K  
Sbjct: 818  LQQLQK-EILTVENKLQFERER-----LESTRGRLLKAEEDIKKAQLELSLLEEQEKKYH 871

Query: 1037 SSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGL-- 1094
            + +  +++ I  F+                   +EE   E +  ++E+NNK E LN +  
Sbjct: 872  TQIKPLEEDICSFEKQ-----------------IEEKETEIEGKKLEINNKEESLNEVQS 914

Query: 1095 -LNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTN 1153
             +  +K Q   +   +  L L ++                  G L + +I ++    L+ 
Sbjct: 915  SVEAVKRQHDEISTDIENLDLERI------------------GILRNCKISNRDLPILSE 956

Query: 1154 TAVQDDDSMDIDNGAEV-ISNGLPILSDDELSALDITLVETEVSDLEK----YIESTDAN 1208
            T + D      + G  + +SN + I    +   L     E+    LEK     IE  +  
Sbjct: 957  TNLADVPITSNEQGDAIKMSNEIDI----DYEELPTKYKESSSKQLEKELTRSIEEVNEM 1012

Query: 1209 IEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE---------LKKTRYEEFMHGFG 1259
            +E+L+   + +  F   +   N A+D  ET R + EE          KK R E F   F 
Sbjct: 1013 LEILQPNARAVGRFDEAQERFN-AIDN-ETERLKSEERKIYAQFLKTKKKRKELFDRAFD 1070

Query: 1260 IISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL 1310
             +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++  L
Sbjct: 1071 YVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATPPLKRFKDMEYL 1130

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVIS 1369
            SGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI K    + QFIVIS
Sbjct: 1131 SGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKHGNPSLQFIVIS 1190

Query: 1370 LRNNMFELAQQLVGIYK 1386
            L+N+MFE +  LVG+Y+
Sbjct: 1191 LKNSMFEKSDALVGVYR 1207

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  230 bits (586), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 337/1318 (25%), Positives = 598/1318 (45%), Gaps = 188/1318 (14%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L + NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7    LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 214  HKSEKFPDLTSC------SVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
            ++  +  +  S       S  V   Y   +  G       + ++  +R       S Y +
Sbjct: 67   YRG-RMEEGGSAHENNPKSAYVTAFYVKQDASG------AERRMEFTRVIHNTGDSTYKL 119

Query: 268  NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
            +GK   Y +   +L+ E I +  + FL+ QG+VE IA        +S   L +  E + G
Sbjct: 120  DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTKLFEQVSG 172

Query: 328  TSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKN-SLESGKNLAL------EFLEKE 380
            + +Y++       E E L       ++ +E    E N SL++ + + +      E ++KE
Sbjct: 173  SVQYQR-------EYERL-------KDDYEKASAEYNESLKARRKMQIDLKSFKEGVQKE 218

Query: 381  KQ---LTLSKSKLLQ-YNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQL 436
            +Q   L   + KL Q + LWQ    L +   K S L       K+K   L+ +++  + +
Sbjct: 219  EQYISLLAERVKLQQQFMLWQ----LFHLQSKRSGLVASLKDSKAKLSQLKRQLSNEEAI 274

Query: 437  LNESQSKI---KVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTI 493
            L +S+S +   ++L    ++ L  K   + +   L+ +L  +   +  T + +   EK I
Sbjct: 275  LGKSKSLVAKEELLLARRRETLLQK---QQDKARLNAQLLPVGSARQGTTRRMVNIEKRI 331

Query: 494  SSLTSEIQELEKSQKEYSDELETLNQ---QLQSERESLEAMKLKLKEK------------ 538
             SL  +I+  E   K+  ++L+ + +     ++E E   + K  L E+            
Sbjct: 332  DSLQRDIERQESYVKQLKNQLKVVGKTKASFEAELEKSASGKFTLSEEQKKEYEELKEVY 391

Query: 539  -TSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQ-EGQVKLKNDIKVLSQEVS 596
             +SG SE     E  L     K +E   EI + E +I + +   +  LK DI+ L  EVS
Sbjct: 392  LSSGGSE----FEEKLAILQNKKEELSEEIAVFEKRIGISKTRAEHDLKVDIERLEVEVS 447

Query: 597  NQTA-LKIK---REEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMKNVLNMQRQRA 651
             +T  L  K     E +   K+ QS I +  +N E E +   R  L ++ ++   QR+  
Sbjct: 448  ERTGNLNDKNAIHSEKVREWKQIQSEI-ESANNKEYELSYKLREVLAKLDDLSANQRETN 506

Query: 652  SEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDN-TYDVAVSTACPR-LD 709
             E +L       R  V T L +L       G  G + DL       Y V VST   +  D
Sbjct: 507  KERKL-------RENVAT-LRRL-----FPGVRGLVHDLCRPKKEKYAVGVSTILGKNFD 553

Query: 710  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPK-DS 768
             ++V+++   QQCI YL+K++ G A FI LD + + ++ T+    N   +  L   + +S
Sbjct: 554  SVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDT-SSPTLPAGDNTGCILTLDAIEYES 612

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGL 827
                A   V  D+++   L  A  + + +  + ++VTL+G LI  +G M+GG   ++K  
Sbjct: 613  SLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLMTGG---ITK-- 667

Query: 828  MMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELE 887
                       ++ N  D E+ +  L  K+K     +    E+   ++  + +  + E E
Sbjct: 668  -----------NNTNRWDKEEYQSLLLLKDK----ISTELSELTTGIRTGSIKSRDYENE 712

Query: 888  ISKIIMEIDTYSAEIKSKERQLQEK-TNIDNSELQDNEELKVAIENLQKLKEE-HLALQD 945
            +S +  EI +  +++    R ++E  T ++  +    +E    +++L K+ EE    + D
Sbjct: 713  VSLLSTEISSLRSQLNQLNRSMKEALTELNYHDDLIEKEYSPKVDSLHKMVEEVDGQMAD 772

Query: 946  KTKAKKKKIASL-KEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTEL 1004
              K K    AS+ K+   KIG                  DI   +Q      +K S  EL
Sbjct: 773  IAKDKANLQASVYKDFSKKIG-----------------FDIGEYEQHTGGRLRKHS-REL 814

Query: 1005 EKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELK 1064
            ++ +K ++  +N +   T+ ++   +R  K    L  +              + E D L 
Sbjct: 815  QQLQKEVMNIENKLEFETERLESTIKRQQKAREDLKKV--------------QGELDSLT 860

Query: 1065 DKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMAL 1124
             +  D++ N+ +  +   E    LE+    L    N IK +ED     T+  +H  +   
Sbjct: 861  SQETDIQSNLEQVTNQIAEETKVLEEAQEKLKKKGNNIKIIED-----TINDLHDSIQTC 915

Query: 1125 DEESEAKAPNNGTLSDEQIHDQTGHELTN-------TAVQDDDSMDIDNGAEVISNGLPI 1177
              E      +   +  E+++     ++TN       +A++D     ID  AE I  G  I
Sbjct: 916  KREITEWKEDIEKVGIERVNILKNCKMTNIELPLDSSALEDLAIERID--AETIEAGNNI 973

Query: 1178 LSD-DELSALDITLVETEVSD-LEKYIESTDANIEVLE---EYVKRLTEFKTRKLDLNDA 1232
              D   LSA         + D  E  I++ D  +  L+   + V+R  E + +   ++  
Sbjct: 974  SVDYSRLSARYKESSSHHIRDEFESSIKAIDNTLTELQPNSKAVERFDEARDQFNAVSGE 1033

Query: 1233 VDK-RETVRKQLE---ELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAE 1279
             DK +E+ RK  E   ++K+ R   F+  F  +   +  +Y+ +T          GG+A 
Sbjct: 1034 SDKLKESERKAKELYLKIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSAS 1093

Query: 1280 LELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1339
            L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE
Sbjct: 1094 LTLEDEDEPYLGGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDE 1153

Query: 1340 IDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            +DAALD  NV  +A YI+   +   QFIVISL++N+F  ++ + G+++ ++   S  I
Sbjct: 1154 VDAALDVTNVERIAAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  228 bits (581), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 328/1319 (24%), Positives = 601/1319 (45%), Gaps = 189/1319 (14%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L LNNFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7    LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 214  HKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLV-----------ISRKAFKNNS 262
            ++               FL   DE + +  ++     +            + R    +  
Sbjct: 67   YRG--------------FLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGD 112

Query: 263  SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
            S Y IN K  +Y   T  L++E I +  K FL+ QG+VE IA        +S   L +  
Sbjct: 113  STYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIAS-------QSTTDLTKLF 165

Query: 323  EDIIGTSKYKQLIEKDLIEIESLNEICIEK-ENRFEI---VDREKNSLESGKNLALEFLE 378
            E++ G+ +YK+  E+   ++E L++   E  +NR  I   +   K+ +   +    + LE
Sbjct: 166  EEVSGSIQYKKEYEELKEKVEKLSQSTAESIKNRRRINNEIKVYKDGITKDEKYKAQ-LE 224

Query: 379  KEKQLTLSKSKLLQYNLWQNNSKLTNTLQ----KISALNEEYNVEKSKNQTLQNEINRTK 434
            K + L +  S    Y+L +  S+  N L+    K+S L E+   E+   Q  +N I +  
Sbjct: 225  KRRNLLVYSSLWQLYHLDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQKAKNSIVKDT 284

Query: 435  QLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTIS 494
              + + ++K++    +EK++L S+ I       +    +N T+K +  E+ I   E+ I 
Sbjct: 285  AAITKYKNKLEY-RSKEKEKLASQLI------PIKVSQRNTTKKISNIERRIEGIERDIE 337

Query: 495  SLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLK---------LKEK--TSG-- 541
               S ++  E   K  +   E+   +++   ++ +  +L          L EK  +SG  
Sbjct: 338  RQKSYVERYESQLKVVTKSKESFELEIKESAKNFDKYRLSDEDLVTYDALSEKYLSSGGF 397

Query: 542  -ISEEILIHEHDLEPWNIKVQEKKTEIQLVESQIS--LLQEGQVKLKNDIKVLSQEVSNQ 598
             I  +I +  +D +  + +V   K  I+L +S+I+  L+ +G+ +L+ +I  L+  ++ +
Sbjct: 398  DIDTKISLLNNDKQETSDEVAMFKNRIELAKSKIADDLVLQGE-RLELEISELTSSLNEK 456

Query: 599  TALKIKREEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMKNVLNMQRQRASEARLA 657
             +L  ++  +L  L+ +  S     SN E + N   R  L ++ ++   QR+  +E +L 
Sbjct: 457  NSLHSQKVSELKTLQGEIEST----SNKEYDLNYKLRETLVKLDDLSASQRESTNERKLR 512

Query: 658  LANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDN-TYDVAVSTACPR-LDDIVVET 715
              NV     +L  L+         G  G + DL       Y +AVST   +  D I+ + 
Sbjct: 513  -ENVS----MLRRLFP--------GVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDN 559

Query: 716  VECGQQCIEYLRKNKLGYARFILLDKLRS--------------FNTNTIQTPKNVPRLFD 761
            +   Q+CI YL+K + G A FI L+ + S                 N I+      R   
Sbjct: 560  ISVAQECIAYLKKQRAGVASFIPLESIESEVPTLPFSDGQGCILTINAIEYEPEYERAMQ 619

Query: 762  LIKPKDSKFVPAFYSVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGG 820
             +            S++ DTL +AKDLK  + V              KL+ + G +    
Sbjct: 620  YVCSD---------SIICDTLTIAKDLKWKHNVK------------SKLVTLEGALIHKA 658

Query: 821  NHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNR 880
              ++ G++   R   N +D    + +  ++  L  + +    ++ +F         +  R
Sbjct: 659  GLMTGGIL---RDATNRWDKEEFQSLTVLKDKLLSQIEELSTSSKSF--------AIKGR 707

Query: 881  KPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEH 940
              ++E  IS +  +I +  +E     R L+E    +  E+Q   ++ +  E   KL    
Sbjct: 708  --DLESTISLLNTDITSLRSEFTQLNRALEE----NKVEIQYQTDM-IDKEFGPKLD--- 757

Query: 941  LALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTS--KK 998
             AL DK K   ++I+  + K       +  +Q         R+   T K+ ++ +   ++
Sbjct: 758  -ALNDKIKVYDEEISQFENK-------KEDLQGEIFKEFTNRLG-FTIKEYEEHSGEIRR 808

Query: 999  KSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKD 1058
            K   EL++ ++ +L  +N +    + +    +R +K  S L     S++  +  +  L+ 
Sbjct: 809  KQAKELQQLQRQILNIENKLQFEQERLASTEKRFEKGQSELQKTKISLDSLETEESELQT 868

Query: 1059 ECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGL---LNHIKNQIKT-------LEDS 1108
            + +E+ +   +LE    E    +  +++KL+ ++ +   LN + N ++          D 
Sbjct: 869  QIEEIDN---ELETQRTEIDEMQKALDSKLKDISFIEDSLNEVSNSLEISKREKLGFNDD 925

Query: 1109 LSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGA 1168
            + K+ L K+   +    + S  + P    ++ E         L N  + D+D++ I N  
Sbjct: 926  IEKVDLEKIG--IYKNCKISGIELPITSAITLEN--------LPNDKI-DNDTILISNEI 974

Query: 1169 EVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLD 1228
            EV  + LP    +  +      +E E+ D E+ +     N + +E Y +   +F     +
Sbjct: 975  EVDYDELPAEYKESGNEAVGQKIEKEIKDAEEKLMELQPNSKAVERYDEAKDKFDEIDKE 1034

Query: 1229 LNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAE 1279
                  K   +  Q   +KK R E F   F  ++  +  +Y+ +T          GGNA 
Sbjct: 1035 TEGLKKKERKLLTQFVNIKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNAS 1094

Query: 1280 LELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1339
            L L D  +P++ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE
Sbjct: 1095 LTLEDEDEPYNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDE 1154

Query: 1340 IDAALDFRNVSIVANYIKERTKNA--QFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            IDAALD  NV  +A YI +R  N   QFIVISL+N+MFE ++ LVGIY+ +    S  I
Sbjct: 1155 IDAALDITNVERIATYI-QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRII 1212

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
            (SMC2) - SMC chromosomal ATPase family member [contig
            149] FULL
          Length = 1170

 Score =  169 bits (427), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 310/1314 (23%), Positives = 582/1314 (44%), Gaps = 256/1314 (19%)

Query: 151  INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
            + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3    VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 210  SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
             DLI+K  +   +T  SV + F  + D+++      E+ PK+ ++R+     +SKY ING
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVFANS-DKNNSPIGF-ESYPKISVTRQIVLGGTSKYLING 119

Query: 270  KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
              +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120  HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 330  KYKQLIEK----------DLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEK 379
             ++   EK           L EI SL +         E V+ + N L + K   L+F E 
Sbjct: 173  MFEDRREKAERTMNKKETKLQEIRSLLQ---------EEVEPKLNKLRNEKRAFLDFQET 223

Query: 380  EKQL--------TLSKSKLLQY-----NLWQNN----SKLTNTLQ--KISALNEEYNVEK 420
            +  L            S L+Q      N +QN+    S+LT ++Q  K+   N E +++ 
Sbjct: 224  QSDLENTSKIVNAFVFSSLVQKRKNIENAFQNSESRISELTASVQQTKVELTNLEEDLDT 283

Query: 421  SKNQTLQNEINRTKQLLNESQSKIKVLEGE---EKQQLKSKRILEGEHVSLDEKLKNLTQ 477
             + Q  +NE+ +   L     SK++ LE +   E  +LK+         SL   ++N+ Q
Sbjct: 284  IRTQK-RNEMRKDGAL-----SKLEALETQLINEVSRLKT---------SLSLTIENINQ 328

Query: 478  KKAKTEKIIATTEKTISSLTSEIQE-------LEKSQKEYSDELETLNQQLQSERESLEA 530
            +  K E +    E++I  + + +QE        E    E  D ++ L+QQLQ++ E L  
Sbjct: 329  ENGKRESL----ERSIRGIQTSLQEKSAISKNAENEYNELHDLVQNLSQQLQTKEELLST 384

Query: 531  MKLKLKEK---TSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKND 587
            +   +       SG S ++   +  L    I+VQ  + +I +++ +++  +   V    D
Sbjct: 385  LTTGISSTGATNSGYSAQLSNTKARLNDARIQVQRFEMKINILKKELAANEPKIV----D 440

Query: 588  IKVLSQEVSNQ--------TALKIKREE-----DLV-NLKKQQSSITKEISNGETECNDG 633
             K LS+E   Q        + LK+  E+     DL  +LK+++SS+              
Sbjct: 441  AKSLSEEAKKQVEVTGIQCSDLKMHLEKLGFNPDLFKSLKEEESSL-------------- 486

Query: 634  RSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTI 693
            +SK+  + N +   R++ +    A +   ++    +          + G   +L  L   
Sbjct: 487  KSKIYNLSNDMEGLRRKVANIDFAYSKPSDKFDPTS----------VKGVAAQLFSLNEE 536

Query: 694  DNTYDVAVS-TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTI 750
            + +   A+   A  RL ++VV       Q +E  R  K      I L+K+  R  + +T+
Sbjct: 537  NFSSATALQICAGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTV 594

Query: 751  Q-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVT 804
                   P +V    +LI  +D +   A   +   +L+ +D + A +V +  + R R +T
Sbjct: 595  NFAKQLAPDSVELALNLIGYED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSIT 653

Query: 805  LDGKLIDVSGTMSGGG-NHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELA 863
            L G + D  GT+SGG  N+ S  L+ +Q+        YN        ++LS+ E      
Sbjct: 654  LQGDIYDPEGTLSGGSRNNNSSILIDIQK--------YNA-----YSRNLSESEAKLADV 700

Query: 864  NNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNID----NSE 919
                 +    LQK  N + E+ L   K  +            ER L    ++     N E
Sbjct: 701  TKRIKQYSEVLQKTKNLQNELNLATHKFHL-----------AERNLANNPSVQLMSRNKE 749

Query: 920  LQDN-----EELKVAIENLQKLKEEHLALQ-DKTKAKKKKIASLKEKIMKIGGIELQVQN 973
            +QD      E ++   E+++KL+ E  +++ D  +  K K + L E   +I  I   ++ 
Sbjct: 750  IQDEIQMCLESMRSGSEDIKKLEAEVASVEKDMLEFSKDKGSKLDELKREISHIRKDIEE 809

Query: 974  SKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERID 1033
             K+        +L  K   +++ +     E+E+    +L ++       D+ KE  E   
Sbjct: 810  KKI--------VLEMKDDSNQSLQ----LEMEQLNSDILAAR-------DEFKESVEAAK 850

Query: 1034 KISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNG 1093
            ++    +++++ +EE     +  K E  E K K+               E++++++ L  
Sbjct: 851  ELEQKKHSVEQKLEETANQLQDTKTEFSEQKKKLH--------------EIDDEIKVLTD 896

Query: 1094 LLNHIKNQIKTLEDSLSKLT--LRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHEL 1151
            LL    +Q+++ E  L++L+   RK+     +++E+  A   +   L DE         L
Sbjct: 897  LLRTKSDQLRSDEVELARLSNETRKLKTNTSSVEEQITALLKDEDWLQDEG--------L 948

Query: 1152 TNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALD----------ITLVETEVSDLEKY 1201
             ++ V  +  ++++   +          +++ SAL           I  VE + S L+  
Sbjct: 949  VSSIVTQNQGINLEAYRQRADQ-----LNEKFSALRRKVNPNIMSMIESVEKKESALKTM 1003

Query: 1202 IESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGII 1261
            I + + +   ++E V +L E+K            RET+ K  E++      +F + FG  
Sbjct: 1004 ISTIEKDKRKIQETVAKLNEYK------------RETLIKTWEKVTV----DFGNIFG-- 1045

Query: 1262 SMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLA 1321
             +      +++ + G +           +EG+   +        ++  LSGG+++L +L+
Sbjct: 1046 DLLPNSFAKLVPIEGKS----------VTEGLEVKIRLGSIWKESLVELSGGQRSLIALS 1095

Query: 1322 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1375
            L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+  MF
Sbjct: 1096 LILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  167 bits (424), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 190/752 (25%), Positives = 337/752 (44%), Gaps = 120/752 (15%)

Query: 682  GFHGRLGDLGTIDN-TYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 739
            G  G + DL       Y +AVST   R  D I+V+ +   Q+CI YL+K + G A FI L
Sbjct: 525  GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 740  DKLRSFNTNTIQTPKNVPRLFDLIKPK-DSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR 798
            D +    T+T+   ++   +  +   + D ++  A   V  D+++   L+ A  + + + 
Sbjct: 585  DTI-EVETSTLPASESSGCILAINAIEYDPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 799  -RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKE 857
             R ++VTL+G LI  +G M+GG   +SK             D  N  D E+ +  ++ K+
Sbjct: 644  VRSKLVTLEGTLIHRAGLMTGG---ISK-------------DSSNRWDKEEYQSLMTLKD 687

Query: 858  KNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDN 917
            K          E+ +  +  + R  E+E  IS I  E  +   +I   +R L E TN D 
Sbjct: 688  KILV----QIEEVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRAL-EDTNTD- 741

Query: 918  SELQDNEELKVAIENLQKL-KEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKV 976
                        IE  Q L K+E+            KI  L++K+  I     Q++  K 
Sbjct: 742  ------------IEYHQNLIKQEY----------DPKIQELEQKLAIINDSRKQLEEEKD 779

Query: 977  TSIVQRIDILTAK--------QKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEI 1028
            +   Q     T K        +     +K++   EL++ +K +L  +N +    + +   
Sbjct: 780  SLQTQTFKEFTDKLGFSMKEYETHSGDAKRQQSKELQQLQKQILNVENKLEFEKERLTST 839

Query: 1029 SERIDKISSSLNNIDKSIEEFQAHKETLKDECDE----LKDKVVDLEENINEFKSFEIEV 1084
            S R++K  + +  +   ++  Q  +E +  +  +    +KD  + L++   E K+ +  +
Sbjct: 840  SNRLEKTETDMKKVFIELQSLQKQEEDVGVQTKKVEKAIKDHKIKLKKVEEELKNKQRTM 899

Query: 1085 NNKLEKL---NGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDE 1141
            N   E+L   N  L  +K +   ++D + K  L ++   ++   + S  + P    +SD 
Sbjct: 900  NLNDEQLIEYNSSLQSLKRERDEVKDVIEKGDLERI--CVLKNCKISNMQIP---IVSDV 954

Query: 1142 QIHDQTGHELTNTAVQDDDSMDID----------NGAEVISNGLPILSDDELSALDITLV 1191
             +       +   A++  + ++ID          NG E +  G                 
Sbjct: 955  DLQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEAVEKGF---------------- 998

Query: 1192 ETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRK-------QLE 1244
                   E+ ++  D  + VL+   K    F   +       D+ E ++K       Q  
Sbjct: 999  -------ERELKQVDEILNVLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFI 1051

Query: 1245 ELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1295
            ++K+ R   F   F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +
Sbjct: 1052 KIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRY 1111

Query: 1296 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1355
               PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA Y
Sbjct: 1112 HATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATY 1171

Query: 1356 IKER-TKNAQFIVISLRNNMFELAQQLVGIYK 1386
            I+     + QFIVISL+N MFE +  LVG+Y+
Sbjct: 1172 IRRHGNPDLQFIVISLKNTMFEKSDALVGVYR 1203

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
            (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score =  167 bits (424), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 328/1305 (25%), Positives = 578/1305 (44%), Gaps = 238/1305 (18%)

Query: 151  INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
            + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3    VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 210  SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
             DLI+K  +   +T  SV + F    D  D  +  I  E+ P + ++R+     +SKY I
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVF----DNSDKSNAPIGFESSPTISVTRQVALGGTSKYLI 117

Query: 268  NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
            NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118  NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328  TSKYKQLIEKDLIEIESLNEICIEKENRF---EIVDREKNSLESGKNLALEFLEKEKQLT 384
            T  ++   EK   E     +    +ENR    E ++ +   L S K + LEF E +K L 
Sbjct: 171  TKMFEDRREK--AERTMGKKEAKLQENRTLLNEEIEPKLEKLRSEKRIFLEFQETQKDLE 228

Query: 385  LSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKN--QTLQNEINRTKQLLNESQS 442
                                T + +SA +  Y V+K  +  +TLQ   NR  +L      
Sbjct: 229  -------------------ETHRVVSAFDYNYLVQKQTSVVETLQTSENRIIEL------ 263

Query: 443  KIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL-TQKKAKTEK--IIATTEKTISSLTSE 499
                      ++L +K  +  E  SL+E L+ +  QKK + +K   +A  E   S L +E
Sbjct: 264  ----------KELITK--VTDELGSLNEDLEQIQVQKKNELDKNGKLAKLESNESKLMNE 311

Query: 500  IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
            I  L+ S K   D L     +L+S+ ++LEA K +L  K S + E+I   E + +  NI+
Sbjct: 312  ISRLKTSYKISEDNLSDTLSKLKSKGKNLEANKQELSNK-SKMFEKI---EEEYKGINIQ 367

Query: 560  VQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSI 619
            + E K   +  E  +S L  G           S +++N    K K  E  V++KK    I
Sbjct: 368  LDEYKQTYKKKEELLSTLSTGISSTGGTDGGYSAQLNNA---KTKLNEANVSIKKSNIKI 424

Query: 620  ------------------------TKEISNGETECNDGRSKLKE----MKNVLNM-QRQR 650
                                     K+I   E +C+  + K+KE     + V  + Q++ 
Sbjct: 425  EALQRELASNEPKMESAKKDLEISLKQIKQYEEQCSQIQLKIKEHGYDAETVKELKQKKI 484

Query: 651  ASEARL------------ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYD 698
            A E +L             +AN+       T  ++ Q    + G   RL  L   +N Y 
Sbjct: 485  AIEQQLNKIERENEYLKRKVANIDFTYTKPTGDFQEQS---VKGVAARLFHLN--ENNYS 539

Query: 699  VAVS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-- 751
             A +    A  RL ++VV+  +   Q ++  R  K      I L+K+  R  N  T+   
Sbjct: 540  SATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTIIPLNKIMARKLNDKTLNIA 597

Query: 752  ---TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYG-QRRYRVVTLDG 807
               +P NV    +LI  ++     A   +   +L+ KD + A +V +  Q R R +TL G
Sbjct: 598  KEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAETAKKVTFHPQVRTRSITLQG 656

Query: 808  KLIDVSGTMS-GGGNHVSKGLMMLQRKGQNYFDDYN-PEDVEQIEKDLSDKEKNFELANN 865
             + D  GT+S G  N  S  L+ +Q+  +     Y   E++  I++ L   E+ +E    
Sbjct: 657  DVYDPEGTLSGGSRNMNSSLLVDIQKYNEASKQTYVLQEELSVIQERLVALERVYE---- 712

Query: 866  AFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEE 925
                ++NE   L ++     L +++  ++ ++ +  +K  E   QE   + N+E+  N E
Sbjct: 713  GTRVLQNEYNLLKHK-----LRLAQRNLDSNSSTQVMKRNEEIYQELA-VCNNEITTNNE 766

Query: 926  LKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDI 985
            L +   N  ++K+    +++ +K K  K+  LK ++  +G    Q++N +V         
Sbjct: 767  LVLKFGN--EIKQIERDMKEFSKDKGSKLKELKNELESLGK---QIENQEVI-------- 813

Query: 986  LTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKS 1045
              A+ K D     + +TE  +    +   ++ I   +   K + E ++ IS+ L  I+  
Sbjct: 814  --AESKSDLFQNLQLETE--QLSNEIQADEHYIEQTSVSKKSLEEELETISTQLKEIENE 869

Query: 1046 IEEFQAHKETLKDECDELKDKVVDLEE------NINEFKSFEIEVNNKLEKLNGLLNHIK 1099
            ++  Q       D+  E K +++D++E      NI + KS EI+ N++LE          
Sbjct: 870  LQLVQ-------DQLSEEKKRLLDIDEEAADLANIIKSKS-EIKSNSELE---------- 911

Query: 1100 NQIKTLEDSLSKLT--LRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQ 1157
                     L KLT  L K       ++E+ +  A  N  LSDE              ++
Sbjct: 912  ---------LQKLTHDLTKFKNSTSGINEKIKQLADENEWLSDET--------FVAGIIK 954

Query: 1158 DDDSMDIDNGAEVISNGLPILSD------DELSALDITLVETEVSDLEKYIESTDANIEV 1211
             +  +DI++  E     L   +D        + A+ I  VE + + L+  I++ + +   
Sbjct: 955  QNKGIDIESYRERNEQLLGRFNDMKRKVNPNIMAM-IENVEKKETALKTMIKTIERDKVK 1013

Query: 1212 LEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQM 1271
            ++E +++L E+K            R+T+ K   ++     E+F + F             
Sbjct: 1014 IQETIEKLNEYK------------RDTLIKTWTKVN----EDFGNIFA------------ 1045

Query: 1272 ITMGGNAELELVDSLDP-FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1330
              +  N+  +LV S     +EG+   V        ++  LSGG+++L +L+L+ AL +++
Sbjct: 1046 -DLLPNSFAKLVPSEGKDVTEGLEVKVKLGSIWKESLVELSGGQRSLIALSLIMALLQFR 1104

Query: 1331 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1375
            P P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+  MF
Sbjct: 1105 PAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score =  146 bits (369), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 306/1358 (22%), Positives = 582/1358 (42%), Gaps = 264/1358 (19%)

Query: 149  LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
            ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 209  LSDLIHK-SEKFPDLTSCSVDVEFLYAIDEHDGDTKI-----SETKPKL---VISRKAFK 259
               LIH+ +     + SCSV++ F      HD D ++     +   P+    V  R+   
Sbjct: 61   RQGLIHQGTSGGSSVMSCSVEIVF------HDPDNRMILASNASIVPRPNNEVFIRRTVG 114

Query: 260  NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLL 319
                 Y IN +    +D+ ++L+  G  + +   ++ QG++  +   K K         L
Sbjct: 115  LKKDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------L 167

Query: 320  EYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKN-LALEFLE 378
            + LED++G   ++  +   L +I+       E E +   +D+E + L++  N +  E LE
Sbjct: 168  QLLEDVVGAKSFEIKLNDSLKKIK-------ETEFKKSTIDKELSELKNKLNEMEWEKLE 220

Query: 379  KEKQLTLSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNV----------EKSKNQTLQ 427
             EK     K+ K+LQ+ L+  + +L + + +I +L+++YN           E  K +T+ 
Sbjct: 221  LEKFNKFDKNRKVLQFTLY--DRELNDLINQIESLDDDYNSILQSSESYIQELDKRETMV 278

Query: 428  NEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLK-------------- 473
            N++      LN   + +K+    + QQ KS  + E  + S D  LK              
Sbjct: 279  NDVTMN---LNTIGNHLKIKINNDLQQAKSN-LAEVLNKSADINLKINDLQNQLSLNTEQ 334

Query: 474  --NLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQ---LQSERESL 528
              +L     K +  I+  ++ ++ +     EL   + ++  +LE L Q+   L  +R S 
Sbjct: 335  STSLMDNLGKIKNRISERQEKLNKILPRFNELTNQELKFKFDLEQLKQKQRDLLLKRSSY 394

Query: 529  EAMKLKLKEKTSGISEEIL--------IHEHDLEPWNIKVQEKKTEIQLVESQISLLQEG 580
            E  + K +E+ + I+ EI         +  H L   +I+    K  +  ++ +I+ L E 
Sbjct: 395  ERFESK-QERDNWINSEIKEQESNLNDLQNHSLNNLSIEYANIKASLNDMDVEINSLNES 453

Query: 581  QV--KLKNDIKVLSQEVSNQTAL---KIKREEDLVNLKKQQSSITKEISNGETECNDGRS 635
                ++ ++++ L+ + + +  L   KI + ++L   +++  +I   +SN          
Sbjct: 454  IAGNEITSNMEGLTTQYNERKRLYSEKIDQRKELWRREQKLQAILDTVSND--------- 504

Query: 636  KLKEMKNVLN--MQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTI 693
             LK+ +  LN  M R  +      +A++    K +T   KL          G +G+L   
Sbjct: 505  -LKQSERNLNETMDRNLSH----GIASI----KEITQKLKLPPDS----VFGTVGELIKA 551

Query: 694  DNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQT 752
               Y   V      +L  I+V+T E     ++ L + K G   FI L+K+  +N   I  
Sbjct: 552  SEKYKNCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI--YNDPNITY 609

Query: 753  P--KNVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGK 808
            P          LIK    +SKF  A   +   T+V KDL    ++A  + +   +TLDG 
Sbjct: 610  PPADQYSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKFKLNAITLDGD 668

Query: 809  LIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFY 868
              D  G ++ GG                YFD +    +E + K+LSD       A ++  
Sbjct: 669  RADKRGVLT-GG----------------YFDYHKRTRLESL-KNLSD-------ARDSHA 703

Query: 869  EMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKV 928
            +   +L+ +      I+ EI K+  E+ T S          Q +T + N E Q     +V
Sbjct: 704  QTTADLETVKRELAIIDSEIDKLNGELRTISN---------QRETILTNVEHQ-----RV 749

Query: 929  AIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTA 988
             + N    K E   L++          SL+  ++K   +E  +   +   I  + D+ T 
Sbjct: 750  KLNNK---KSEKYVLEE----------SLQSVVLKREKVETNISIIREKVISYQHDLETD 796

Query: 989  KQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLN-------- 1040
             +    + +K+    LE    ++    ND+T+ ++ ++ I+  I+ +++ LN        
Sbjct: 797  FESALSSEQKQL---LETISASISKISNDLTVTSEALESITTTINTLNAELNSKLIPQQQ 853

Query: 1041 NIDKSIEE----------------FQAHKETLKDECDELKDKVVDLEENINEFKSFEIEV 1084
            +I+  I E                 ++ +E L  E +E K+ +  ++  I+     +   
Sbjct: 854  DIESKISEIGGGSIAQDLVEELRSLESQRERLDSEQEEAKNDIYTIQNEIDGLNGEKTNN 913

Query: 1085 NNKLEKLNG----LLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD 1140
               LEK N     LL  I+N  K++E +L K T       L +  +E + K    G L++
Sbjct: 914  EKILEKANSQQRLLLKKIENYQKSVEKTLIKKT------TLASRRDELQQKIREIGLLAE 967

Query: 1141 EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK 1200
            + ++D                           N L   S+D L  L+        S++ K
Sbjct: 968  DALND--------------------------FNSLS--SEDLLEKLN-----EANSEISK 994

Query: 1201 YIESTDANIEVLEEYVKRLTEF--KTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGF 1258
             +       E    + ++ TE   ++R+L+L+     + ++++ +E+LK+ +       F
Sbjct: 995  LVNVNKRAFENFRRFGEKQTELVERSRELELS-----KISIQELIEKLKEQKINAVDKTF 1049

Query: 1259 GIISMTLKEMYQMITMGGNAELEL----------------VDSLD----PFSEGVTFSVM 1298
              +S    ++++ +   G  +L +                 + +D    P   GV+ SV 
Sbjct: 1050 RKVSENFVKVFETLVPRGTGKLVIHRTNQENSATPDLEDETNDMDIDAQPMYTGVSISVS 1109

Query: 1299 PPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
               K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN +
Sbjct: 1110 FNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANTL 1169

Query: 1357 KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394
            KE +KNAQFI  + R +M ++A +   + K EN+  S 
Sbjct: 1170 KELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 244/999 (24%), Positives = 445/999 (44%), Gaps = 172/999 (17%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            + L NFKSY G+  +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7    IELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLI 66

Query: 214  HKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNN------------ 261
            ++       T    D +  Y+ + HD +   S    K   S    +N+            
Sbjct: 67   YRG------TLQDGDADSGYS-ETHDNENNPSSAYVKAFYSPSGQENDVAELTRTITLSQ 119

Query: 262  SSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 321
             S Y +NG+  ++      L+ E I +  + FL+ QG+VE +A  KP+        L   
Sbjct: 120  ESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTL 172

Query: 322  LEDIIGTSKYKQLIEKDLIEIE---SLNEICIEKENRFEIVDREKNSLESGKNLALEF-- 376
             E + G+ +YKQ  ++   E+E   S     I+   R  I  +   S + G N   E+  
Sbjct: 173  FEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLK---SFKEGVNKDEEYRK 229

Query: 377  -LEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQ 435
             LE+  +L        Q  +WQ    L +   K  +L E     + + Q+L +E+N  +Q
Sbjct: 230  HLEERNKLQ------QQLIVWQ----LFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQ 279

Query: 436  LLNE---SQSKIKVLEGEEKQQL--KSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTE 490
            ++ +   S +K + L  +++ +L  K+K++   +H  L   L  +   K   +K ++   
Sbjct: 280  IVAKKKLSYAKKQTLAAKQRTRLSDKTKKV---DH--LTSSLLPIKSSKESIDKRLSAAV 334

Query: 491  KTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHE 550
              I SL  +I   E   K+Y  +L+ +N+     + + +A ++    K+SG        +
Sbjct: 335  TKIESLQRDIDRQESLVKQYEHQLKVVNKA----KTNFQA-EIDESAKSSG--------D 381

Query: 551  HDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTAL--------K 602
              L   N+K  E   E   + S  S L++  +  KN+    SQE+S++  L        +
Sbjct: 382  FKLNEANLKRYEDLKET-FLSSGGSELEDKLLLEKNE----SQEISDEIELYSRQLDASR 436

Query: 603  IKREEDLV----NLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLAL 658
            +K  E+L      L+ + S +TKE+S   ++ +    KLKE+++       R  E    L
Sbjct: 437  LKVNEELGAEKEALENEVSELTKELSGKTSQVSAAVKKLKELQSRAEYNNNREYEVSFKL 496

Query: 659  ANVQNRGKVLTAL-------YKLQKSGRIV-----GFHGRLGDLGTIDN-TYDVAVSTAC 705
                 +   + A         KL+++  I+     G  G + +L       Y VAVST  
Sbjct: 497  KETLTKLDDMNATQRETAKERKLRENVSILRRLFPGVRGLVHELCRPKKEKYTVAVSTIL 556

Query: 706  PR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQT----PKNVPRLF 760
             +  D ++V+     QQC+ +L+K + G   FI LD   + + N +       K      
Sbjct: 557  GKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLD---TIDVNKVSMMALDTKGCTLAI 613

Query: 761  DLIK-----PKDSKFVPAFYSVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSG 814
            D I       +  ++V +  S++ D+L +AKDLK    V     R ++V+LDG ++  +G
Sbjct: 614  DAIDYERDLERAMQYVCS-DSIICDSLAIAKDLKWRRNV-----RAKLVSLDGSIVHKAG 667

Query: 815  TMSGG-----GNHVSK----GLMMLQRK--GQ-NYFDDYNPEDVEQIEKDLSDKEKNFEL 862
             M+GG     GN   K    GLM L+    G+ +     N  D E+I       E     
Sbjct: 668  LMTGGTTKSSGNRWDKEEYQGLMSLKDTLLGEISELSSANTIDSERIR----STENELSF 723

Query: 863  ANNAFYEMENEL----QKLNNRKPEIELEISKIIMEI--------DTYSAEIKSKERQLQ 910
             N+    +  +L    + LN ++ EI+ +   I  E         +  +A  K+  R  +
Sbjct: 724  LNSDVMSLRTQLNQVKRSLNEKETEIQYQQELIKGEFEPKIQSLKEAMTAHAKTTARFEE 783

Query: 911  EKTNIDNSELQDNE-ELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIEL 969
            EK  + +S   D E ++   +   +K   E +         ++++  L++  M+I GIE 
Sbjct: 784  EKDRLLDSVYADFEGDIGFKVSQYEKHSGEMM---------RRQLEDLRKLQMQIAGIE- 833

Query: 970  QVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEIS 1029
                       ++++  T + +  +  +++   ++EKAK  L    +D   ITD+I+ + 
Sbjct: 834  -----------KKLEFETERLQSTQERQQRVQVDIEKAKIKLEALNSDEQRITDEIQGVE 882

Query: 1030 ERIDKISSSLNN----IDKSIEEFQAHKETLKDECDELK 1064
              I++  + L+N    I+K + E  + +ET+++  + L+
Sbjct: 883  LTINEEQTRLDNLQNEINKDLVELNSSEETIQEATEHLQ 921

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  127 bits (320), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 188/728 (25%), Positives = 327/728 (44%), Gaps = 101/728 (13%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           I +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGD-TKISET-KPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV V F    D  D D + I  T  PK+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVF----DNSDRDNSPIGFTNSPKISVTRQVVLGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328 TSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSK 387
           T  ++   EK             +KE + +         E+   LA E   K ++L   K
Sbjct: 171 TKMFEDRREK-------AERTMAKKETKLQ---------ENRALLAEEIEPKLEKLRSEK 214

Query: 388 SKLLQYNLWQNNSKLTNTLQKISALNEEYNV---EKSKNQTLQ---NEINRTKQLLNESQ 441
              L +   Q +  L  T + +SA N  YN+   + S  QTLQ   ++ N  K+ + +  
Sbjct: 215 RIFLDFQTTQTD--LERTSRVVSAFN-YYNMKHRQSSFEQTLQDSEDKCNHLKEEIEKVS 271

Query: 442 SKIKVL-EGEEKQQLKSKRIL--EGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTS 498
            +IK L E  E+ +L+ K  +  EG  V+ +++  +L ++ ++ +  ++    +I     
Sbjct: 272 EEIKSLNEDLEELKLQKKNEMDNEGRLVNFEKEESDLLKQISRIKTTLSIKNDSIDEAEK 331

Query: 499 EIQELEKSQKEYSDELET-LNQQLQSERE---------SLEAMKLKLKEKTSGISEEILI 548
           E+Q+L  + +E + ELE  L Q   +E+E          L+ ++ K  E  S +S  I  
Sbjct: 332 ELQKLNSNNEELTKELEMKLAQYTSTEKEYEIANSELTRLKELQGKKSELLSTLSTGISS 391

Query: 549 HEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKR--- 605
           +    + ++          QLV ++  L         ND +VL ++++ + ++  K    
Sbjct: 392 NGATDDGYS---------AQLVATKKKL---------NDTEVLIKKLNMKRSMLQKELAS 433

Query: 606 -EEDLVNLKKQQSSITKEISNGETECNDGRSKLKEM---KNVLNMQRQRASEARLALANV 661
            E  L   K++    +K +   E  C + RS+L       ++L   R+  SE +  L   
Sbjct: 434 NEPKLFQAKREHEKSSKIMEQNEKYCGELRSQLASFGYDPDLLKFLRKEESEVQQQLYRA 493

Query: 662 QNRGKVL---TALYKLQKSGRIVGF-----HGRLGDLGTID-NTYDVAVS---TACPRLD 709
               + L    A  +   +     F      G    L T+D   +D A++    A  RL 
Sbjct: 494 NEEAEALKRRVANIEFNYTRPSANFDPKSVKGVAAQLFTVDQQQFDNAIALQVCAGGRLY 553

Query: 710 DIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVPRLFDL 762
           +I+V+      Q +E  R  K      I L K+  R+ N NT+       P  V    +L
Sbjct: 554 NIIVDNEITASQLLERGRLKK--RVTIIPLSKIATRTLNKNTLALAKELAPGKVELALNL 611

Query: 763 IKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGN 821
           I   D +   A   +  + LV KD   A +V +    R R +T  G + D  GT+SGG  
Sbjct: 612 I-GYDDEVSKAMEFIFGNGLVCKDADTAKKVTFHPNIRTRSITQQGDVYDPEGTLSGGSR 670

Query: 822 HVSKGLMM 829
           + ++ L++
Sbjct: 671 NTTRSLLV 678

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score =  127 bits (320), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 298/1381 (21%), Positives = 571/1381 (41%), Gaps = 295/1381 (21%)

Query: 149  LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
            ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209  LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISR--------KAFKN 260
               LIH+      + S SV++ F      HD D   S   P  V+SR        +    
Sbjct: 61   RQGLIHQGSG-GSVMSASVEIVF------HDPDH--SMILPSGVLSRGDDEVTIRRTVGL 111

Query: 261  NSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 320
                Y +N +     D+ ++L+  G  +++   ++ QG++  +   K K         L+
Sbjct: 112  KKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQ 164

Query: 321  YLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESG-KNLALEFLEK 379
             LED++G   ++  ++  L ++E   +  I+       +++E   L S    +  E  E 
Sbjct: 165  LLEDVVGAKSFEVKLKASLKKMEETEQKKIQ-------INKEMGELNSKLSEMEQERKEL 217

Query: 380  EKQLTLSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLN 438
            EK   L ++ K+ Q+ L+  + +L   + ++  L+ +YN     ++    E+++ + +++
Sbjct: 218  EKYNELERNRKIYQFTLY--DRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMID 275

Query: 439  ESQSKIKVLEGEEK----QQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTE--KT 492
            +   K+  +E   K      L+  ++ E E   + +KL N+  K    ++ I + E  + 
Sbjct: 276  QVSKKLSSIEASLKIKNATDLQQAKLRESE---ISQKLTNVNVKIKDVQQQIESNEEQRN 332

Query: 493  ISSLT-SEIQELEKSQKEYSDELETLNQQLQSERESLEAM-KLKLKEKTSGISEEILIHE 550
            + S T  EI+ + + +K+   ++    Q+L  E    EAM KL+L               
Sbjct: 333  LDSATLKEIKSIIEQRKQKLSKILPRYQELTKE----EAMYKLQLA-------------- 374

Query: 551  HDLEPWNIKVQEKKTEIQLVESQISLLQ---EGQVKLKNDIKVLSQEVSNQTALKIKREE 607
                     +Q+K+ ++ L + + +  +   E    + ++I+ L   + N   L+ + + 
Sbjct: 375  --------SLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNELESQLQM 426

Query: 608  DLVNLKKQQSSITKEISNGETECN--DGRSKLKEMKNVLNMQRQRASEA----------- 654
            D  +L+KQ S+I +EI       N  D + +L++  + L   +Q+ SE+           
Sbjct: 427  DRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTRKELWRKE 486

Query: 655  -------RLALANV-QNRGKVLTALYKLQKSGRI-------------VGFHGRLGDLGTI 693
                      L++V QN+  V   + +   +G I                 G LG+L  +
Sbjct: 487  QKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKV 546

Query: 694  DNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR-----SFNT 747
            ++ Y           L  IVV+T E     +  L + K G   FI L++L       F +
Sbjct: 547  NDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPS 606

Query: 748  NTIQTPKNVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTL 805
            NT    +  P    LIK    + +F  A   V   T+V KDL Q  ++A  + +   +TL
Sbjct: 607  NTTTQIQFTP----LIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITL 661

Query: 806  DGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKE-------K 858
            DG   D  G ++GG                 Y D +    +E + K+L++         +
Sbjct: 662  DGDRADKRGVLTGG-----------------YLDQHKRTRLESL-KNLNESRSQHKKILE 703

Query: 859  NFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNS 918
              +   N   +++ ++ ++N    ++  +   ++  I+ Y   + +K+          N 
Sbjct: 704  ELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTNIEVYRTSLNTKK----------NE 753

Query: 919  ELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTS 978
            +L   E L   I  L+KL       Q+K                          N+    
Sbjct: 754  KLILEESLNAIILKLEKLNTNRTFAQEKL-------------------------NTFEND 788

Query: 979  IVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSS 1038
            ++Q  D   +K++K+R         LE   K +  + N + + +D ++ I+  ID +++ 
Sbjct: 789  LLQEFDSELSKEEKER---------LESLTKEISAAHNKLNITSDALEGITTTIDSLNAE 839

Query: 1039 LNN-----------------------IDKSIEEFQAHKETLKDECDELKDKVVDLEENIN 1075
            L +                       +   ++E Q  KE+++ + +   + V++L     
Sbjct: 840  LESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHE---NAVLELGTVQR 896

Query: 1076 EFKSFEI-EVNNK--LEKLNG----LLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES 1128
            E +S    E NNK  LEK N     LL  + N  K++E ++ K T       L+   EE 
Sbjct: 897  EIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKT------TLVTRREEL 950

Query: 1129 EAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDI 1188
            + +    G L ++             A+ +D S               I SD  L  L+ 
Sbjct: 951  QQRIREIGLLPED-------------ALVNDFS--------------DITSDQLLQRLND 983

Query: 1189 TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK 1248
              + TE+S L+   +    N +   E  K L E +  +LD     + +++++  + +LK+
Sbjct: 984  --MNTEISGLKNVNKRAFENFKKFNERRKDLAE-RASELD-----ESKDSIQDLIVKLKQ 1035

Query: 1249 TRYEEFMHGFGIISMTLKEMYQMITMGGNAEL-------------ELVD-SLDPFSE--- 1291
             +       F  +S   + +++ +   G A+L             E +D  +D  S    
Sbjct: 1036 QKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQ 1095

Query: 1292 ----------GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1339
                      GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DE
Sbjct: 1096 NGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDE 1155

Query: 1340 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNR 1399
            IDAALD +  + VA  +KE +KNAQFI  + R +M ++A +   + K EN+  +    NR
Sbjct: 1156 IDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNR 1214

Query: 1400 E 1400
            E
Sbjct: 1215 E 1215

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score =  126 bits (316), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 261/1065 (24%), Positives = 468/1065 (43%), Gaps = 182/1065 (17%)

Query: 151  INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
            + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3    VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 210  SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKISET-KPKLVISRKAFKNNSSKYYI 267
             DLI+K  +   +T  SV + F    D  D  ++ I  T  P++ ++R+     +SKY I
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 268  NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
            NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118  NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328  TSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLE-KEKQLTLS 386
            T  ++   EK    + S  E  ++ ENR  + +  +  LE  +N    FLE +  Q  L 
Sbjct: 171  TKMFEDRREKAERTM-SKKETKLQ-ENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 387  KSKLL-----QYNLWQNNSKLTNTL------------------QKISALNE---EYNVEK 420
            K++ +      YN+   ++ +  TL                  Q+I +LNE   E  ++K
Sbjct: 229  KTERIVASCDYYNIKHKHTSIRETLENGEAHMKELNEFIEKTAQEIESLNEDVKEIKLQK 288

Query: 421  SK--------------NQTLQNEINRTKQLL-------NESQSKIKVLEGE---EKQQLK 456
             K                TL NEI+R K  L       N++  K+K LE E      +L 
Sbjct: 289  QKELHKDSEISKLETQESTLLNEISRLKTSLSIKAESVNDTTEKLKALELEIANSSARLN 348

Query: 457  SKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELET 516
             K+I   E+   +E  K + ++ +K  ++    E+ +S+LT+ I     +   Y      
Sbjct: 349  EKKI---EYTKTEEDYKTVQEELSKQRELYKKKEELVSTLTTGISSTGAADGGY------ 399

Query: 517  LNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISL 576
             N QL   +  L  + L +K+ T                  +K+   K E+ ++E +++ 
Sbjct: 400  -NAQLIKAKAGLSDVSLAIKKST------------------MKMDLLKRELSVIEPKLT- 439

Query: 577  LQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSK 636
                Q    N++ +            +K  +D  N  K Q+ +T E     +   D + K
Sbjct: 440  ----QATKDNELNIKH----------VKECQD--NCNKLQAQLT-EYGFDPSRIKDLKQK 482

Query: 637  LKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNT 696
              E+K   +   Q ++++      V N     T  Y   K+  + G  G+L +L      
Sbjct: 483  ENELK---SQYYQISNDSEYLKRRVANLEFNYTTPYPDFKANLVYGVVGQLFELDDDKIR 539

Query: 697  YDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-- 751
            Y  A+ T A  RL ++VV+  +   Q +E  R  K      I L+K+  R  +   ++  
Sbjct: 540  YSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPLNKISTRPISPQVLELA 597

Query: 752  ---TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDG 807
                P  V    +LIK  D     A   +  ++L+ +D + A ++ +  + R R +TL G
Sbjct: 598  KKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQG 656

Query: 808  KLIDVSGTMSGGGNHVSKGLMM-------LQRKGQNYFDDYNPEDVEQIEKDLSDKEKNF 860
             + D  GT+SGG  + S  L++       +QRK +    D N    E+++K  +  +K  
Sbjct: 657  DVYDPEGTLSGGSRNTSDSLLVDIQKYNQIQRKIEIIQADLN-HVTEELQKQYTTSQKTK 715

Query: 861  ELANNAFYEMENELQKLNNRKPEIELEISKIIM--------EIDTYSAEIKSK----ERQ 908
             + N+    +   L KL+  K  +E+  S  IM        EI     EIK +    ER 
Sbjct: 716  TIQND----LNASLHKLDLAKRNLEVNPSSQIMARNEEILREIGECENEIKIRQMDLERC 771

Query: 909  LQEKTNI-------DNSELQDNEELKVAIENLQKLKEEHLA-----------LQDKTKAK 950
             QE ++I       DN +     ELK  +++L K  EE  +           L+ +T+  
Sbjct: 772  RQEVSSIEKDMKEYDNDKGSKLNELKNELKSLAKNLEEQESESEGKYDLFQNLELETEQL 831

Query: 951  KKKIASLKEKIMK-IGGIE-LQVQNS----KVTSIVQRIDILTAKQKKDRTSKKKSDTEL 1004
              ++ S K  +   +  IE L+ +N+    K+ SI   +  + AK  +++      D EL
Sbjct: 832  SSELDSNKTLLQNYLKSIESLKSENTELEEKIRSIEDNLATIQAKLNEEKKRLMDIDDEL 891

Query: 1005 EKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELK 1064
             + +  +   +        +++++   ++K  S+ +NI+K IEE +   E L+D   +L 
Sbjct: 892  TELETLMKKKQEKKKSSELELQKLIHDLNKYKSNTDNIEKKIEELRQKHEFLED--FDLV 949

Query: 1065 DKVVDLEENIN--EFKSFEIEVNNKLEKLNGLLN-HIKNQIKTLE 1106
              +V   E IN   ++    ++N+K ++L   +N +I N I+ +E
Sbjct: 950  TSIVKQNEGINLETYRERSKQLNDKFQELRKKVNPNIMNMIENVE 994

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  122 bits (306), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 180/727 (24%), Positives = 335/727 (46%), Gaps = 99/727 (13%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            DLI+K  +   +T  SV + F    D+ +     + + P++ ++R+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF-DNTDKSNSPIGFANS-PQISVTRQVVLGGTSKYLING 119

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 330 KY---KQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKN---LALEF------L 377
            +   K+  E+ + + E+  +     ENR  + +  +  LE  +N   + LEF      L
Sbjct: 173 MFEDRKEKAERTMSKKETKLQ-----ENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDL 227

Query: 378 EKEKQLTLSKSKLLQYNLWQNNSKLTNTL------------------QKISALNEEYNVE 419
           EK +++ +S      YNL   ++ +  TL                  Q+I++LNE+  VE
Sbjct: 228 EKTERIVVSYD---YYNLKHKHTSIRETLENGEAHMKNLNEFIEKTIQEINSLNED--VE 282

Query: 420 KSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKK 479
           + K+Q  + E+N+        + KI  LE +E   L     L+    SL  K++NL    
Sbjct: 283 EIKHQK-EKELNK--------EGKISKLEKKENSLLNEISRLK---TSLSIKVENLNDTN 330

Query: 480 AKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKT 539
            K + + A    + + L  +     K++K+Y    + + QQL  +R+  +  +  +   T
Sbjct: 331 EKLKSVEADITTSSTKLNDKKIAYTKTEKDY----KIVQQQLSEKRDLYKRKEELVSTLT 386

Query: 540 SGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQI-------SLLQEGQVKLKNDIKVLS 592
           +GIS            +N ++ + KTE+  +   I        LL++  + ++  +K  +
Sbjct: 387 TGISSTGAADGG----YNAQLGKAKTELNDISLAIKKSNMRMDLLKKELLTIEPKLKEAT 442

Query: 593 QEVSNQTALK-IKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRA 651
           ++  N+ ++K +K  +++ N  K Q+ +  E     +   D   K  +MK+        A
Sbjct: 443 KD--NELSIKHVKECQEICN--KLQAQLV-EFGFDPSRIKDLEQKENKMKSQYYQICNEA 497

Query: 652 SEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVST-ACPRLDD 710
              +  +AN++      T  Y   ++  + G  GRL  L   +  Y  A+ T A  RL +
Sbjct: 498 EHLKRRVANLEFN---YTKPYPDFETSSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFN 554

Query: 711 IVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVPRLFDLI 763
           +VV   +   Q +E  R  K      I LDK+  R      ++      P  V    +LI
Sbjct: 555 VVVRDSQTATQLLEGGRLRK--RVTIIPLDKIYTRPITPQVLELAKSIAPGKVELAINLI 612

Query: 764 KPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNH 822
           +  D     A   +  ++L+  D + A ++ +  + R R +TL G + D  GT+SGG  +
Sbjct: 613 RF-DKPVTKAMEFIFGNSLICDDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRN 671

Query: 823 VSKGLMM 829
            S+ L++
Sbjct: 672 TSQSLLV 678

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
            chromosome segregation protein
          Length = 1170

 Score =  122 bits (305), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 252/1079 (23%), Positives = 473/1079 (43%), Gaps = 177/1079 (16%)

Query: 151  INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
            + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3    VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 210  SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
             DLI+K  +   +T  SV + F    D+ +     SE  PK+ ++R+     +SKY ING
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVF-DNTDKSNTPIGFSEY-PKISVTRQIVLGGTSKYLING 119

Query: 270  KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
              +    V +L +   +++++  FLI+QG++  I  MKP         +L  +E+  GT 
Sbjct: 120  HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGTK 172

Query: 330  KYKQLIEKDLIEIESLNEICIEK------ENRF---EIVDREKNSLESGKNLALEF---- 376
             ++   EK         E  ++K      ENR    E +D +   L + K L LEF    
Sbjct: 173  MFEDRKEK--------AERTMQKKETKLQENRTLLKEEIDPQLEKLRNEKRLFLEFQTIQ 224

Query: 377  ----------LEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTL 426
                      +  + Q  L+    ++  L  +NSK+    +KI  +N E +   + N+ L
Sbjct: 225  ADLETTEKVVIATDYQKMLNSRDSIKTVLETSNSKMDELQKKIDLVNREIS---NLNEDL 281

Query: 427  QNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLK----NLTQKKAKT 482
            Q  + + K+ L E+ + IK +E +E + L        E   L   LK    N+   K K 
Sbjct: 282  QQTMKQKKKEL-ENDTNIKAMESKEDKLL-------SEIAKLKANLKINGDNILDGKQKQ 333

Query: 483  EKIIATTEKTISSLTSEIQELEKSQ---KEYSDELETLNQQLQSERESLEAMKLKLKEKT 539
            +++    EK+   L S+ Q LE S+   +    +L  LN   + + E L  +   +   +
Sbjct: 334  KRLTVKIEKSKQLLDSKSQLLEDSKSKSRNCEADLTRLNSIFKQKEELLSVLSTGI--SS 391

Query: 540  SGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQT 599
            +G +E    +E  +   N K+ +   EI+  + +I LL+  +  ++N+ K+   ++  +T
Sbjct: 392  TGGTEG--GYEAQISSVNDKINDNSIEIEKNKMKIELLK--KEFMENEEKIGKSQLQVET 447

Query: 600  ALKIKR---------EEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQR 650
             +K ++         EED+ +   +  +  KE+ N E E +  ++  K  ++   ++R  
Sbjct: 448  HMKERKQLTEICKKLEEDIFSHGFRPEAF-KELKNREYELD--QAIYKTNRDCEGLRR-- 502

Query: 651  ASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVS-TACPRLD 709
                R+A    Q      +  ++      + G    L  +   +  Y + +   A  RL 
Sbjct: 503  ----RVAGIEFQ-----YSKPFESFDPNSVKGVTAELFSIPEQNMKYVIGLQICAGGRLY 553

Query: 710  DIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVPRLFDL 762
            +++V+  + G   ++  R  K      I LDK+  R  N N ++      P  V    +L
Sbjct: 554  NVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKLAKQLAPGKVELALNL 611

Query: 763  IKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGG- 820
            I   D + V A   +  ++L+  D + A ++ +    R R +TL+G + D  GT+SGG  
Sbjct: 612  IGYSD-EVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEGTLSGGTR 670

Query: 821  -------------NHVSKGLMMLQRKGQNYFD-----DYNPEDVEQIEKDLSDKEKNFE- 861
                         N + K L+ +  + QN        +    +   ++K+LS K+   + 
Sbjct: 671  NNTNTLLVDIQQYNTLKKELLAMNEEKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDI 730

Query: 862  -----------LANNAFYEMENELQKLNNRKPE-------IELEISKIIMEIDTYSAEIK 903
                       +  N   E+ENE++ L +   +       +E EI K+  ++  +S    
Sbjct: 731  LERTMNSEPSLMMQNRNGEIENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKG 790

Query: 904  SKERQLQEKTNIDNSELQD----NEELKVAIENLQKLKEEHLALQDKTKAKK-------- 951
            +K ++L+ + +  N +++D    +E+L    E + K++ E +A +  T  K         
Sbjct: 791  AKLKELKAEVHELNEQIKDLESESEKLNDTYEKI-KVETEQIANEIDTDTKSLDSTVQDI 849

Query: 952  -----------KKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKS 1000
                       K + + +E++M +   +L V+  ++++I   ++ L    K+   SK   
Sbjct: 850  EKKLEEEIKINKMLKTSEEELMSVQN-DLNVERKRISNIDDELEELERTIKQKEESKNTY 908

Query: 1001 DTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSL-------NNIDKSIEEFQAHK 1053
            + EL++    L   KN    I   + +I E  + ++  +        N   ++ E++   
Sbjct: 909  ELELKQLHHDLSKYKNSTDGIEKALNDIQEEHEWVTDEMLVRSICEQNAGVNVNEYRHRM 968

Query: 1054 ETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKL 1112
            E L+   DEL+ KV     N N     E  V  K E L  ++  I+   K +ED++SKL
Sbjct: 969  EQLQKNFDELRRKV-----NPNIMNMIE-SVEKKGEALKTMIRTIEKDKKKIEDTISKL 1021

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  122 bits (305), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 175/733 (23%), Positives = 320/733 (43%), Gaps = 111/733 (15%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            DLI+K  +   +T  SV + F    D+ +     + + P++ ++R+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF-NNTDKLNSPIGFTNS-PQISVTRQVVLGGTSKYLING 119

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 330 KYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLE-KEKQLTLSKS 388
            ++                   +E     + +++  L+  + L  E +E K ++L   K 
Sbjct: 173 MFED-----------------RREKAERTMSKKETKLQESRTLLTEEIEPKLEKLRNEKR 215

Query: 389 KLLQYNLWQNNSKLTNTLQKISALNEEYNVEK---SKNQTLQNEINRTKQL--------- 436
             L++   Q + + T   ++I A  + YN++    S  +TL+N     K+L         
Sbjct: 216 MFLEFQSTQTDLEKT---ERIVASYDYYNIKHKHTSIRETLENGEAHMKKLNDFIRKTSE 272

Query: 437 ----LNESQSKIKVLEGEEKQQLKSKRILEGE-------------HVSLDEKLKNLTQKK 479
               LNE   +IK    +EK+  K  RI + E               SL  K++NL    
Sbjct: 273 EIESLNEDIREIK--HQKEKELHKEGRIFKLEAQENGLLNEISRSKTSLSIKMENLNDTN 330

Query: 480 AKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKT 539
            K    +   E  I+S ++++ E +    +  ++ +T   QL  +R+  +  +  +   T
Sbjct: 331 GK----LKAVESEIASASAKLNEKKTEYIKTEEDYKTAQGQLSKQRDLYKRKEELVSTLT 386

Query: 540 SGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQT 599
           +GIS            +N ++ + KTE+  +   I         LK ++  +  ++ N T
Sbjct: 387 TGISSTGAAD----GGYNAQLIKAKTELNDISLAIKKSNMKMELLKKELLAIEPKLKNAT 442

Query: 600 A---LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656
               L IK  +D          +   +    TE     S++K++K       QR +E + 
Sbjct: 443 MDNELNIKHVKDC-------QEVCNRLQAQLTEYGFDPSRIKDLK-------QRENELKS 488

Query: 657 ALANVQNRGKVL-----------TALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVST-A 704
               + N  + L           T  Y   K+  + G  G+L  L   +  Y  A+ T A
Sbjct: 489 RYYQISNDSEYLKRRVANLEFNYTTPYPDFKANFVHGVVGQLFQLDYDNIRYSTALQTCA 548

Query: 705 CPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVP 757
             RL ++VV+  +   Q +E  R  K      I LDK+  R+ N   ++      P  V 
Sbjct: 549 GGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPLDKIYARTINPQVLELAKTVAPGKVE 606

Query: 758 RLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTM 816
              +LIK  D     A   +  ++L+ +D + A ++ +  + R R +TL G + D  GT+
Sbjct: 607 LAINLIKF-DKTVTKAMEFIFGNSLICEDPETAKKITFHPKIRIRSITLQGDVYDPEGTL 665

Query: 817 SGGGNHVSKGLMM 829
           SGG  + S  L++
Sbjct: 666 SGGSKNTSDSLLV 678

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score =  117 bits (294), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 241/1007 (23%), Positives = 450/1007 (44%), Gaps = 139/1007 (13%)

Query: 151  INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
            I +L ++ FKSYA + V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3    IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 210  SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS----ETKPKLVISRKAFKNNSSKY 265
             DLI+K  +   +T  SV + F       + D K S    E  PKL ++R+     +SKY
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVF------SNLDPKCSPIGFENSPKLSVTRQIILGGTSKY 115

Query: 266  YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
             ING  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116  LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEA 168

Query: 326  IGTSKY---KQLIEKDLIEIESLNEICIEKENRF---EIVDREKNSLESGKNLALEFLEK 379
             GT  +   K   E+ +       E+ + KENR    E ++ +   L + K + LEF E 
Sbjct: 169  AGTKMFEDRKGKAERTM----GKKELKL-KENRTLLQEEIEPQLEKLRNEKRIFLEFQEI 223

Query: 380  EKQLTLSKSKLLQY---NLWQNNSKLTNTLQKISALNEEYN--VEKSKNQTLQ-----NE 429
            +  L   +  +L Y   +L    S +  TL    +   E +  + K+  + +      N 
Sbjct: 224  QTDLEKIQRIVLAYEYHSLVGKQSSIKETLDTGESRMAELHGLISKTGEEVMHLTEDLNR 283

Query: 430  INRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATT 489
            IN  KQ   +S  K+  LE +E   + +   L     S D  ++N+ +    T K + +T
Sbjct: 284  INYEKQKELDSDGKLGKLEKQESTLMNN---LSRLRASFDICVENINE----TAKNLEST 336

Query: 490  EKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIH 549
            +  I +   +++E  ++ K    E   LN++ +  +ES       L    +GIS      
Sbjct: 337  KANIKTNKGKLEEKSEAWKNMEAEYRHLNKKGKELKESHSKKSELLSTLQTGISSVGTTG 396

Query: 550  EHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDL 609
                E      Q   T+  L E++I ++Q+ ++K+++  K L          ++  EE L
Sbjct: 397  GGYTE------QLAATKGNLQEAEI-VVQKSRLKIEHLNKELHANKPKLEKARMDNEEGL 449

Query: 610  VNLKKQQS---SITKEISN---GETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQN 663
              +KK +S   + T+E++      +   + R K   M+  L+   +     R ++AN++ 
Sbjct: 450  NQIKKHKSIQDTFTEELNRYGYDPSVVKELRQKEYSMRQELHNVGRETEYLRRSVANIEF 509

Query: 664  RGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVS---TACPRLDDIVVETVECGQ 720
               + +  +       + G   +L  L   +N YD A++    A  RL +++V+      
Sbjct: 510  NYTMPSEKF---DPNSVKGVAAQLFTLS--ENNYDSALALQVCAGGRLFNVIVDDQNTAS 564

Query: 721  QCIEY--LRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFV 771
            Q +E   LRK        I L+K+  R  N+ +++      P  V    +L+  ++ +  
Sbjct: 565  QLLERGKLRKR----VTIIPLNKIATRVINSESLKLAKQLAPGKVQLALNLVGYEE-EVS 619

Query: 772  PAFYSVLRDTLVAKDLKQANRVAYG-QRRYRVVTLDGKLIDVSGTMSGGG-NHVSKGLMM 829
             A   +  ++LV  D + A R+ +  Q R R +T  G + D  GT+SGG  N+ S  L+ 
Sbjct: 620  KAMEYIFGNSLVCNDAETAKRLTFHPQIRTRSITQQGDVYDPEGTLSGGSRNNKSTLLVD 679

Query: 830  LQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEIS 889
            +Q+        YN                    A      +E+EL  ++N+  E E   +
Sbjct: 680  IQK--------YNS-------------------AAKRMKVLEDELLVISNKLKEQESASA 712

Query: 890  KIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKA 949
            K        + EI++K   +  K +I    L +N   ++   N   L  +    +++ + 
Sbjct: 713  K--------TKEIQNKLNLVSHKLSIFQRTLNENPATQIIKRN-DDLTRQIRECEEEIEQ 763

Query: 950  KKKKIASLKEKIMKIGGIELQVQNSKVT---SIVQRIDILTAKQKK-DRTSKKKSDTELE 1005
            K+  ++ L+++I KI     +  N K T    + + ID LT +  K D  + KK D    
Sbjct: 764  KQSYMSQLQDEIRKIQDDMEEFNNDKGTKLEKLKKEIDSLTKEIGKLDSITDKKYDL--- 820

Query: 1006 KAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKD 1065
                       ++ L T+   +++  I     +L +++ S++ FQ  K++L  E +  + 
Sbjct: 821  ---------YQNLQLETE---QLTSEISSDEDALEHMNTSLDNFQNQKKSLIAELEHAEH 868

Query: 1066 KVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKL 1112
             + D+   ++E K   ++++ +L++LNGL++    +  +LE  L +L
Sbjct: 869  TLADVHSEVDEEKKRLVDIDEELKELNGLIHAKAEKKSSLELELQQL 915

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score =  115 bits (289), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 185/727 (25%), Positives = 312/727 (42%), Gaps = 119/727 (16%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D  ++ I      K+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V +L +   +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 328 TSKYKQLIEKDLIEIESLNEICIEKENRFEIVDR----EKNSLESGKNLALEFLE-KEKQ 382
           T  +                     ENR E  +R    ++  L+  + L  E +E K ++
Sbjct: 171 TKMF---------------------ENRREKAERTMAKKETKLQESRTLLEEEIEPKLEK 209

Query: 383 LTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS 442
           L   K   L++   Q  +    T++ + A +                    K ++N   S
Sbjct: 210 LRNEKRMFLEFQTTQ--ADFEKTMKVVHAFD-------------------YKNMINRHAS 248

Query: 443 KIKVLEGEEKQ--QLKSKRILEGEHV-SLDEKLKNLTQKKAK---TEKIIATTEKTISSL 496
              VLE  E +  +LK   +   E + SL+E L+ +  +K K    +  ++  EK  S L
Sbjct: 249 VKDVLESSEARMAELKGLILRTAEEIGSLNEDLEQVKIQKEKELDKDATLSRLEKEESEL 308

Query: 497 TSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPW 556
            +E+  ++ S    +D ++  N+Q++  +  +E  KL LKEK    SE     E + +  
Sbjct: 309 LNEVSRIKTSHSICNDNIKENNKQVEKLKSDIEQFKLTLKEK----SETFESTEKEYQEI 364

Query: 557 NIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVS------NQTALKIKR----- 605
           N  + + K      E  +S L  G     +     S +++      N T + IK+     
Sbjct: 365 NASLAKIKETYSKKEELLSTLLTGITSTGDTDGGYSAQLTIAKNKLNDTEVSIKKLSMRI 424

Query: 606 ---EEDLVN--LKKQQSSITKEISNGETE-----CNDGRSKL----------KEMKNVLN 645
               ++LVN   K QQ+ I  E   G  E     C D   +L          KE+K   N
Sbjct: 425 DILNKELVNNQPKLQQAKIENEKIRGNVEKHKHVCLDLEQQLSKSGFDPLRTKELKTREN 484

Query: 646 MQRQRASEARLALANVQNRGKVLTALY-KLQKSGRIVGFHGRLGDLGTID-NTYDVAVS- 702
             RQ          N++ R   L   Y    ++       G    L T++ + +D A + 
Sbjct: 485 SLRQEIHRVETQNENLKRRVAGLDFNYTNPSENFDARSVKGVAAQLFTLNKDHFDAASAL 544

Query: 703 --TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TP 753
              A  RL ++VV+  +     +E  R  K      I L+K+  R+ N  T+Q      P
Sbjct: 545 QVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAP 602

Query: 754 KNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYG-QRRYRVVTLDGKLIDV 812
             V    +LI   D +   A   +   +LV +D   A +V +  Q R R +TLDG + D 
Sbjct: 603 GKVELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDP 661

Query: 813 SGTMSGG 819
            GT+SGG
Sbjct: 662 EGTLSGG 668

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  112 bits (280), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 182/722 (25%), Positives = 332/722 (45%), Gaps = 91/722 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS----ETKPKLVISRKAFKNNSSKY 265
            DLI+K  +   +   SV + F       + D K S    E  PK+ ++R+     +SKY
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF------DNSDIKSSPIGFERYPKISVTRQIALGGTSKY 115

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
            ING  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEA 168

Query: 326 IGTSKY---KQLIEKDLIEIES-LNEI--CIEKENRFEIVDREKNSLESGKNLALEFLEK 379
            GT  +   ++  EK + + E+ L EI   +++E     ++ + +   S K   LEF E 
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEIRALLQEE-----IEPKLDKFRSEKRAFLEFQET 223

Query: 380 EKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVE--KSKNQTLQNEINRTKQLL 437
           +  L ++  +++  + + N     N++Q+ +  N E  V+  +S  +  QNE++     L
Sbjct: 224 QTDLEMT-LRIVNTHDYHNLVTKQNSIQE-TVQNSEQRVQELESSIKKYQNELSS----L 277

Query: 438 NESQSKIKVLEGEEKQQLKSKRILEGEHV--SLDEKLKNLTQKKAKTEKIIATTEKTISS 495
           NE  + IK    +E + LK   + + E +  +L   L   +      +  +   +K++  
Sbjct: 278 NEDFTAIK--NQKECELLKDGSLTKLEKLENTLSTDLSRFSTALGIAKDDLKQEKKSLID 335

Query: 496 LTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEK-------TSGISEEILI 548
           + S ++  EK     +  L+T+ QQ     +S+E +K + K+K       T+GIS     
Sbjct: 336 IQSSLESSEKDLFVKAKNLKTIEQQYNELNDSIEKLKSQHKDKEELLSTLTTGISSTGAT 395

Query: 549 ---HEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKR 605
              +   L     K+ E +  I+    +I++LQ+         ++ S E   Q A K   
Sbjct: 396 DGGYNSQLAAAKAKLGEAEISIKKANMRIAMLQK---------ELASSEPLLQRAKK-DN 445

Query: 606 EEDLVNLKKQQSSITK-EISNGETECNDG-----RSKLKEMKNVLNMQRQRASEARLALA 659
           EE ++ +K++   I K ++S  ++  N       R +  E+KN L          R  +A
Sbjct: 446 EEQIMQVKQRGQEIEKLKVSLNKSGFNPELMKTLRRRENELKNNLQKLSNDTEYLRRKVA 505

Query: 660 NVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVS---TACPRLDDIVVETV 716
           N++      T  +  Q    + G   ++  LG  DN +D A +    A  RL +I+V+  
Sbjct: 506 NLEFNYTSPTKDFNPQS---VKGVAAQVFTLGK-DN-FDSANALQVCAGGRLFNIIVDNE 560

Query: 717 ECGQQCIE--YLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKD 767
           +   Q +E   LRK        I L+K+  R  +  ++       P  V    +LI  ++
Sbjct: 561 KTASQLLEKGMLRKR----VTIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEE 616

Query: 768 SKFVPAFYSVLRDTLVAKDLKQANRVAYG-QRRYRVVTLDGKLIDVSGTMSGGGNHVSKG 826
                A   +   +L+  D + A ++ +  Q R R +TLDG + D  GT+SGG ++ +  
Sbjct: 617 D-VSKAMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNS 675

Query: 827 LM 828
           L+
Sbjct: 676 LL 677

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score =  112 bits (280), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 185/724 (25%), Positives = 318/724 (43%), Gaps = 132/724 (18%)

Query: 685  GRLGDLGTID--NTYDVAVSTACP--RLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 740
            G    L ++D  N Y       C   RL ++VV+      Q +E  R  K   A  I L+
Sbjct: 525  GIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLN 582

Query: 741  KL--RSFNTNTIQTPKNV-PRLFDL---IKPKDSKFVPAFYSVLRDTLVAKDLKQANRVA 794
            K+  R+ N N +   K+V P   +L   +   + +   A   +   +LV KD + A  V 
Sbjct: 583  KIAARTLNDNIVNMAKSVAPGRVELALNLIGYEEEVRRAMEFIFGSSLVCKDAEAAKMVT 642

Query: 795  YGQR-RYRVVTLDGKLIDVSGTMSGGG-NHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKD 852
            +  + R R +TLDG + D  GT+SGG  N+ S  L+ +QR    Y ++ N   V+++E  
Sbjct: 643  FNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQR----YNNNCNL--VKELETK 696

Query: 853  LSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEK 912
            L+D  K   +     +E+ N   K  N + E+EL   K           +K  ER LQ  
Sbjct: 697  LNDIAKKIAIQ----FEISN---KTKNLQKELELAQHK-----------LKLSERNLQ-- 736

Query: 913  TNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQ 972
            +N     ++ NEEL+  I    + KEE   ++DKT     +I  LK++I KI     +  
Sbjct: 737  SNTAAQLIRKNEELESEI---AQCKEE---IKDKT----SQIKQLKKQIAKIEKDADEFS 786

Query: 973  NSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERI 1032
            + K +    ++D L    +++  S     +E E+  +T   +  +  L   +I+++   I
Sbjct: 787  HDKGS----KLDEL----RREVESMSVQISEEEQRCETQYDAYQNFQL---EIEQLGGDI 835

Query: 1033 DKISSSLNNIDKSIEEFQA----HKETLKDECDELKDKVVDLEENIN-------EFKSFE 1081
            D    +L   + ++++ Q     H   L+D    L+DK V+LEE  N       E K  E
Sbjct: 836  DSSKDTLEQAELTVKKLQTEVSEHDMNLRDLNQALQDKQVELEEERNRLMGIDDELKEIE 895

Query: 1082 IEVNNK----------LEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAK 1131
              + +K          ++K+N  LN +++   + E  L++L           LDE     
Sbjct: 896  ALIKSKTDIKNNAELDIQKINHELNKLRSTSNSFESELAQL-----------LDEHEWLS 944

Query: 1132 APNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLV 1191
              +      EQ       E      Q  +  D D   +V  N + ++            V
Sbjct: 945  DESQVAYIIEQHASINLAEYRERGAQLQERFD-DMKRKVNPNIMSMIES----------V 993

Query: 1192 ETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRY 1251
            E + S L+  I + + +   ++E + +L E+            KRET+ K  E++     
Sbjct: 994  EKKESALKTMIRTIEKDKVKIQETITKLNEY------------KRETLIKTWEKVT---- 1037

Query: 1252 EEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLS 1311
            E+F + F    +      +++   G             +EG+   V        ++  LS
Sbjct: 1038 EDFGNVFA--DLLPNSFAKLVPCEGK----------DITEGLEVKVKLGSIWKESLIELS 1085

Query: 1312 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1371
            GG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+
Sbjct: 1086 GGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLK 1145

Query: 1372 NNMF 1375
              MF
Sbjct: 1146 EGMF 1149

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
           YJL074C (SMC3) - SMC chromosomal ATPase family member
           [contig 224] FULL
          Length = 1247

 Score =  105 bits (263), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 187/815 (22%), Positives = 342/815 (41%), Gaps = 147/815 (18%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I  + +  FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
              LIH+      + S  V++ F    D+    + I  T+  +V  R+       +Y +N
Sbjct: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG- 327
           GK  + +D++++ +  G    +   ++ QG +  +   K K         L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLLEDVVGA 195

Query: 328 ---------TSKYKQLIEKDLIEIES-LNEICIEKENRFEIVDREKNSLESGKNLALEFL 377
                    +SK  +   +D  +I S L+E+    + R E +D E+  LE  +      L
Sbjct: 196 RSFEIKLRESSKKMEATNRDRAKITSELSEL----KARLEELDEERQELEKYQE-----L 246

Query: 378 EKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEY-NVEKSKNQTLQNEINR---- 432
           E+++       ++ Q+ L+  + +L     +I +L +EY NV +S  + +Q    R    
Sbjct: 247 ERDR-------RIFQFVLY--DRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLI 297

Query: 433 ---TKQLLNESQSKIKVLEGEEKQQLKSK-RILEGEHVSLDEKLKNLTQKKAKTEKIIAT 488
              TK + N  ++++K+ E  + QQ KS+ + +      L+ + +   +++ +     A 
Sbjct: 298 ANLTKNISN-VEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAV 356

Query: 489 TEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILI 548
             K ++++  EIQ         S   E    QL+ E E+ EA   + + K   I  +  I
Sbjct: 357 YRKNLATVEEEIQNTSTQLNRLSPRYE----QLKLEAEAFEAQLSQYQRKQREIISKRGI 412

Query: 549 H-----EHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKI 603
           +     + + + W             +  ++S L+     LK +++++  E   Q A +I
Sbjct: 413 YAQFENQSERDAW-------------IAKELSSLKAQTDDLKKNVEIMEAE-KEQVAAEI 458

Query: 604 KREEDLV---NLKKQQSSITKEISNGETECND-GRSKLKEMKNVLNMQR-----QRASEA 654
           +++++ +   N   +   I+ E+ + +T  ND  RS L+++     + R     Q  SEA
Sbjct: 459 QQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEA 518

Query: 655 RL----------------ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTY- 697
            L                 LAN     + +T   KL         HG LG+L  ++  Y 
Sbjct: 519 LLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPG----AVHGPLGELIKVNEKYK 574

Query: 698 DVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNV- 756
             A +     L  +VV+T E     +  L   K G   FI L+++   + N +  P+N  
Sbjct: 575 TCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRIS--DRNAVTFPENAQ 632

Query: 757 ----PRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLI 810
               P L+ +    D  F  A   V   T+V +DL   +++A   R Y +  VTLDG   
Sbjct: 633 AECTPLLWKI--KYDKVFEKAVRHVFGRTIVVRDLGNGSKLA---RSYNLDAVTLDGDRA 687

Query: 811 DVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEM 870
           D  G ++GG                  + DY+        KD+S  ++    A       
Sbjct: 688 DNRGVITGG------------------YHDYHKRTRLDCLKDISSAKEQLTQAT------ 723

Query: 871 ENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSK 905
               Q LN     + L+I  I  EID  + E+K++
Sbjct: 724 ----QSLN----AVRLKIGAIDSEIDNVNGELKAQ 750

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 94/194 (48%), Gaps = 28/194 (14%)

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELEL------------- 1282
            +E++ K +E LKK + E     F  ++     +++ +   G   L +             
Sbjct: 1043 KESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQ 1102

Query: 1283 -----------VDSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKY 1329
                        D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+   
Sbjct: 1103 RSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMV 1162

Query: 1330 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCEN 1389
             P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A     + K EN
Sbjct: 1163 DPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV-KFEN 1221

Query: 1390 R-THSATIKNREIL 1402
            + +  AT+  +E +
Sbjct: 1222 KISEIATVSKQEAI 1235

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  105 bits (261), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 217/474 (45%), Gaps = 91/474 (19%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D   + I  E+ PK+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328 TSKY---KQLIEKDLIEIES-LNEICIEKENRFEIVDREKNSLESGKNLALEFLE-KEKQ 382
           T  +   ++  EK + + E+ L EI    E   E        LE  +N    FLE +E Q
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEIRTLLEEEIE------PKLEKLRNQKRAFLEFQETQ 224

Query: 383 LTLSKS-KLLQ----YNLWQNNSKLTNTLQKISALNEEYN--VEKSKNQT---------- 425
             L K+ ++L     Y++   NS +  TLQ  +A  EE N  ++K+KN+           
Sbjct: 225 TDLEKTLRILNAYEYYDMATKNSTIKETLQNSTARVEELNNFIQKTKNEISNLDEDLKTI 284

Query: 426 -----------------------LQNEINRTKQLL-------NESQSKIKVL-EGEEK-- 452
                                  L NEI+R K  L       NE   K+K L E  +K  
Sbjct: 285 KIQKQEQVQKDGKLSQLEKQENDLANEISRLKTALGISVENINEESYKLKKLHENVQKFE 344

Query: 453 QQLKSKRIL----EGEHVSLDEKLKNL-TQKKAKTEKIIATTEKTISSLTSEIQELEKSQ 507
           + L  K ++    E E   L+E +K L  Q KAK        E+ +S+LT+ I     + 
Sbjct: 345 RDLSEKSVIYTSTESEFNDLNEGVKRLKGQFKAK--------EELLSTLTTGISSTGGTD 396

Query: 508 KEYSDELETLNQQLQSERESLE--AMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
             Y+ +L     +L   +  ++   MK+ + +K S I+E  + H       NI+
Sbjct: 397 SGYNSQLSAAKTKLNDAQICIKRSTMKIDMLKKESAINEPKIAHAERENEQNIR 450

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/382 (26%), Positives = 187/382 (48%), Gaps = 48/382 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI--SETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +   SV + F    D  D  +     ET PK+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF----DNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 328 TSKY---KQLIEKDLIEIES-LNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQL 383
           T  +   ++  EK + + E+ L EI   +    E ++ + N L + K   LEF  ++ Q 
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEI---RALLLEEIEPKLNRLRNEKRAFLEF--QQTQT 225

Query: 384 TLSKSKLLQYNLWQNNSKLTNT------LQKISALNEEYNVEKSKNQTLQNEINRTKQLL 437
            L K+           S++ NT      +QK S++ E    ++ + + L+  + + +  +
Sbjct: 226 DLEKT-----------SRIVNTYDYQTLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEI 274

Query: 438 NESQSKIKVLEGEEKQQLK---SKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTIS 494
           +      + +  ++++QL+   + + LE +  SL  +L  +T     T   +A  ++ +S
Sbjct: 275 STLTEDFESIRRQKEKQLQKDTTLQTLEAKENSLSTELSRVTAALGITRDDLADEQRNLS 334

Query: 495 SLTSEI----QELEKSQKEYSD 512
           +L   I    QEL    K YS+
Sbjct: 335 ALNLSIAKSEQELTSLSKTYSE 356

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 12/139 (8%)

Query: 703 TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKN 755
            A  RL +++V+  +   Q +E  R  K      I L+K+  R  NT+ +       P  
Sbjct: 547 CAGGRLFNVIVDNEKTASQLLERGRLRK--RVTIIPLNKISARVINTDALNKAKSLAPGA 604

Query: 756 VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYG-QRRYRVVTLDGKLIDVSG 814
           V    +LI   +++   A   +   +L+ +D   A +V +  Q R R +TLDG + D  G
Sbjct: 605 VELALNLI-GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEG 663

Query: 815 TMSGGG-NHVSKGLMMLQR 832
           T+SGG  +H S  L+ +Q+
Sbjct: 664 TLSGGSRSHTSSLLIDIQK 682

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 179/792 (22%), Positives = 322/792 (40%), Gaps = 166/792 (20%)

Query: 685  GRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743
            G LG+L  I   Y           L  +VV+T       ++ L  +K G   FI L+++ 
Sbjct: 533  GPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVH 592

Query: 744  SFNTNTIQTPKNVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYR 801
              ++N +    +      LIK    D KF  A   V   T+V KDL Q  ++A  Q R  
Sbjct: 593  -VDSNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA-KQFRLN 650

Query: 802  VVTLDGKLIDVSGTMSGG--GNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKN 859
             +TLDG   D  G ++GG   +H  K L  ++             D++ ++K+    +  
Sbjct: 651  AITLDGDKADSRGVLTGGFHDHHKQKRLDSMR-------------DLKSLKKEQQGNKSQ 697

Query: 860  FELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQL---------- 909
             E      + ++ E+ +LN++  +       I+ +++  + +++  +R+           
Sbjct: 698  LEEVKEKLHSIDQEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQL 757

Query: 910  ---QEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGG 966
               +EK  I+   LQD  +L +  E+L +  +  L L ++ +        L E   K+  
Sbjct: 758  ISKEEKAKINQKLLQD--KLDMYTEDLSRDFDTELTLTEREE--------LDEIAKKLPD 807

Query: 967  IE--LQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDD 1024
            +E  L      ++S+V +ID L A+           D++L+   K L    N+I   T  
Sbjct: 808  LENLLNTTTDALSSVVVKIDSLKAEL----------DSKLKPQAKELEDQPNEIMSTT-- 855

Query: 1025 IKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEV 1084
                         ++ N+ + I+  +  ++TL +    + ++V  + E I+  KS + E 
Sbjct: 856  -------------AIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSRQEEE 902

Query: 1085 NNKLEKLN----GLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD 1140
               LEK N     LL  + N  K  E S+    LRKM   L    +E + K  + G L D
Sbjct: 903  EKSLEKANSQQRALLKKLDNYQKEAEKSM----LRKM--TLSTRRDELQQKIRDIGLLPD 956

Query: 1141 E---QIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSD 1197
            +   + H+ +  EL                              ELS+++          
Sbjct: 957  DSADKYHNMSSSELLK----------------------------ELSSIN---------- 978

Query: 1198 LEKYIESTDANIEVLEEYVK---RLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEF 1254
             +K  + T+ N   LE + K   +  +   R  +L+++   +E++ K +++LKK + E  
Sbjct: 979  -DKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDES---KESIEKLIDKLKKQKVEAV 1034

Query: 1255 MHGFGIISMTLKEMYQMITMGGNAELELV------------------------------- 1283
             + F  +S    ++++ +   G  +L +                                
Sbjct: 1035 ENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEPSKPSKRQQKKRKRQETEDVHFNDDQ 1094

Query: 1284 ---DSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1338
                S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1095 DENSSQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1154

Query: 1339 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT-IK 1397
            EIDAALD +  + VA  +K+ +  AQFI  + R +M  +A +   +   EN+  +   + 
Sbjct: 1155 EIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV-NFENKISTVVEVT 1213

Query: 1398 NREILNSDINRE 1409
              E LN    RE
Sbjct: 1214 KAEALNFVTGRE 1225

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 169/728 (23%), Positives = 327/728 (44%), Gaps = 112/728 (15%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPK---LVISRKAFKNNS 262
              LIH+      + S SV++ F      HD + KI   S   P+    V  R+      
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVF------HDPNHKIILPSGVVPRENDEVYIRRTVGLKK 113

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y +N +     DV ++L+  G  +++   ++ QG++  +   K K         L  L
Sbjct: 114 DDYQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLL 166

Query: 323 EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESG-KNLALEFLEKEK 381
           ED++G   ++  ++  L +++       E E +   +D E N L S  K +  E  E EK
Sbjct: 167 EDVVGAKSFELKLKASLKKMD-------ETEQKRNQIDMEMNELNSKLKEMNQERKELEK 219

Query: 382 QLTLSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNES 440
             +L K+ K+ Q+ L+  + +L + + +I  L+ +YN     ++    E+++ + +++E 
Sbjct: 220 FNSLDKNRKVFQFTLY--DRELNDIITQIENLDGDYNSTVDSSEKYIKELDKRENIISEL 277

Query: 441 QSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEI 500
             K+  ++   K  +K+   L+    +  E L NLT                  +L  +I
Sbjct: 278 TKKLTEIDSSLK--IKTTNDLQIAKANNSEILNNLT------------------NLDVQI 317

Query: 501 QELEKSQKEYSDELETLNQQLQSERESLEAM-------KLKLKEKTSGISEEILIHEHDL 553
           ++L+        +LET N+Q  S++ +LE +       +LKL  K S   +++   E   
Sbjct: 318 KDLKL-------QLETQNEQTNSDKSNLELINKEIESRRLKLS-KISPRFQQLTNEESRF 369

Query: 554 EPWNIKVQEKKTEIQLVESQISLLQEGQVK---LKNDIKVLS--QEVSNQTALKIKREED 608
           +  +  ++E++ ++ L + + S     Q +   ++N+IK L+  Q+  N T  K K E+D
Sbjct: 370 KLQSNTLKERQRDLLLKKGRYSRFHTAQERNEWIENEIKELNQLQQSLNDTKTKNKIEKD 429

Query: 609 LV--------------NLKKQQSSITKEISNGETECNDGR----SKLKEMKNVLNMQRQR 650
            V              N   Q  SI  E+ + E+  +D +    S + + K +   +++ 
Sbjct: 430 EVAERINTIDEEIQELNDSIQGPSINAELEDLESNIDDIKQQYNSSIDQRKELWRNEQKL 489

Query: 651 ASEARLALANVQNRGKVLT-----ALYKLQKSGRIVG---------FHGRLGDLGTIDNT 696
            +  +  L NV++  + +      +L    KS + +            G LG+L ++++ 
Sbjct: 490 ETVLQTILDNVKDSERAVGETMDRSLANGLKSVKEIAEKLKLPEDSVFGTLGELVSVNSK 549

Query: 697 YDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKN 755
           Y           L  ++V+T E   + ++ L + K G   FI L+K+  F+ +    P++
Sbjct: 550 YKTCAEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKVY-FDNSITFPPED 608

Query: 756 VPRLFDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLID 811
                 LIK    D KF  A   V   T+V KDL    ++A   ++Y++  +TLDG   D
Sbjct: 609 QSSYTPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA---KKYKLSAITLDGDRAD 665

Query: 812 VSGTMSGG 819
             G ++GG
Sbjct: 666 KRGVLTGG 673

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 4/121 (3%)

Query: 1286 LDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1343
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1344 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT-IKNREIL 1402
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K EN+  +   I  +E +
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYENKISTVIEIDRQEAI 1217

Query: 1403 N 1403
            N
Sbjct: 1218 N 1218

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 171/715 (23%), Positives = 316/715 (44%), Gaps = 88/715 (12%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++T+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG---DTKISETKPKLVISRKAFKNNSSKY 265
              LIH+      + S  V++ F    D  DG   +   S + P  V+ R+       +Y
Sbjct: 61  RQGLIHQGS--GSVMSAYVEIVF----DNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
            +N K  +  ++  LL+  G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 326 IGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSL-ESGKNLALEFLEKEKQLT 384
            G + +++ +       +SLN++     NR +I D E   L E  + L  E  E EK   
Sbjct: 168 TGANSFEKKLR------DSLNKMDATNRNRKKI-DSELRELDEKLQELNEEREELEKYNA 220

Query: 385 LSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEI--------NRTKQ 435
           L +  K+ Q+ L+  + +L +    I  L+ EYN     ++    E+        N TK 
Sbjct: 221 LERDRKVFQFTLY--DRELNDVTNHIEKLDSEYNNTVDSSEQYVQEMDKREVLISNVTKN 278

Query: 436 LLNESQSKIKVLEGEEKQQLKSKRI-LEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTIS 494
           L+N   +++K+ +  + +Q K+ ++ +E +   LD K + L ++   T +   T E  ++
Sbjct: 279 LVN-IDAELKIKKSTDLEQSKANQLDVEEKKADLDVKCEELQRQIRSTSEQAKTDESNLA 337

Query: 495 SLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLE 554
           S+ ++I   E   K  S   E L ++    +  LE ++ K +        ++L       
Sbjct: 338 SVLNDISRKETQIKRISPRFEELTREEHQFKTDLELLQQKQR--------DLLAKRGRYA 389

Query: 555 PWNIKVQEKKTEIQLVESQIS-LLQEGQVKLKNDIKVLSQEVSN--QTALKIKREEDLVN 611
            +  K QE++     ++S+I+ L QE Q+ L++  + LSQE S+  +   ++  +   +N
Sbjct: 390 QF--KTQEERN--GWIQSEIADLKQEAQI-LESTYQELSQERSDLQEQLAELDEQAKELN 444

Query: 612 LKKQQSSITKEISNGETECN----------DGRSKLKE------------MKNVLNMQRQ 649
              Q   IT E+ +  +E +          D R +L              M +V   +R 
Sbjct: 445 DSIQGPGITAELEDLNSEISQLKQLYTTKIDERKELWRSEQKLQTILETLMDDVKRSERS 504

Query: 650 RASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPR-L 708
                  +LAN     + ++   KL ++      +G LG+L  ++  Y     T     L
Sbjct: 505 VNETMDRSLANGLKAVREISERLKLPEN----AVYGPLGELIKVNEKYKTCAETVGGNSL 560

Query: 709 DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQT--PKNVPRLFDLIKPK 766
             +VV+T +     ++ L   K G   F+ L++L + N  T  +    N   L   IK  
Sbjct: 561 FHVVVDTEDTAGLLMQELYNVKGGRVTFMPLNRLHADNNVTYPSNEQSNCTALIKKIKY- 619

Query: 767 DSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLIDVSGTMSGG 819
           D KF  A   V   T+V +DL    ++A   R+Y++  +TLDG   D  G ++GG
Sbjct: 620 DEKFERAVKHVFGKTIVVRDLTLGTKLA---RQYKLNAITLDGDRADKRGVLTGG 671

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 4/120 (3%)

Query: 1287 DPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1344
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1345 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHS-ATIKNREILN 1403
            D +  + VAN IKE + NAQFI  + R++M  +A     + K EN+  + A +  R+ +N
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVADVFYRV-KYENKISTVAEVSQRDAIN 1216

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 171/746 (22%), Positives = 320/746 (42%), Gaps = 149/746 (19%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPKL---VISRKAFKNNS 262
              LIH+      + S SV++ F      HD D +I   S   P+    V+ R+      
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF------HDPDHRIILPSGVAPRSNDEVLVRRTVGLKK 112

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y +N +     DV ++L+  G  +++   ++ QG +  +   K K         L+ L
Sbjct: 113 DDYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLL 165

Query: 323 EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQ 382
           ED++G   ++  +   L ++E        ++ R +IV   K   E    L+    E+++ 
Sbjct: 166 EDVVGAKSFEVKLRASLKKMEQT------EQKRAQIV---KEMEELNDKLSEMEEERKEL 216

Query: 383 LTLS----KSKLLQYNLWQNNSKLTNTLQKISALNEEYNV----------EKSKNQTLQN 428
              +      K  Q+ L+  + +L + + +I  +++ YNV          E  K + +  
Sbjct: 217 EVFNNLERNRKAFQFTLY--DRELNDVINQIEKMDDVYNVTLHSSHDYITELDKREDMVE 274

Query: 429 EINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIAT 488
           +IN+  Q L   +S IK+ E  E  Q +SK      H  L   + NL  K          
Sbjct: 275 QINKNLQNL---ESSIKIKETAELSQARSK------HNELSNAIANLNVK---------- 315

Query: 489 TEKTISSLTSEIQELEKSQKEYSDELETLNQQ-LQSERESLEAMKLKLKE---KTSGISE 544
                      I++L++    Y DE   LN++ L    E++EA + +L +   +   +S+
Sbjct: 316 -----------IRDLQRQVVSY-DEQSDLNRKNLAIINEAIEAKQAQLAKISPRFESLSK 363

Query: 545 EILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQ---EGQVKLKNDIKVLSQEVSNQTAL 601
           E + ++ +L      +QEK+ ++ L++ + S  Q   E    ++ +++ L++ ++N T L
Sbjct: 364 EEVSYKLELAG----LQEKQRDLLLMKGKYSHFQTVEERNEWIEGELRSLNETLANTTHL 419

Query: 602 K--------------------IKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKE-- 639
           K                    I+  ED V    +   +  EI + E + ND +++  E  
Sbjct: 420 KSQIDNERNELHEKLNATEEQIQELEDSV----RGPGVVAEIEDIEKKVNDLKAEYVEKI 475

Query: 640 --------------------MKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGR 679
                               +  V N +R  +     +LAN     + +T   +L + GR
Sbjct: 476 NERKELWRSEQKLQTISETLLDTVKNSERSVSETMAKSLANGIASVREITEKLRLPE-GR 534

Query: 680 IVGFHGRLGDLGTIDNTYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFIL 738
           +    G LG+L  ++  Y +         L  IVV+T E     I+ L + + G   F+ 
Sbjct: 535 VF---GTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTFMP 591

Query: 739 LDKLRSFNTNTIQTPKNV-PRLFDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAY 795
           L+++  +N   I  P N       LIK    D++F     +V   T+V +DL   +++A 
Sbjct: 592 LNRI--YNDPNITYPPNAQSSCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAGSKIA- 648

Query: 796 GQRRYRV--VTLDGKLIDVSGTMSGG 819
             + Y++  +TLDG   D SG ++GG
Sbjct: 649 --KHYKLDAITLDGDRADKSGLLTGG 672

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  IK  + NAQFI  + R +M ++A +   + K EN+  +    +R+
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEVDRQ 1208

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 103/192 (53%), Gaps = 19/192 (9%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS----ETKPKLVISRKAFKNNSSKY 265
            DLI+K  +   +T  SV + F      ++ DT  S    E+  K+ I+R+      SKY
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF------NNSDTSNSPIGFESHAKISITRQIILGGVSKY 115

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
            ING  +    V +L +   +++++  FLI+QG++  +  MKP+        +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEA 168

Query: 326 IGTSKYKQLIEK 337
            GT  ++   EK
Sbjct: 169 AGTRMFEDRREK 180

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1295
            ++ +++ +E+L + + E  +  +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1296 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1355
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1356 IKERTKNAQFIVISLRNNMF 1375
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 200/832 (24%), Positives = 350/832 (42%), Gaps = 140/832 (16%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           + I  + ++ FK+Y  + VV  F    + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 209 LSDLIHKSEKFPDLTSCSVDVEF-------LYAIDEHDGDTKISETKPKLVISRKAFKNN 261
               I++      + S  V++ F       L  +    G+ +I          R+     
Sbjct: 62  RKGFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRI----------RRTVGLK 109

Query: 262 SSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 321
             +Y IN K S   DV ++L+  G    +   ++ QG + ++   K       D   L  
Sbjct: 110 KDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHL 162

Query: 322 LEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEK 381
           LED++G   ++  +++ L ++E+      +  N    +D+  + L   K    E LEK  
Sbjct: 163 LEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRLSELSDEK----EELEKYN 218

Query: 382 QLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN--VEKS--------KNQTLQNEIN 431
            L   + K+LQ+ L+  + +L +   +I  L  EYN  +E S        K + L  E+N
Sbjct: 219 NLNRDR-KVLQFCLY--DRELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELN 275

Query: 432 RTKQLLNESQSKIKVLEGEEKQQLKSKRI-LEGEHVSLDEKLKN----LTQKKAKTE--- 483
           +    +N  +S+IK+ +  +  QLK+ ++ + GE   LD +L +    L   +A  E   
Sbjct: 276 KR---MNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNV 332

Query: 484 KIIATTEKTISSLTSEIQELEKSQKEYSDELETL----------NQQLQSERESLEAMKL 533
           K I   +K I    S I E++   ++ S+E E L           ++L S++   E  + 
Sbjct: 333 KEIGEVKKQIEINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFR- 391

Query: 534 KLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQ 593
            + E+   I E+I +    L   NI ++++ T      SQ+S LQ     L  +I+ L+ 
Sbjct: 392 TVNERNDWIQEQINLLNQSLNKSNI-LKDQLT------SQLSTLQHDLENLNAEIEDLAD 444

Query: 594 EVSNQTALKIKREEDLVN---------LKK--QQSSITKEISNGETECNDGRSKLKEMKN 642
            V+   +  + ++EDL N         L K  Q+  + +     +T      + +K  ++
Sbjct: 445 SVNGMGS--VAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFES 502

Query: 643 VLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVS 702
            +N    R+    LAL  +QN   ++  L   +         G +G+L  + + Y +   
Sbjct: 503 DMNETIDRS----LALG-LQNVNDIVNRLNLHEH------VFGPVGELIKVSDKYKICAE 551

Query: 703 TACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPR--L 759
                 L ++VV+  E     I+ L   K G   FI L+KL   +TN    P N+ +   
Sbjct: 552 VVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH-VDTN-FTYPNNLEKNQC 609

Query: 760 FDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMS 817
             LIK    D KF      V   TLV K L     +A  + +   +TLDG   D  G +S
Sbjct: 610 TPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAITLDGDRADSKGVLS 668

Query: 818 GGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKL 877
           GG                 Y D Y    ++ +        ++F+ +   + +++ ELQ++
Sbjct: 669 GG-----------------YLDQYKSNRLDTL--------RDFKQSKREYKKIQVELQEI 703

Query: 878 NNRKPEIELEISKI-------IMEIDTYSAEIKSKERQLQ----EKTNIDNS 918
                 IE EI  +         E D Y A I+    QL+    +K  ID+S
Sbjct: 704 KQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDS 755

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1307 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1366
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1367 VISLRNNMFELAQQLVGIYKCENRTHSAT 1395
              + R +M  +A     + K EN+  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 100/190 (52%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D     I  ET   + ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKSKAPIGFETSLTISVTRQIVLGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TKMFEDRREK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1302 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1361 KNAQFIVISLRNNMFELAQQL 1381
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 234/1041 (22%), Positives = 451/1041 (43%), Gaps = 188/1041 (18%)

Query: 149  LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
            ++I ++ +  FK+Y  + ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1    MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 209  LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPK---LVISRKAFKNNS 262
               LIH+      + S SV++ F      HD   +I   S   P+    V  R+      
Sbjct: 61   RQGLIHQGS--GSVMSASVEIVF------HDPSHRIILPSGIPPRENDEVFVRRTVGLKK 112

Query: 263  SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
              Y +N +    +DV ++L+  G  + +   ++ QG +  +   K       D   L  L
Sbjct: 113  DDYQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLL 165

Query: 323  EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQ 382
            E+++G   ++  +        SL ++   ++ R +I    +  +   K +  E  E E+ 
Sbjct: 166  EEVVGAKSFEVKLRA------SLKKMDETEKKRAQIAQEMEELVGKLKEMEEEQKELERY 219

Query: 383  LTLSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQL----- 436
             +L ++ K+ Q+ L+  + +L + + +I  L+ +YN     +     E+++ +++     
Sbjct: 220  NSLERNRKVFQFTLY--DRELNDVINQIERLDGDYNATVHSSGDYIKELDQREEMISQVS 277

Query: 437  --LNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTIS 494
              L + +S +K+ E  E QQ K K      +  L  +L NL  K              I+
Sbjct: 278  KELQQLESSLKIKESTELQQSKDK------NSELSTELANLNVK--------------IT 317

Query: 495  SLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE---KTSGIS---EEILI 548
             L S+IQ  ++  K     L+ +N+ +Q  +  LE ++ + +E   + +G+     E+  
Sbjct: 318  DLESQIQLHDEQVKIDETNLQIINEAVQQNQRQLEKVEPRFQELNKEETGLKLKLAELRE 377

Query: 549  HEHDL-----EPWNIKVQEKK-----TEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQ 598
             E DL     +  + + +E++      EI+ + +++  L+E    +K ++++   E+ N+
Sbjct: 378  RERDLLLKKGKYADFRTKEERDSWVEQEIKDLRNKLDNLKE----VKQNVELERSEIRNK 433

Query: 599  TALKIKREEDLVNLKKQQSSITKEISNGETECNDGR----SKLKEMKNVLNMQRQ----- 649
             A  I  + D +    Q      E+++ +TE N+ +     K+ E K +   +++     
Sbjct: 434  LA-AIDEQIDELTDSIQGPGALAELNDLDTELNNTKHLYGQKIDERKELWRTEQRLQSLL 492

Query: 650  -------RASEARLA------LANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNT 696
                   + SE  +       LAN     K +    KL   G + G    LG+L  +++ 
Sbjct: 493  EATTNDVKRSEGEVTETMSRDLANGIKSVKEIAEKLKL-PDGCVFG---TLGELIKVNDK 548

Query: 697  Y-DVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKN 755
            Y   A       L  IVV+T E     I+ L + K G   F+ L+++ S + N    P  
Sbjct: 549  YKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRVYS-DPNITYPPNE 607

Query: 756  VPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLID 811
                  LIK    D++F  A   V   T+V +DL    R+A   +R+R+  +TLDG   D
Sbjct: 608  QASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRFRLNAITLDGDRAD 664

Query: 812  VSGTMSGGGNHVSKGLMM-LQRKGQNYFDDYNP--EDVEQIEKDLSDKEKNFELANNAFY 868
              G ++GG +   K   + L +K ++    Y     ++E + + + D + + +  N    
Sbjct: 665  KKGALTGGYHDQHKKTRLDLLKKLKDSRSQYKSLVSELELMRQKIQDIDASIDTVNGTTR 724

Query: 869  EMENELQ-----------KLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDN 917
             + N+ +           KLNN+K E      KI +E    +  +K+++ +    TNI  
Sbjct: 725  SLSNKRETILTNMDSWRAKLNNKKTE------KIFLEESMQALIVKAEKTE----TNIRV 774

Query: 918  SELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVT 977
            SE    E++   +E L +  +  L     ++AK+ ++ +LK  I+ I   +L + +  + 
Sbjct: 775  SE----EKISTYLEELSQDFDNEL-----SRAKQAELENLKSSILDIQN-KLYMTSEALE 824

Query: 978  SIVQRIDILTAK-------QKKDRTSK-----------KKSDTELEKAKKTLL-----TS 1014
             +   ID L A        Q+K+  +K            KS+ +     KT L      S
Sbjct: 825  GLTNNIDSLNATLNSKLIPQQKELKAKLAETGDSFIAGLKSEVQSMLIVKTTLDNQLEIS 884

Query: 1015 KNDITLITDDIKEISER-------IDKISSSLNNIDKSIEEFQ-------AHKETLKDEC 1060
              +++ I ++IK +SER       ++K +S   ++ K +E FQ         K TL    
Sbjct: 885  NEELSGIQEEIKNMSERKKNSEKSLEKANSQQASLLKKLETFQKDAEKSMVKKTTLAARR 944

Query: 1061 DELKDKVVDL----EENINEF 1077
            +EL+ K+ ++    EE +N F
Sbjct: 945  EELQQKIREVGLLAEEALNSF 965

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 1285 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1342
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1343 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENR 1390
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +   + K EN+
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRV-KYENK 1202

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score = 89.0 bits (219), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 167/725 (23%), Positives = 311/725 (42%), Gaps = 104/725 (14%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVIS--------RKAFKN 260
              LIH+      + S SV++ F      HD D   S   P  V+S        R+    
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPDH--SMILPSGVLSRGDDEVTIRRTVGL 111

Query: 261 NSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 320
               Y +N +     D+ ++L+  G  +++   ++ QG++  +   K K         L+
Sbjct: 112 KKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQ 164

Query: 321 YLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEF---- 376
            LED++G   ++  ++  L ++E        ++ +F+I ++E + L S K   +E     
Sbjct: 165 LLEDVVGAKSFEVKLKASLKKMEET------EQKKFQI-NKEMDELNS-KLTEMEQERKE 216

Query: 377 LEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQL 436
           LEK  +L   K K+ QY L+  + +L + + ++  L+ +YN     ++    E+++ + +
Sbjct: 217 LEKYNELE-RKRKIYQYTLY--DRELNDVINQMERLDGDYNNTVYSSEQYIQELDKREDM 273

Query: 437 LNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEK------------ 484
           + +   K+  +E   K  +K+   L+   +   E  +NLT    K ++            
Sbjct: 274 IEQVSKKLSNIEASLK--IKNTTDLQQAKLRESETSQNLTDVNVKIKEVELQIESNSEQR 331

Query: 485 ------------IIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMK 532
                       II   +K +S +    QEL K +  Y  +L +L Q+ +        + 
Sbjct: 332 SLDSTTLEEIKSIIRQRKKKLSKILPRYQELTKEEAMYKLQLASLQQKQRD-------LI 384

Query: 533 LKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLS 592
           LK  E     S+E    E D   ++ +++E K+ +Q +  Q + LQ  +  LK     + 
Sbjct: 385 LKKGEYARFKSKE----ERDAWIYS-EIEELKSSVQNLNEQGNKLQTERASLKEQYSKID 439

Query: 593 QEVS------NQTALKIKREE---DLVNLKKQQSS---ITKEISNGETECNDGRSKLKEM 640
            E+       N   +K + E+   +L+NLK++ +      KE+   E +       L  +
Sbjct: 440 GEIEELIDSVNGPDIKGQLEDFDSELINLKQKLNGSLDTRKELWRKEQKLQTVLETL--L 497

Query: 641 KNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVA 700
            +V   QR        +LAN     K +T   K+          G LG+L  +++ Y   
Sbjct: 498 SDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPE----SVFGTLGELIKVNDKYKAC 553

Query: 701 VST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR-----SFNTNTIQTPK 754
                   L  +VV+T E     +  L + K G   FI L++L       F +NT    +
Sbjct: 554 AEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPSNTTTQIQ 613

Query: 755 NVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSG 814
             P L   IK +  +F  A   V   T+V KDL Q  ++A  + +   +TLDG   D  G
Sbjct: 614 FTP-LIKKIKYQ-PRFEKAVKHVFGRTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRG 670

Query: 815 TMSGG 819
            ++GG
Sbjct: 671 VLTGG 675

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 66/116 (56%), Gaps = 3/116 (2%)

Query: 1287 DPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1344
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1345 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            D +  + VA  IKE +KNAQFI  + R +M ++A +   + K EN+  +    NRE
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNRE 1214

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
           complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 88.6 bits (218), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 169/752 (22%), Positives = 302/752 (40%), Gaps = 161/752 (21%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I+++ +  FK+Y  + V+  F  +++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
              LIH+      + S SV++ F          + +   +   +  R+        Y +N
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVN 118

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
            +    +DV ++L+  G  + +   ++ QG +  +   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLEDVVGA 171

Query: 329 SKYKQLIEKDLIEIES-------LNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEK 381
             ++  +   L +++        ++E   E   +   ++ E+  LE  K  ALE      
Sbjct: 172 KSFESKLRASLKKMDETEQKRKKISEEMSELNKKLGDMEEERKELE--KFNALE------ 223

Query: 382 QLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEY-NVEKSKNQTLQNEINRTKQLLNE- 439
                K K+LQ+ L+  + ++ + + +I  L+ EY N+  S  + LQ ++N+ + ++ E 
Sbjct: 224 ----GKRKVLQFTLY--DREINDIINQIEGLDSEYNNILASSEEYLQ-QLNKRETVVEEM 276

Query: 440 -------------------SQSKIKVLE---GEEKQQLKSKRI-----LEGEHVSLDEKL 472
                               QSKIK  E   G    Q+K K I      + E   +DE  
Sbjct: 277 TTILQDIDASLKLKGTTELQQSKIKYQELSNGLVDSQVKMKEIKSQLDSQTEQSKIDE-- 334

Query: 473 KNLTQKKAKTEKIIATTEKTISSLTSEI----QELEKSQKEYSDELETLNQQ-------- 520
           KNL        KIIA   K   S   +I    ++L + + +Y +EL  L Q+        
Sbjct: 335 KNL--------KIIAEAIKEKQSELGKILPRYEQLNQDEAKYKNELFDLKQKQKELMLKR 386

Query: 521 ----------------------LQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNI 558
                                 LQ E  +LE  K+ L E+ + I EE+  +E  ++    
Sbjct: 387 GSYARFKTKEERNEWIHSEIEDLQEELTNLETTKITLAERRNEIQEELKTYEEQIDELLD 446

Query: 559 KVQEK--KTEIQLVESQISLLQEGQVKLKNDIKVLS------QEVSNQTALKIKREEDLV 610
            VQ      E++ ++S+I  L+       ++ K L       Q V    A  +KR E  V
Sbjct: 447 SVQGPGVSAELEDLKSEIESLKSSYADKFDERKELWRTEQKLQTVLENMADSVKRSERAV 506

Query: 611 NLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTA 670
           N      S+++ ++N       G + +KE+   LN+                        
Sbjct: 507 N-----ESMSRSLAN-------GIASVKEITEKLNLPDD--------------------- 533

Query: 671 LYKLQKSGRIVGFHGRLGDLGTIDNTYD-VAVSTACPRLDDIVVETVECGQQCIEYLRKN 729
                         G LG+L  +   Y   A       L ++VV+T E     +  L   
Sbjct: 534 -----------AVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHM 582

Query: 730 KLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIK--PKDSKFVPAFYSVLRDTLVAKDL 787
           K G   F+ L+++   N N    P        LIK    D ++  A   +   T+V KDL
Sbjct: 583 KGGRVTFMPLNRIHVDN-NITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKDL 641

Query: 788 KQANRVAYGQRRYRVVTLDGKLIDVSGTMSGG 819
            + +++A  + +   VTLDG   D  G ++GG
Sbjct: 642 LEGSKIA-KKLKLNAVTLDGDRADKMGVLTGG 672

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 116/231 (50%), Gaps = 24/231 (10%)

Query: 1196 SDLEKYIESTDANIEVLEEYVKRLTE----FKTRKLDLNDAV----DKRETVRKQLEELK 1247
            SDL + + S +  +  L    KR +E    F  +K++LN+      D + +++  +E+LK
Sbjct: 971  SDLFQELNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKVSIQNLIEKLK 1030

Query: 1248 KTRYEEFMHGFGIISMTLKEMYQMITMGGNAELEL------------VDSLDPFSEGVTF 1295
            + +       F  +S     +++ +   G A+L +             +S +    G++ 
Sbjct: 1031 QQKVTAVDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNSTESIYSGISI 1090

Query: 1296 SVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1353
            SV     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA
Sbjct: 1091 SVSFNSKKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRAAVA 1150

Query: 1354 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT-IKNREILN 1403
            + IK  + NAQFI  + R +M ++A +   + K EN+  +   ++ +E +N
Sbjct: 1151 DVIKSLSGNAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEVERQEAIN 1200

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 218/997 (21%), Positives = 427/997 (42%), Gaps = 185/997 (18%)

Query: 149  LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
            ++I  + +  FK+Y     V      F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1    MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 209  LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
               LIH+      + S  V++ F     +    + I  T+  +V  R+       +Y +N
Sbjct: 61   RQGLIHQGT--GSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSVN 118

Query: 269  GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
            GK  + +D++++ +  G    +   ++ QG +  +   K       D   L  LE+++G 
Sbjct: 119  GKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEEVVGA 171

Query: 329  SKYKQLIEKDLIEIESLN--------EICIEKENRFEIVDREKNSLESGKNLALEFLEKE 380
              ++  + +   ++E+ N        E+  E   R + ++ E+  LE  +      LE++
Sbjct: 172  KSFEIKLRESAKKMEATNRDRTRIDSELA-ELRTRLDELNEERQELEKYQK-----LERD 225

Query: 381  KQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN-VEKSKNQTLQNEINRTKQLLNE 439
            +       ++ Q+ L+  + +L     +I +L +EYN V +S  + LQ E+ + ++L+  
Sbjct: 226  R-------RIFQFVLY--DRELNEVTSQIESLEDEYNHVLQSSEEFLQ-ELYKREELIEN 275

Query: 440  SQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSE 499
                I  +E E    L+ K        S+D     L Q+K                  S 
Sbjct: 276  VTKNISNIETE----LRVKE-------SMD-----LQQEK------------------SR 301

Query: 500  IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
            +QE+ K + +    LE   +Q ++ ++     +  LK     + EEI      LE    +
Sbjct: 302  LQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQNNLK----TVEEEIEKKSLQLERLIPR 357

Query: 560  VQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVN-------- 611
             ++ K+E Q  ESQ+S  Q  Q ++     V  + +  Q   K++R+E L N        
Sbjct: 358  FEQLKSESQEFESQLSNYQRSQREI-----VSKRGIYAQFKSKVERDEWLKNEIASLKAQ 412

Query: 612  ---LKKQQSSITK---------EISNGE-TECNDG------RSKLKEMKNVLNMQRQ--- 649
               L +Q +++T+         E+ N E TE ND       +++L+++++ L+  +Q   
Sbjct: 413  HQDLAEQLAALTREKEQTGSEVEVFNEEITELNDSVRGPGIQAELQDLQSHLDSLKQSYL 472

Query: 650  ----------RASEARLALANVQNRG-----------------KVLTALYKLQKSGRIVG 682
                      RA +  L +++  N G                   L A+ ++ +  ++  
Sbjct: 473  GKIDERKELWRAEQKFLTVSDALNDGVKRSERNLSETMDRGLASGLRAVREISERLKLPA 532

Query: 683  --FHGRLGDLGTIDNTYD-VAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILL 739
               HG LG+L  ++  Y   A +     L  +VV+T E     +E L   K G   FI L
Sbjct: 533  DSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPL 592

Query: 740  DKLRSFNTNTIQTPKN-----VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVA 794
            +++   ++N +  P N      P ++ +   K  +F  A   V   T+V +D+   +++A
Sbjct: 593  NRI--ADSNPVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGTGSKLA 648

Query: 795  YGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLS 854
                    VTLDG   D  G ++GG +   K         +N  D    +++   ++ L 
Sbjct: 649  KS-FNLDAVTLDGDRTDKRGLITGGYHDYHK---------RNRLDCL--KEMSAAKRQLL 696

Query: 855  DKEKNFELANNAFYEMENELQKLNNRKPEIELEISK---IIMEIDTYSAEI--KSKERQL 909
            +  KN + A      ++ E+ ++N+   EI+ + S+   I+  I+   A++  K+ ER L
Sbjct: 697  EATKNLDAARGQITAIDTEIDQIND---EIKTQSSRKEAILSNIENMRAKLNKKTAERAL 753

Query: 910  QEKTNIDN---------SELQDNEELKVAIE-NLQKLKEEHLALQDKTKAKKKKIASLKE 959
            + K  +D+         + L+ NEE     E +L K  E+ L+ +++   K     SL +
Sbjct: 754  K-KEILDSITTKHARMETSLKLNEEKTERFETDLNKPFEKGLSDEEEQTLK-----SLAD 807

Query: 960  KIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKK--SDTELEKAKKTLLTSKND 1017
            K M+     L V    +  +  +ID+L A+       +KK   D   + +    L S  +
Sbjct: 808  K-MRAVSEPLSVTADALNELTLKIDLLKAELGVKLVPQKKEIEDRISQASGSKRLASSEE 866

Query: 1018 ITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKE 1054
            ++ I+ ++++++ R  ++ +SL  I  +I      KE
Sbjct: 867  LSQISTELEKLASREHELQTSLQGISDNIASLNEEKE 903

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 2/97 (2%)

Query: 1284 DSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1342 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1378
            AALD +  + VAN IKE + +AQFI  + R++M ++A
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVA 1188

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1290 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMF 1375
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 111/505 (21%), Positives = 217/505 (42%), Gaps = 84/505 (16%)

Query: 680  IVGFHGRLGDLGTIDNTYDVAVS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARF 736
            + G   +L  L   ++ YD A +    A  RL ++VV+      Q +E  R  K      
Sbjct: 523  VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 737  ILLDKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQ 789
            I L+++  R+ N+ T+Q      P  V    +L+  ++ +   A   +  ++L+ KD + 
Sbjct: 579  IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEE-EVSRAMEFIFGNSLICKDAET 637

Query: 790  ANRVAYG-QRRYRVVTLDGKLIDVSGTMSGGG-NHVSKGLMMLQRKGQNYFDDYN--PED 845
            A ++ +  Q R R +TL G + D  GT+SGG  N+ S  L+ +Q+        YN   + 
Sbjct: 638  AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLIDVQK--------YNKTAKR 689

Query: 846  VEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISK--------------- 890
            +E++E  L    ++ E       E E++LQK  + + ++ L   K               
Sbjct: 690  IEELELKLKSITRDLE-------EQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQAAH 742

Query: 891  -------IIMEIDTYSAEIKSK-------ERQLQE-KTNIDNSELQDNEELKVAIENLQK 935
                   +I EID    EI SK       E+++Q  +T+I         +LK   + + K
Sbjct: 743  IIRKNEELIKEIDESQKEIASKRSSISDCEKEIQRIQTDIQEFSTDKGSKLKQLKDEVSK 802

Query: 936  LKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRT 995
            L +E   L+ K ++K     + +    ++ G E+   N  V  + +    L  +++    
Sbjct: 803  LFKEIGILETKVESKYDSYQTFQLDTEQLAG-EIASGNDTVKQLSELQQTLEGERRSLEE 861

Query: 996  SKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKET 1055
            +   + TEL+  +  L   ++ +  I +++KE+   I   + + NN +  +++       
Sbjct: 862  NLGMNQTELDNVQVELKAEQSRLVDINEELKELDTVIKTKTEAKNNYELELQKLSNDLNK 921

Query: 1056 LKDECDELKDKVVDLEENINEFKSFEI---------EVNNKLEKLNGLLNHIKNQIKTLE 1106
             K+    + +K+  LE+  +  K   +         EVN  LE++   + H++ Q + + 
Sbjct: 922  FKNNSSSIYEKISSLEQEHDWLKDGALVAGIIQQSGEVN--LEQMKKRVEHLQKQFQDMR 979

Query: 1107 DSLSKLTLRKMHQVLMALDEESEAK 1131
                    RK++  +M++ E  E K
Sbjct: 980  --------RKVNPNIMSMIESVEKK 996

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1174

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 20/154 (12%)

Query: 1229 LNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDP 1288
            LND   KRET+ K  E++ K    +F + FG              +  N+  +LV S   
Sbjct: 1025 LNDY--KRETLLKTWEKVTK----DFGNIFG-------------DLLPNSSAKLVPSEGK 1065

Query: 1289 -FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
              +EG+   V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  
Sbjct: 1066 DITEGLEVKVKLGNIWKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLS 1125

Query: 1348 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1381
            +   + + IK R K AQFIV+SL+  MF  A ++
Sbjct: 1126 HTQNIGHLIKTRFKGAQFIVVSLKEGMFTNANRV 1159

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 685 GRLGDLGTI-DNTYDVAVS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 740
           G    L TI DN  + A +    A  RL ++VV+      Q +E  R  K      I L+
Sbjct: 529 GVAATLFTINDNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTIIPLN 586

Query: 741 KL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRV 793
           K+  R  N NT+       P  V    +LI   D +   A   +   +L+ KD + A +V
Sbjct: 587 KIASRRLNENTVNFAKQLAPGKVDLALNLIGYSD-ELSRAMEFIFGTSLICKDSETAKKV 645

Query: 794 AYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM 829
            + Q  R R +TL+G + D  GT+SGG  +    L++
Sbjct: 646 TFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLLL 682

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
            YFR031C
          Length = 1171

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 1281 ELVDSLDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1338
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1339 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   + K EN+  + 
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYENKISTV 1206

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
            SMC2Subunit of the condensin complex; essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase; Smc2p/Smc4p complex
            binds DNA; required for clustering of tRNA genes at the
            nucleolus
          Length = 1170

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  IKE + NAQFI  + R +M ++A +   + K EN+  +    NRE
Sbjct: 1166 TAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNRE 1215

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA+ IK  + NAQFI  + R +M ++A +   + K EN+  +    NR+
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEINRD 1201

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1288 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1346 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394
             +    VA  I + + NAQFI  + R++M + A +   + K EN+  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 8/140 (5%)

Query: 685 GRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743
           G +G+L  ++  Y V         L  +VV+T E     +  L + K G   F+ L+KL+
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 744 SFNTNTIQTPK--NVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRR 799
           + N N I  P   N+P    LIK    D +F      V    LV KDL     ++  Q +
Sbjct: 599 NGNQN-IDYPSDPNIP-CTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSIS-KQYK 655

Query: 800 YRVVTLDGKLIDVSGTMSGG 819
              +TLDG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 84/162 (51%), Gaps = 5/162 (3%)

Query: 1243 LEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1302
            ++ LK+ +       F  +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1303 S--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1361 KNA-QFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREI 1401
            +N  QFI+ + R++M E+A  ++ + K  N+  S    N+ I
Sbjct: 1071 QNGTQFILTTFRSDMIEIA-DMIYMVKYHNKVSSVYETNKTI 1111

 Score = 58.9 bits (141), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 682 GFHGRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 740
             +G LG+L  +   Y   V   A   L +I+V+T E   Q +  L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 741 KLRSFNTNTIQTPKN----VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYG 796
           ++   N   I  P N       L   IK  D KF     +V   T+V KDL+  NR+   
Sbjct: 520 RIE--NGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC-K 575

Query: 797 QRRYRVVTLDGKLIDVSGTMSGGGNHVSK 825
           + + + +TLDG  ID  G +SGG  ++++
Sbjct: 576 EFKLQAITLDGDRIDSKGVVSGGYFNINR 604

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 1284 DSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1342 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT 1395
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   + K EN+  +  
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV-KYENKISTVV 1205

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  IKE + +AQFI  + R +M ++A +   + K EN+  +    N+E
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNKE 1215

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1225

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 85/189 (44%), Gaps = 21/189 (11%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPKL---VISRKAFKNNS 262
              LIH+      + S SV++ F      HD D +I   S   P+    V  R+      
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF------HDPDHRIILSSGVIPRPNDEVFVRRTVGLKK 112

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y IN +    +D+ ++L+  G  +     ++ QG +  +   K K         L  L
Sbjct: 113 DDYQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLL 165

Query: 323 EDIIGTSKY 331
           ED+IG   +
Sbjct: 166 EDVIGAKSF 174

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
            Component of the condensin complex essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 11/122 (9%)

Query: 703 TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQT-----PKN 755
            A  RL ++VV+      Q +E  R  K      I L+K+  RS + N ++      P N
Sbjct: 547 CAGGRLFNVVVDNEGTASQLLERGRLRK--RVTIIPLNKISARSLHQNAVKAAKELAPGN 604

Query: 756 VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSG 814
           V    +LI  ++ +   A   +   +L+ +D + A +V +  R R R +TL G + D  G
Sbjct: 605 VELALNLIGYEE-EVSKAMEFIFGTSLICQDAETAKKVTFHPRVRARSITLQGDIYDPEG 663

Query: 815 TM 816
           T+
Sbjct: 664 TL 665

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 100/399 (25%), Positives = 172/399 (43%), Gaps = 50/399 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 210
           + +L L+NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 211 DLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNN--SSKYYIN 268
           D   K+       S  +DV   +   E  G T        L +SR   +N+  +S YY++
Sbjct: 115 DSFIKN----GADSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 269 GKESNYTDVTKLLK-EEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           G E++   V +L+  +  I LD+    + Q  V+  A+++P       D LL  LE +  
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP-------DKLL--LETVRA 210

Query: 328 TSK-----YKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQ 382
             +     + QL +     I    E+ +E+E         ++S   G   AL   E  ++
Sbjct: 211 CDRQLLDCWTQLAQLQREHISLDKEVQLERETSRTSPRSRQDS--EGAVSALRTYENTRK 268

Query: 383 LTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS 442
             ++ ++LL Y      +++      ++    EY V K + Q L N+    +QLL ES +
Sbjct: 269 QIMTHNQLLPY------AQIKEHKASLTRYKTEYQVAKRQLQALLNDKKPFQQLL-ESLA 321

Query: 443 KIKVLE--GEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEI 500
                E     K+ L   RI   E   L  +L  L      T   +A       ++ +EI
Sbjct: 322 SGSTQEDRAAAKESLTRARIALQE---LAVQLALLRDNTRDTGTQVAVYRNRTHTIAAEI 378

Query: 501 QELEKSQKEYSDELETLNQQL--QSERESLEAMKLKLKE 537
            ELE + ++   EL    +++  Q   + L A K +L E
Sbjct: 379 TELETAAEQQQAELVVAKEKIPPQPAVDELTAQKAQLFE 417

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 46/175 (26%)

Query: 1200 KYIESTDANIEVLEEYVKRLTEFKTR------KLDLNDAVDKRETVRKQLEELKKTRYEE 1253
            + I   +++I +L+E  ++L + K R      KLD   A     T++ +LE    T  E+
Sbjct: 894  RMINHDESSIAILQEVERKLADVKARLPAMVRKLDA--ATASMSTMQAELEPRLDTIVEK 951

Query: 1254 FMHGF----------GIISMTLKEMYQ------MITMGGNAELELVDSLDPFSEGVTFSV 1297
                F          G I ++   +YQ      M+    NA L+ +DS            
Sbjct: 952  ISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS------------ 999

Query: 1298 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1352
                         SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 ----------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 55.8 bits (133), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 102/414 (24%), Positives = 185/414 (44%), Gaps = 56/414 (13%)

Query: 151 INKLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I K+ L NF +YA    +  FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 208 RLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNN-SSKYY 266
           R+ D I   E       C +++  L    +  G   +  +   + I+R   ++   S Y+
Sbjct: 104 RVEDFIKNGE-----DECEIEIT-LKNNSKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
           IN + ++   V  ++ +  I LD+    + Q  VE  A++K      SD  L E +    
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK------SDKLLFETIRS-- 209

Query: 327 GTSKYKQLIEKDLIEI-ESLNEICIE----------KENRFEIVDREKNSLESGKNLALE 375
                   I+ DLI + E L E+  E          K+ R + +  EK  LE+   +  E
Sbjct: 210 --------IDTDLITVLEELKELQGEELAEEKEVSFKQQRLQELTAEKERLETSVRVLEE 261

Query: 376 FLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEY-NVEKSKNQTLQNE---IN 431
           F  K+ QL + K KLL Y       K+ +  +KI A  + Y + +++    LQ++    +
Sbjct: 262 FQRKKDQLEIHK-KLLPY------VKIKDHKEKIRASKKCYEDAKRNLKALLQDKKPFSH 314

Query: 432 RTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEK 491
             +QL   ++  ++    +E++  +++   +   VSL EK++   QK +     I     
Sbjct: 315 AKRQLERATEDALESKNNKEREYRENQVKFKSIPVSL-EKIREEIQKNSAQ---INYYRG 370

Query: 492 TISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEE 545
             + L   I+ELE   +   ++L  L +  Q E +S++  + KL ++  G +E+
Sbjct: 371 RSAKLKQGIEELESQLENQREDLNGLKEPEQGEFDSIDTERTKLSDELQGYTEQ 424

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1368 IS 1369
            I+
Sbjct: 1054 IT 1055

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 133/289 (46%), Gaps = 40/289 (13%)

Query: 153 KLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 209
           KL L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 62  KLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 210 SDLIHKS--EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
            + I     E   ++T  +         +  + D  +   K  L + +K      SKYYI
Sbjct: 118 EEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHVKRVLSMEKK-----KSKYYI 172

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           N K      V  +++   I LD+    + Q  VE  A++KP      D  L E +  I  
Sbjct: 173 NNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP------DTLLNETIRSIEA 226

Query: 328 TSKYKQLIEKDLIEIESL----NEICIE---KENRFEIVDREKNSLESGKNLALEFLEKE 380
                 L+EK L E++SL    NE+ I+   KEN+ + +   + +LES  +    + EK 
Sbjct: 227 G-----LLEK-LSELKSLQAEGNELQIDLGAKENKLKELTSSRAALESQAHALELYEEKA 280

Query: 381 KQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNE 429
           ++L + + KLL Y   + +       +KI  L ++ N  +++ +T++NE
Sbjct: 281 RELDIHQ-KLLNYTYLKEHK------EKIRGLKDKRNALRNEVKTMENE 322

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL--------SG 1312
            IS     ++  +   G  EL+  DS + +        +  K  +R+ S L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1313 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1367
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1368 ISLRNNMF 1375
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 75/161 (46%), Gaps = 16/161 (9%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I  L L NF +YA    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 208 RLSDLIHKSEKFPDL-TSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
           ++ D I   E    +  +   D E        DG TK++     L  +RKA     S+Y+
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVASDGTTKVTRV---LHRNRKA-----SEYF 154

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           +NG+    + V +L+ E  I LD+    + Q  VE  A++K
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1368 IS 1369
            ++
Sbjct: 1049 VT 1050

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 177/389 (45%), Gaps = 71/389 (18%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 209 LSDLIHKSEKFPDLTSCSV---------DVEFLYAIDEHDGDTKISETKPKLVISRKAFK 259
           + D I   +   D +   +         D+EF   I+ HD   K++      +I+R   +
Sbjct: 99  VEDFIKNGQ---DTSRIEITLKNSPKIHDIEF---INTHDETIKVTR-----IITRSKRR 147

Query: 260 NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKES 314
              S Y IN ++ +   V  L+ +  I LD+    + Q  VE  A++K      +  +  
Sbjct: 148 ---SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSI 204

Query: 315 DDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLAL 374
           D  LL+ L++++     +Q ++KDL +++ L  + + +E+     D+ + S+ES +    
Sbjct: 205 DASLLDVLDELMELQANEQSLQKDL-DVKKLKVVHLRQES-----DKLRKSVESLR---- 254

Query: 375 EFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTL---QNEIN 431
           +F +K+ ++ L  S+LL Y       K+ +  +K++   EEY   KS  + L   +    
Sbjct: 255 DFQKKKGEIELH-SQLLPY------VKVKDHKEKLNTYKEEYERAKSNLRALLKDKKPFA 307

Query: 432 RTKQLLNESQSKIKVLEGEEKQQLKS----------KRILEGEHVSLDEKLKNLTQK--- 478
            TK+ L       +V E  EK  LK+            I E  ++  D+ +K  TQ    
Sbjct: 308 NTKKTLEN-----RVHELTEKCSLKNDEFVKAKEKVNEIFERLNIIRDDVIKKKTQNEYY 362

Query: 479 KAKTEKIIATTEKTISSLTSEIQELEKSQ 507
           + +T+K+ AT   T   L    + LE++Q
Sbjct: 363 RGRTKKLQATIISTKEDLVRNQEILEQTQ 391

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 IS 1369
            I+
Sbjct: 1047 IT 1048

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 80/188 (42%), Gaps = 41/188 (21%)

Query: 151 INKLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I KL L NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 208 RLSDLIHKSE----------KFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKA 257
           R+   I   E          + P  T   V V         DG TK+S     L + +K 
Sbjct: 125 RVDSFIKNGENRGLIEVTLKRDPGRTGSFVAV---------DGTTKVSRV---LWVGKK- 171

Query: 258 FKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDG 317
                S+YY+N +  +   V  L+ E  I LD+    + Q  VE  A++K      SD  
Sbjct: 172 -----SEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKL 220

Query: 318 LLEYLEDI 325
           L+E +  +
Sbjct: 221 LMETVRSV 228

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1368 IS 1369
            ++
Sbjct: 1072 VT 1073

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar
           to Ashbya gossypii AEL337
          Length = 1097

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 102/407 (25%), Positives = 184/407 (45%), Gaps = 60/407 (14%)

Query: 151 INKLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I KL L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 208 RLSDLIHKS--EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
           ++ D I     E   +LT  +      Y++    G  ++   K  ++ ++K        Y
Sbjct: 102 KVEDFIKNGTEESVIELTVKNSKAVSGYSM--IGGSDEVINIKTVIMKAKK-----KCIY 154

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
           YING+      V  L+    I LD+    + Q  VE  A++K      SD  L E +  I
Sbjct: 155 YINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK------SDKLLEETIRSI 208

Query: 326 IGTSKYKQLIEK-DLIEIESLNEICIEKE-----NRFEIVDREKNSLESGKNLALEFLEK 379
             T     L+EK D+++ +   E+ I ++     ++ E +   K SLES      E+  K
Sbjct: 209 DST-----LVEKLDMLKDKQQEEVTIGRDVELNKSKLEKLIIRKESLESQVRALEEYERK 263

Query: 380 EKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTK----- 434
           + ++ + K KLL Y   +N+    N L+K+         E+SK Q L++ +   K     
Sbjct: 264 KNEIDIHK-KLLPYVRVKNHKLQLNNLKKV--------YEQSK-QELKDFLKDKKPFKVA 313

Query: 435 ----QLLNESQSKIKVLEGEEKQQLKS--KRILE---GEHVSLDEKLKNLTQKKAKTEKI 485
               QLL++    +K ++ EE   LK+  K+++E    + +S+ +  K ++  +++ E +
Sbjct: 314 SEKLQLLSDESEGLKKIKEEEYNSLKTNHKKLIETLSNQRISIQDLKKKISYYRSRRENM 373

Query: 486 ---IATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLE 529
              +   E+ ISS    ++ L    +E  D+ E    QL  +   +E
Sbjct: 374 RRKVEMAEQDISSRNKLLETLMLPSQEVMDDYERRRVQLYEKESDIE 420

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 103/204 (50%), Gaps = 25/204 (12%)

Query: 1180 DDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETV 1239
            +DE S    T++ET ++ LE  I+  + +   ++   + L++ K  +  L   V +  ++
Sbjct: 861  EDESSFTLTTVLET-IAKLETEIQIINHDESAIKILKQTLSDIKYLQEKLPGQVKRLSSI 919

Query: 1240 RKQLEELK---KTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1296
            R+++  ++   + R +E +     IS   ++++  + +G   E+ LV   D +SE     
Sbjct: 920  RRKMWSIRSELEPRLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK--- 970

Query: 1297 VMPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1348
             +  K  +R+++ L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN
Sbjct: 971  -IEIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARN 1029

Query: 1349 VSIVANYIKER--TKN-AQFIVIS 1369
              IV   + E    KN +Q+ +I+
Sbjct: 1030 ERIVHKAMVENACAKNTSQYFLIT 1053

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1288 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1348 NVSIVANYIKERTKN---AQFIVIS 1369
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] {ON}
            some similarities with uniprot|P38853 Saccharomyces
            cerevisiae YHR158c KEL1 involved in cell fusion and
            morphology
          Length = 1136

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 151/305 (49%), Gaps = 55/305 (18%)

Query: 844  EDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIK 903
            ED +++E ++S   K ++L +  + EME+ LQ       + E  ++  +++ + ++  IK
Sbjct: 851  EDNKKMEDEISQFRKRYDLLDADYKEMEDTLQ-------QYEDILAAKVLDAEKFNGIIK 903

Query: 904  SKERQLQE-KTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIM 962
             +  ++ E K ++ NSE  + E+LK+  E L+K   E+  L+DK K K   +   K  +M
Sbjct: 904  VQSDKIDELKLHVVNSE--EFEKLKIQNEVLEK---ENQDLKDKLKEKDNNLD--KSIVM 956

Query: 963  KIGGIELQVQNSKVTS--------------------------IVQRIDILTAKQKKDRTS 996
              G ++  ++N ++TS                          +  R+D L  K K+   S
Sbjct: 957  FSGTVDELLKNWRMTSKKDTSSASPVAATQSQSTKNRNIISKMNNRLDDLLVKSKELTES 1016

Query: 997  KKKSDTELEK--AKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKE 1054
            +++ D+E E+   K   + S+   + I+     + E    I++++N   + IE+++AH E
Sbjct: 1017 EEQIDSEYEQLEIKNESIQSQARHSSIS-----VKETASDIANAMNESKRKIEDYKAHTE 1071

Query: 1055 TLKDECDELKDKV------VDLEENINEFKSFEIE-VNNKLEKLNGLLNHIKNQIKTLED 1107
             L++E D LK KV      + L++   E    EIE +  + E+LN  +  +K +I++  D
Sbjct: 1072 KLQNEIDGLKGKVNHTDGEISLDKQSEEKLREEIEKITAEKEELNRQMQGLKMKIQSSSD 1131

Query: 1108 SLSKL 1112
            +L+ L
Sbjct: 1132 NLAIL 1136

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 91/197 (46%), Gaps = 31/197 (15%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I KL L N  +Y+  +  + P   S + +VGPNGSGKS  + ++      +   + R  +
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
           + + I   E      +  +D  FL     H  +  I  T+   +++R   K   S+YYI+
Sbjct: 94  IDNFIKNGE-----NTAQIDT-FLRG---HMPNEVIKITR---IMTRNKKK---SEYYID 138

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLLEYLE 323
              S  T V KL  E  I LD+    + Q  VE+ A++K      +  +  +  LLE LE
Sbjct: 139 DSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETLE 198

Query: 324 DIIGTSKYKQLIEKDLI 340
           D+      KQL  K+++
Sbjct: 199 DL------KQLQTKEIV 209

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1368 IS 1369
            I+
Sbjct: 1035 IT 1036

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1295 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1354
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1355 YIKERTKN---AQFIVIS 1369
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 207
           +I K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 208 RLSDLI 213
            L DLI
Sbjct: 131 SLKDLI 136

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 92/201 (45%), Gaps = 29/201 (14%)

Query: 1186 LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLND----AVDKRETVRK 1241
             ++  VE  V+ LE  I+ ++ +       V  L + K +  DL D     V K  T+RK
Sbjct: 873  FNLIYVEQIVNKLESKIQLSNHD----RSAVALLEQTKAKIADLEDKLPTQVRKCNTIRK 928

Query: 1242 QLEELKKT---RYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1298
            ++ + +K    R E  + G G       E+++ +   G   L     L  FS+     +M
Sbjct: 929  EMSDKQKVLEPRLESIVSGIG---RKFSELFKDVGTAGGVTLNRKSKL--FSDW-KLEIM 982

Query: 1299 PPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD--FRNV-- 1349
               +    +S L     SGGE+ +S++  + AL K+   P  V+DEI+  +D  F  +  
Sbjct: 983  VQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVH 1042

Query: 1350 -SIVANYIKERTKNAQFIVIS 1369
             ++V N  +E T  +Q+ +I+
Sbjct: 1043 KAMVQNACEEGT--SQYFLIT 1061

 Score = 39.7 bits (91), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 111/477 (23%), Positives = 214/477 (44%), Gaps = 63/477 (13%)

Query: 123 LSPVKNNRIKLREL-YDAHNSQSKKERLFINKLTLNNFKSYAGQQV-VGPFHTSFSAVVG 180
           L+P +  R+K++ + YD     S      I K+ L NF +Y   +  + P   S + ++G
Sbjct: 16  LTPSRK-RLKIKPVDYDVFKPGS------IVKIRLENFVTYNYTEFNLSP---SLNMIIG 65

Query: 181 PNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEKFPDLTSC-----SVDVEFL-- 232
           PNGSGKS  + ++      +   + R  ++ D I   +    +        ++D+EFL  
Sbjct: 66  PNGSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNGQDTSKIEIVLKDDPNIDIEFLGS 125

Query: 233 -YAIDEHDGDTK-----ISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGI 286
            +    ++G+ K         + +  I R   K  + +Y ING  +  ++V  L+ +  I
Sbjct: 126 SFHRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHI 185

Query: 287 DLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLN 346
            LD+    + Q  VE  A+++P  EK  D+ +     +++  S ++ L +  L EIE  N
Sbjct: 186 QLDNLCQFLSQERVEEFAKLRP--EKLLDETIRAIDSELL--SMFEVLKKLQLQEIEMSN 241

Query: 347 EICIEKENRFEIVDREKNSLESGKNL-----ALEFLEKEKQLTLSKSKLLQYNLWQNNSK 401
           EI    ++  ++   E+N  +  + L      L+ L+K K       KLL Y       K
Sbjct: 242 EIQTNTDSLKKLKTDEENFQQEVQLLNEYQETLDTLDKHK-------KLLPY------LK 288

Query: 402 LTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLL---NESQSKIKV-LEGEEKQQLKS 457
           + +  +K+     +    K + Q  Q E     Q+L   NES +++ +  E  E++++ +
Sbjct: 289 IQDHREKLLTYKRQVEGAKKQLQEFQKEREPYMQVLASLNESDAQLNIEKENIEEKKVST 348

Query: 458 KRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETL 517
           KR LE     L+   + + +K  + E     + K    + ++ ++++  +++ SD +ET 
Sbjct: 349 KRKLEKTVSKLNALREEIEKKNLQIEYYKGRSNKLKIKIETKKEDIDNIKRKISD-IETP 407

Query: 518 NQQLQSERESLEAMKLKLKEKTSGISEEI-------LIHEHDLEPWNIKVQEKKTEI 567
            +   SE   LE  +  L E+ S ++ EI           H+L     K+ +KK+ +
Sbjct: 408 EE---SEVTELERKRNDLIERESQVNSEIDEVDTQMSTQNHNLAILERKMVDKKSSL 461

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 120/257 (46%), Gaps = 34/257 (13%)

Query: 174 SFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEKFPDLTSC---SVDV 229
           S + ++GPNGSGKS  + ++      +   + R  R+ D I   +    +      S  V
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFIKNGQDVSRIEITLKNSPKV 122

Query: 230 EFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLD 289
             +  ++ HD   KI+      +I+R   +   S Y IN  E + + V  L+ +  I LD
Sbjct: 123 NDIENVNAHDETIKITR-----IITRSKRR---SDYLINDCEVSESVVKALVAQLNIQLD 174

Query: 290 HKRFLILQGEVENIAQMKP-----KAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIES 344
           +    + Q  VE  A++K      +  +  D  LL+ L+++      +Q ++KDL +++ 
Sbjct: 175 NLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLDVLDELRELQGNEQCLQKDL-DVKK 233

Query: 345 LNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTN 404
              + + +E+     D+ + S+ES +    +F +K+ ++ L  S+LL Y       K+ +
Sbjct: 234 SKILHLRQES-----DKLRKSVESLR----DFQKKKGEIELH-SRLLPY------VKVKD 277

Query: 405 TLQKISALNEEYNVEKS 421
             +K++   EEY   K+
Sbjct: 278 HKEKLNVYKEEYERAKA 294

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 IS 1369
            I+
Sbjct: 1047 IT 1048

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 113/262 (43%), Gaps = 42/262 (16%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 38  IVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKR 94

Query: 209 LSDLIHKSEKF------------PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRK 256
           + D I   E              P     S++++F  A     G   +  T+   +I R 
Sbjct: 95  VDDFIKNGEDTSRIEIFLKNYEDPTELQSSLNLKFNLA-----GKDLLKVTR---LIQRD 146

Query: 257 AFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAE 311
             K  S  Y+IN K      +  L+K   I LD+    + Q  VE  A++K      +  
Sbjct: 147 GNKCKSD-YFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETV 205

Query: 312 KESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKN 371
           +  D  LL+ L+D+  +   +  +E         NE+ I K+ RF  ++ ++N LE+   
Sbjct: 206 RSIDAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEASVR 255

Query: 372 LALEFLEKEKQLTLSKSKLLQY 393
              EF   ++ + + K KLL Y
Sbjct: 256 SLKEFETMKEDIEIHK-KLLPY 276

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1368 IS 1369
            I+
Sbjct: 1050 IT 1051

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1297 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1357 KERTK---NAQFIVIS 1369
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           +I KLTL+NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 208 RLSDLI 213
            L DLI
Sbjct: 136 SLKDLI 141

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 27/154 (17%)

Query: 1243 LEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGN------------AELELVDSLD--P 1288
            L E  + +Y++    FG +   L+++   I +               A+L+   SL    
Sbjct: 922  LFEKSRDKYKDAEKKFGSVDRALRQLQHSIEVRSQNYTNIQNNTCLEADLDFRASLKVRK 981

Query: 1289 FSEGVTFSVMPPK----------KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1338
            F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A  K   + +  +D
Sbjct: 982  FTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLATWKPMRSRIIALD 1041

Query: 1339 EIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1369
            E D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1042 EFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 113/486 (23%), Positives = 208/486 (42%), Gaps = 59/486 (12%)

Query: 115 KRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERL---FINKLTLNNFKSYAGQQV-VGP 170
           KRR +   ++    N    +      +S S+K+ L   +I K+ L NF  +   ++ +GP
Sbjct: 37  KRRRQYAPMTQYNTNSAATQSASVNSDSNSRKDDLPCGYIKKVILRNFMCHEHFELDLGP 96

Query: 171 FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEKFPDLTSCSVDV 229
                + +VG NGSGKS V+ ++    G +A+   R + + DLI +         C    
Sbjct: 97  ---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNAMKDLIRE--------GCYSAK 145

Query: 230 EFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYI---NGKE--SNYTDVTKLLKEE 284
             L   + H G         +++I R     ++  Y +   NGKE  +   DV  ++   
Sbjct: 146 VTLVLDNSHAGPYNHGTFGDEIIIERTLRMESAPTYSLRTENGKEVSNKKKDVQTVVDFF 205

Query: 285 GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIES 344
            + + +    + Q    +        +K +       L++I  +    Q I+ D+++  +
Sbjct: 206 CVPVSNPMCFLSQDAARSFLTASTSHDKYNHFMKGTLLQEIRDSLNNAQDIQADVVQNMA 265

Query: 345 LNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLW---QNNSK 401
            +         ++ +   KN  E  K L  E L +   L   K  L   +LW     N +
Sbjct: 266 FH---------YDNIAILKNEYEESKKLLRE-LNQTSNLAQRKRLLQGKSLWIDVDKNHE 315

Query: 402 LTNTLQKISALNEEYNVEK-SKNQTLQNEINR----TKQLLNESQSKIKVLEGEEKQQLK 456
           + + L+    LNE+   E   K +  + +I+R     K +  E+ SK+ VL GE+ +  +
Sbjct: 316 IYSKLENEVTLNEKKITETMEKIKMRKAKIDRYTADQKSVEEETASKV-VLVGEKDEAHQ 374

Query: 457 SKR-ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEI----QELEKS----- 506
           + R  L       D++ +N  QK+A  E  I+  ++ I +L   I    QELEK      
Sbjct: 375 AVRDQLRAVRSEFDKEKEN--QKEA--ENGISECKRRIETLNRTIEHLEQELEKQMGGDR 430

Query: 507 --QKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKK 564
              KE   +L+  N+QL+ + E++    L++++K   I+ E    + DL      +Q K+
Sbjct: 431 GKMKEELAQLQAENEQLRDKVENISNELLEMQDKERTIAAE---RQQDLRTIEHNIQSKR 487

Query: 565 TEIQLV 570
            E+Q +
Sbjct: 488 NELQKI 493

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 188/421 (44%), Gaps = 72/421 (17%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 209 LSDLIHKSEKFPDLTSC---SVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNS-SK 264
           + D I   E    +      S  VE +  +D  + DT        + I+R+  K+ S S+
Sbjct: 93  VEDFIKNGEDRGSIEITLKNSPKVEGMPGVDS-EADT--------IKITRELIKSKSKSR 143

Query: 265 YYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK-----PKAEKESDDGLL 319
           Y IN +  +  DV  L+ +  I LD+    + Q  VE  A++K      +  +  D  LL
Sbjct: 144 YMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLL 203

Query: 320 EYLEDIIGTSKYKQLIEKDL--IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFL 377
           + LE           + KDL   EI S  E+ + K+   E++ +++   ES K    E  
Sbjct: 204 DVLE-----------LLKDLQAKEISSQRELDLNKQKYDELLVQKEKLSESVKAFK-ELE 251

Query: 378 EKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLL 437
            K+ +L L   +LL Y      +KL +  +K++    +Y                 K+ L
Sbjct: 252 SKKSELELH-LQLLPY------AKLKDHKEKLA----DY-----------------KRDL 283

Query: 438 NESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKI-IATTEKTISSL 496
           +++++ +K L  ++K    +K+ LE E + +    ++L  K+ K ++      E+ + S+
Sbjct: 284 DQAKANLKSLRKDKKPFSNAKQNLE-ERLEILSNKRDLKDKQLKEDQASYRRVEQELESI 342

Query: 497 TSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE----KTSGISEEILIHEHD 552
             EI++ E+  + Y +  + L +     RE LE  K KL E     +  + +EI    HD
Sbjct: 343 REEIEKKEQQIEYYRNRTKKLEETAAKTREELEN-KYKLLETIELPSQSVFDEITSQRHD 401

Query: 553 L 553
           L
Sbjct: 402 L 402

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 85/189 (44%), Gaps = 25/189 (13%)

Query: 121 IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG 180
           I+LSP++         YD + + S      I K+ + NF +Y    V      SF+ ++G
Sbjct: 36  IKLSPIQ---------YDDYQAGS------IIKIKMKNFMTYG--LVEYQLCPSFNMIIG 78

Query: 181 PNGSGKSNVIDSMLFVFGFRAN-KMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHD 239
           PNGSGKS V+ ++      + +   R D ++  I   +     TS  +++   Y+ D   
Sbjct: 79  PNGSGKSTVVCALGLGLASKLDITGRGDIVTQYIQNGK-----TSGKIEITLKYS-DRIK 132

Query: 240 GDTKISETKPKLVISRK-AFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQG 298
               ++  +  + I R+ +     S Y IN    N  DV  ++ +  I LD+    + Q 
Sbjct: 133 NVKGVNPNRETVTIKREISIDAKKSNYKINNTVVNEKDVRDIVSKLNIQLDNLCQYLPQE 192

Query: 299 EVENIAQMK 307
            +++ A++K
Sbjct: 193 RLKDFARLK 201

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1368 IS 1369
            ++
Sbjct: 1055 VT 1056

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 12/88 (13%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 ISLRNNMFELAQQLVGIYKCEN-RTHSA 1394
            I+         + L G+Y  E  R H  
Sbjct: 1047 IT--------PKLLTGLYYHEKMRVHCV 1066

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 16/162 (9%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 209 LSDLIHKSEKFPDLTSC---SVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
           + D I   +    +      S  V  +  I+ HD   KI+      +I+R   +   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
            IN  + +   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           +I K++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   R +
Sbjct: 63  YIKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGN 119

Query: 208 RLSDLI 213
            L +LI
Sbjct: 120 SLKELI 125

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 209 LSDLIH 214
           L DLI 
Sbjct: 145 LKDLIR 150

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1368 IS 1369
            I+
Sbjct: 1074 IT 1075

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 96/231 (41%), Gaps = 41/231 (17%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG------------------DTKISE---T 247
           + D I   E   D +   +   FL  ++  D                   D K  +    
Sbjct: 109 VDDYIKNGE---DRSKIEI---FLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLI 162

Query: 248 KPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           K   +I R   K   S YYIN K  +   V  L+K   I LD+    + Q  VE  A++K
Sbjct: 163 KFTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLK 219

Query: 308 P-----KAEKESDDGLLEYLEDIIGTSKYKQLIEKDL-IEIESLNEICIEK 352
                 +  +  D  LL+ LE++      +Q +E +L I+ +   E+C E+
Sbjct: 220 SDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDELEIKQKRYTELCNER 270

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 92/206 (44%), Gaps = 35/206 (16%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 209 LSDLIHKSEKF----------PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAF 258
           + D I   +            P++T    D+E+   ID  D   KI+      +I+R   
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVT----DIEY---IDARDETIKITR-----IITR--- 143

Query: 259 KNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKE 313
               S Y IN  + + + V  L+ +  I LD+    + Q  VE  A++K      +  + 
Sbjct: 144 SKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRS 203

Query: 314 SDDGLLEYLEDIIGTSKYKQLIEKDL 339
            D  LL+ L+++      +Q ++KDL
Sbjct: 204 IDASLLDVLDELRELQGNEQSLQKDL 229

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 IS 1369
            I+
Sbjct: 1047 IT 1048

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 209 LSDLIH 214
           L DLI 
Sbjct: 139 LKDLIR 144

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 209 LSDLI 213
           L DLI
Sbjct: 139 LKDLI 143

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 209 LSDLI 213
           L DLI
Sbjct: 140 LKDLI 144

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 16/159 (10%)

Query: 151 INKLTLNNFKSYA-GQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y+  +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 44  IIKIKLWNFVTYSLAEFTLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
           L D I   E   D +   V    L  + E D +T     K  +   +K       +Y IN
Sbjct: 101 LEDYIKNGE---DQSVVEVT---LKNVPESDFNTDTILIKTTINRGKK-----KPEYAIN 149

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           G     T +   +K+  I LD+    + Q  VE  A++K
Sbjct: 150 GSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK 188

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1368 IS 1369
            I+
Sbjct: 1044 IT 1045

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1368 IS 1369
            I+
Sbjct: 1072 IT 1073

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 12/160 (7%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR- 208
           I K+ L+NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R 
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKN-NSSKYYI 267
           + D I   E+  ++     + E   AI + +G  + S+T   + I+R   ++   S+Y I
Sbjct: 123 VDDYIKNDEEHGEIEITLKNSE---AIHDVEGVLEGSDT---ITITRILTRSKKKSEYKI 176

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           N        V +L+    I LD+    + Q  VE  A++K
Sbjct: 177 NDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 202
           +I ++TL NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMI 1052

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1359
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1360 TKNAQFIVISLRN--NMFELAQQLVGIYKCEN 1389
              + Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           FI ++ L NF  ++   + +GP     + +VG NGSGKS ++ ++    G +A    R  
Sbjct: 63  FIKEIKLTNFMCHSNFSLRLGP---RLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGT 119

Query: 208 RLSDLI 213
            L DLI
Sbjct: 120 SLKDLI 125

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 96/211 (45%), Gaps = 33/211 (15%)

Query: 1191 VETEVSDLEKYI---ESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELK 1247
            +ET++ +  ++    EST  N+   ++ +++  E  +RK+  N++ D   +  K LE  +
Sbjct: 856  IETQIENASEFCSEEESTSENLPDNQDDIRKELEDISRKIKRNES-DIGVSYEKALELYE 914

Query: 1248 KT---------RYEEFMHGFGIISMTLKEM-----YQMITMGGNAELELVDSLD--PFSE 1291
            +T         +Y E  +   I++ ++K       YQ  +   +A+ +  +SL    F  
Sbjct: 915  QTMSKFLSAKEKYIEMDNALSILNHSIKSRTVNFGYQKTSTFADADFDFRNSLRIRKFKG 974

Query: 1292 GVTFS--------VMPPK--KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341
             + F            P+  K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D
Sbjct: 975  KLDFGKTKETLNVYTGPQTDKEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYD 1034

Query: 1342 AALDFRNVSIVANYIKERTKN---AQFIVIS 1369
              +D  N       I ++ K+    Q I+I+
Sbjct: 1035 VFMDQVNRKTSTQLIVQKLKDDSRTQTIIIT 1065

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 103/236 (43%), Gaps = 35/236 (14%)

Query: 863  ANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQD 922
            AN    +M +    LN R  E +  ++K+  E D    E+K   R L  +  I  ++L +
Sbjct: 671  ANKLLMKMSDSTTYLNERIQEEQKTLNKLKREYDEQINELKQNIRTLDNEKKIIQNKLNN 730

Query: 923  N----EELK------VAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQ 972
            N     ELK      V    L   K+E+  +Q+   + +  +  LKE +           
Sbjct: 731  NTKQITELKKDLNKVVDTGVLDSAKDEYQRIQNAIVSYETALEGLKENM----------- 779

Query: 973  NSKVTSIVQRIDILTAKQKKDRTSKKKSDT---ELEKAKKTLLTSKNDITLITDDIKEIS 1029
            N+ +       DI    QK  R  KK+ +    ELE     +   K+DIT+  D+   I 
Sbjct: 780  NTLLEKARPLNDIRDTAQKTYRNIKKEFEALKQELEDRDIRIRRYKDDITIQNDEKARIQ 839

Query: 1030 ERIDKISSSLNNIDKSIE-------EFQAHKET----LKDECDELKDKVVDLEENI 1074
            E+ID++ S++N++   IE       EF + +E+    L D  D+++ ++ D+   I
Sbjct: 840  EKIDRVQSNINDLMSGIETQIENASEFCSEEESTSENLPDNQDDIRKELEDISRKI 895

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1365
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1366 IVIS 1369
             +I+
Sbjct: 1056 FLIT 1059

 Score = 36.6 bits (83), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 68/163 (41%), Gaps = 20/163 (12%)

Query: 153 KLTLNNFKSYAGQQVVGPF--HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 209
           KL + NF +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 210 SDLIHKSEKFPDLTSCSV----DVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
            D I   E+   L   ++    +VE    +  HD   KI+       +SR       S Y
Sbjct: 104 EDFIKNGEE-KGLVEVTLKKPAEVEHSPIVKSHDQVIKITRH-----LSR---SKRDSDY 154

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP 308
            IN  E   + V  ++ +  I LD+    + Q  V + A   P
Sbjct: 155 QINDIEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP 197

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 77/186 (41%), Gaps = 23/186 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I  + L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 46  IVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAK 101

Query: 208 RLSDLIHKSEKFPDL---TSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSK 264
           R+ D I        +      S +V  L  I   D    +   +  L+ +R+        
Sbjct: 102 RVEDFIKNGTAESTIEIQLRNSRNVSGLPMISAEDEAINV---RTVLMKARR-----KCA 153

Query: 265 YYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLL 319
           YYING+  +   +  L+    I LD+    + Q  VE  A++K      +  +  D  LL
Sbjct: 154 YYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLL 213

Query: 320 EYLEDI 325
             LE +
Sbjct: 214 GLLEQL 219

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1365
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T  +Q+
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENT--SQY 1049

Query: 1366 IVIS 1369
             +I+
Sbjct: 1050 FLIT 1053

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 40.0 bits (92), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 125/270 (46%), Gaps = 14/270 (5%)

Query: 395 LWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQ 454
           L Q  ++L N   ++S+L ++      K    Q E+ R  QL    +SK+  L     Q+
Sbjct: 567 LSQATTELANLSNQVSSLTKQATEVNDKKARAQQELQRVTQLKTSIESKLATLRASYDQE 626

Query: 455 LKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDEL 514
           ++    +E   +   +  + L Q+ +  E      E  ++ L  E+Q+ E+S  +  +++
Sbjct: 627 VQQTEKVESLLLQSRKDTETLQQELSVAEANYHAVEGKLTELQKELQDSEQSNSQLKEQI 686

Query: 515 ETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQI 574
             LN    S +  L   + K+K++ S +     ++   LE   I V   K EIQ +  Q+
Sbjct: 687 GNLNAMAASLQTELNEKQQKVKQERSMVD----VNSKQLELNQITVDNLKAEIQGLGEQL 742

Query: 575 SLLQEGQVKLKN---DIKVLSQEVSNQTALKIKREEDL----VNLKKQQSSI---TKEIS 624
           ++  + + +L +   +I+    E+ N+    + +  DL    + L +++  +   TK+I 
Sbjct: 743 AVFFDKRKELDDYSANIEKQHTELQNRHGEFVSKSHDLEAKKLELDQREQDVQQRTKQIE 802

Query: 625 NGETECNDGRSKLKEMKNVLNMQRQRASEA 654
             E   +   +KL+EM + LN QR+  ++A
Sbjct: 803 EQEQIYHQQIAKLQEMFDDLNNQRESFTKA 832

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 39.7 bits (91), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 126/246 (51%), Gaps = 24/246 (9%)

Query: 421  SKNQTLQNEINRTKQLLNESQ---SKIK-VLEGEEKQ--QLKSKRILEGEHVS-LDEKLK 473
            S+ +TL NE    ++LLNE     S IK V EG+E +  +L  +  L  E ++ +  KLK
Sbjct: 1916 SRIKTLTNEFELNEKLLNEKSEELSAIKAVTEGKENEIKKLTQELALSEEEIAVIKSKLK 1975

Query: 474  NLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKL 533
            N  +  A TE+ +  T++ +S + +   +L  + K+ SD    L+ QL   ++ L+ + L
Sbjct: 1976 NSDETAASTERKLLETKEILSQMPT---DLTTANKDKSD----LSIQLTETKKQLDVLNL 2028

Query: 534  KLKEKTSGIS---EEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKL---KND 587
            ++ E    +S   E +   E  LE   I+    K EI+ ++ Q+S L E    +   KND
Sbjct: 2029 QINENGDLLSSKIESLKEKEDQLEKLQIESDNSKEEIEKLKHQLSKLSENHDSILLDKND 2088

Query: 588  IKVLSQEVSNQTALK---IKREEDLVNLKKQQSSITKE-ISNGETECNDGRSKLKEMKNV 643
            ++    +  N  A +   +KR + L+N K++ S+  K+ I+  E E +  +S+L  +K  
Sbjct: 2089 LEAKVHDYENAIAERENEVKRYQLLLNEKERTSNDFKDKITVAEEEIHSLKSELDRLKIA 2148

Query: 644  LNMQRQ 649
             + Q++
Sbjct: 2149 FDEQKK 2154

>Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON}
           YBL047C (REAL)
          Length = 1377

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 120/253 (47%), Gaps = 9/253 (3%)

Query: 400 SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
           +++ N   ++++L+++ ++   K      E+ R  ++ N  Q K+  L     Q +K   
Sbjct: 600 TEMANLSNQVNSLSKQASITNDKKSRATQELKRVTEMKNSIQVKLNNLRSTHDQNVKQTE 659

Query: 460 ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519
            LE + +  +++ + LTQ+ A +E      E  ++ LT+++QE +    E  +++  LN 
Sbjct: 660 QLEAQVIQANKENETLTQQLAVSEANYHAAESKLNELTNDLQESQAKNAELKEQITNLNS 719

Query: 520 QLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQE 579
              S +  L   +  +K++ S +     ++   LE   I V   + EI+ +  +I++   
Sbjct: 720 MTASLQSQLNEKQQHVKQERSMVD----VNSKQLELSQITVVNLQKEIEGLGEKITVYLT 775

Query: 580 GQVKLKNDIKVLSQEVSNQTALKIK----REEDLVNLKKQQSSITKEISNGETECNDGRS 635
            Q +L ND +   +E   Q   K +    ++ DL + +KQ     K+I   E   +   S
Sbjct: 776 KQKEL-NDYQKTVEEQHAQLQAKYQELSNKDTDLSDREKQLEERNKQIEEQEDLYHQHVS 834

Query: 636 KLKEMKNVLNMQR 648
           KL+EM + L+ ++
Sbjct: 835 KLQEMYDDLSQRK 847

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 202
           ++ ++TL NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 28/142 (19%)

Query: 1219 LTEFKTRKLDLNDAVDKRETVRK---QLEELKKTRYEEFMHGFGIISMTLKEMYQMITMG 1275
            ++ F++ KL   DA  K   V K   QL E  K R++         S+T  +    +T  
Sbjct: 914  MSLFESAKLKYKDAEQKFANVDKAVFQLNESLKRRWQ---------SLTYAKTDTCVT-- 962

Query: 1276 GNAELELVDSLD--PFSEGVTFSV----------MPPKKSWRNISNLSGGEKTLSSLALV 1323
              A+ +  +SL    FS G+ F+            P  +  RN+   SGGEK+ S ++L+
Sbjct: 963  --ADTDFKESLRFRNFSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLL 1020

Query: 1324 FALHKYKPTPLYVMDEIDAALD 1345
             A  +   + +  +DE D  +D
Sbjct: 1021 LATWRPMRSRIIALDEFDVFMD 1042

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR-ANKMRQD 207
           FI ++ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G + A+  R  
Sbjct: 68  FIKRVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKAADTNRGS 124

Query: 208 RLSDLI 213
            L DLI
Sbjct: 125 SLKDLI 130

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 95/207 (45%), Gaps = 31/207 (14%)

Query: 500 IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
           ++ELE ++ E  +E +   Q+L + +E+ E  K  L EK S I           E  +  
Sbjct: 792 MKELESNKNEILEESKPCFQRLDATKEAFEITKQTLSEKRSRI-----------EKGSSA 840

Query: 560 VQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQT--ALKIKREEDLV--NLKKQ 615
           +   + EI+ ++ ++   Q    K+K++IKVL + +SNQ   AL    EE+ V  NL + 
Sbjct: 841 ISSYEEEIKDIDKRMYNYQSKIEKIKDNIKVLEEGISNQIDKALTFCTEEESVNSNLPED 900

Query: 616 QSSITKEISNGETECNDG--RSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYK 673
           Q+ I K++ N  T   +   RS L   + + N ++    E +   A  Q   +V  AL K
Sbjct: 901 QTEIKKQLLNISTMIQESEKRSGLTHEEIISNFEK---CEEKYTKA-YQKYNEVEDALIK 956

Query: 674 LQKS----------GRIVGFHGRLGDL 690
           L+ S           R V F   LGD 
Sbjct: 957 LEASINERIQTYTETRSVTFTEALGDF 983

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1351
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +    V      + + +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 209 LSDLIHK 215
           L +LI K
Sbjct: 130 LKELIRK 136

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1308 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1367
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1368 ISL 1370
            IS+
Sbjct: 655  ISI 657

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 114/517 (22%), Positives = 210/517 (40%), Gaps = 89/517 (17%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           + K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
           L DLI +      +T        LY  +   G  K       ++I R   ++    + + 
Sbjct: 129 LKDLIREGSYSAKIT--------LYLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSLK 180

Query: 269 GKE-----SNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 323
            KE     S   DV  +L    I + +    +                  S D    +L 
Sbjct: 181 TKEGEEISSRKKDVQSVLDYFSIPISNPMCFL------------------SQDAARSFLT 222

Query: 324 DIIGTSKYKQLIEKDLIE--IESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEK 381
                 KY Q ++  L++   + LN   +  +N  E +   K  LE  + L  E+ + +K
Sbjct: 223 AGSPHDKYMQFMKGTLLQNIDDDLNHAKVIHKNSEESM---KLHLEKLRELKAEYEDAKK 279

Query: 382 QL-------TLSKSKLL--QYNLWQNNSKLTNTLQKISALNEEYN-VEKSKN--QTLQNE 429
            +       TL++ K+L    +LW +             +++ Y  VEK KN  +T Q +
Sbjct: 280 LIKEINQTSTLNERKMLLQGRSLWMD-------------IDQNYKAVEKLKNDMKTCQTK 326

Query: 430 INRTKQLLNESQSKIK--VLEGEEKQQLKSKRIL-----EGEHVSLDEKLKNLTQKKAKT 482
           I +    +NE +  I+   ++ E  Q L  + ++     E EH    E ++N+  +  K 
Sbjct: 327 IEKLTNKVNEKEKGIEKYTIDNESAQALIEENVINVNNREQEHQLAREAVRNVRAEFEKK 386

Query: 483 EKIIATTEKTISSLTSEIQELEKS----QKEYSDELETLNQQLQSERESLEAMKLKLKEK 538
           +   A  +K I S   +I+ L+K+    ++ +  E+     QL+ E   LE    +L  +
Sbjct: 387 KANEAEAQKNIESCKKKIEALDKTIAHLEENFRREMGGDKDQLREELADLEMQNTELNTQ 446

Query: 539 TSGIS-----------EEILIHEHDLEPWNIKVQEKKTEIQ-LVESQISLLQEGQVKLKN 586
            + ++           E +   + D++     +Q +K +IQ  VES  + L     K++ 
Sbjct: 447 VNALTINLQDVQNEEREVVQQRQADVQQLERSIQNQKIQIQRTVESNNNFLSNFDPKMEY 506

Query: 587 DIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEI 623
            +KVL Q         I    + + +KK  S  T+ I
Sbjct: 507 LLKVLKQRQREFEVPPIGPLGNYITIKKDFSKWTRAI 543

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1351
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
           EDE1Endocytic protein; involved in a network of
           interactions with other endocytic proteins, binds
           membranes in a ubiquitin-dependent manner, may also bind
           ubiquitinated membrane-associated proteins; interacts
           with Cmk2 and functions upstream of CMK2 in regulating
           non-apoptotic cell death
          Length = 1381

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 115/245 (46%), Gaps = 9/245 (3%)

Query: 400 SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
           +++ N   ++++L+++ ++   K      E+ R  ++ N  Q K+  L     Q +K   
Sbjct: 604 TEMANLSNQVNSLSKQASITNDKKSRATQELKRVTEMKNSIQIKLNNLRSTHDQNVKQTE 663

Query: 460 ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519
            LE + + ++++ + L Q+ A +E      E  ++ LT+++QE +    E  +++  LN 
Sbjct: 664 QLEAQVLQVNKENETLAQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNS 723

Query: 520 QLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQE 579
              S +  L   + ++K++ S +     ++   LE   + V   + EI  +  +IS+   
Sbjct: 724 MTASLQSQLNEKQQQVKQERSMVD----VNSKQLELNQVTVANLQKEIDGLGEKISVYLT 779

Query: 580 GQVKLKNDIKVLSQEVSNQTALKIK----REEDLVNLKKQQSSITKEISNGETECNDGRS 635
            Q +L ND +   +E   Q   K +    ++ DL + +KQ     ++I   E   +   S
Sbjct: 780 KQKEL-NDYQKTVEEQHAQLQAKYQDLSNKDTDLTDREKQLEERNRQIEEQENLYHQHVS 838

Query: 636 KLKEM 640
           KL+EM
Sbjct: 839 KLQEM 843

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1289 FSEG-VTFSVMPPKKSW-RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1347 RNVSI----VANYIKERTKNAQFIV 1367
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           FI K+ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    R  
Sbjct: 69  FIKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 125

Query: 208 RLSDLI 213
            L DLI
Sbjct: 126 SLKDLI 131

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 127/271 (46%), Gaps = 27/271 (9%)

Query: 393  YNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEK 452
            +NL +    LT  + K+    E+      K Q  + E  R  QLL++    I+ L  E +
Sbjct: 834  FNLTKEKDSLTAVMNKLQKEGEK------KLQEAEKEKVRITQLLSQRDRDIENLRNELQ 887

Query: 453  QQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSD 512
             Q   K+ LE EH  L   LK +   K++     A+ +  I  L  +++ L +S K+  +
Sbjct: 888  DQGTQKKKLEDEHAGL---LKEIADLKSQC----ASQDSLIPKLKEKLKTLAESLKDTQN 940

Query: 513  ELETLNQQLQSERESLEAMKLKLKEKTSGISEE--ILIHEHD---LEPWNIKVQEKKTEI 567
            E  TL +Q+ + + +  A   +L  +   + +E  ILI   D    E   ++ Q    E 
Sbjct: 941  EHATLQKQVGNIQATSHAEITQLNAELQKLKDENVILISRKDELTQELEKLQAQTAAGEK 1000

Query: 568  QLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA----LKIKREE--DLVNL-KKQQSSIT 620
            Q   S I+LL   + +L   +    +E+ NQ A    L  +R E  D +N  +KQ    +
Sbjct: 1001 Q--TSDIALLNTQKSELSAKLSRAEKELVNQKAKAEGLFQERAELKDKLNTSEKQLQESS 1058

Query: 621  KEISNGETECNDGRSKLKEMKNVLNMQRQRA 651
            +++SN ++E N+ RS+LK  ++ L   RQ A
Sbjct: 1059 QKLSNAQSELNEIRSRLKANEHDLITSRQEA 1089

>TDEL0C03510 Chr3 (612431..616339) [3909 bp, 1302 aa] {ON} Anc_7.488
           YBL047C
          Length = 1302

 Score = 37.4 bits (85), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 85/180 (47%), Gaps = 10/180 (5%)

Query: 400 SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
           +++ N   ++++L+++  +   K      E+ R  ++    + K+  L    +Q +K   
Sbjct: 563 TEMANLSNQVNSLSKQATITNEKKARATQELKRVNEMKAAIEGKLATLRSTHEQNVKETE 622

Query: 460 ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519
            LE +    +++ + L Q+ A  E     TE  +  LT E+Q+ ++   +  +++ +LN 
Sbjct: 623 TLEAQLAEANKESEGLNQQLAVIEGNYHATESKVRDLTDELQQAQQKNAQLKEQISSLN- 681

Query: 520 QLQSERESLEAMKLKLKEKTSGISEE---ILIHEHDLEPWNIKVQEKKTEIQLVESQISL 576
                  +  A++ +L E+   + +E   + ++   LE   I V   ++EIQ +  ++S+
Sbjct: 682 ------SNSAALQSRLAERQQHVKQERSLVDVNSRQLEVSQITVANFESEIQGLGEKLSV 735

>KAFR0H01520 Chr8 complement(280214..282796) [2583 bp, 860 aa] {ON}
           Anc_8.484 YDR251W
          Length = 860

 Score = 37.0 bits (84), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 15/92 (16%)

Query: 461 LEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEK-----------SQKE 509
           L+ E+ SL E+L  + +K  + E  I+  +K+  +L +++QELE            S++ 
Sbjct: 354 LKLENASLKEQLLKINEKNNENESTISNYQKSDMNLKAKLQELENFVNKLSQENATSKQN 413

Query: 510 YSDELETLNQQLQSE----RESLEAMKLKLKE 537
           Y +E  TL Q  Q+E    R  LE MKLK +E
Sbjct: 414 YQNENATLKQSYQNEITTLRAQLEDMKLKPRE 445

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 135/279 (48%), Gaps = 46/279 (16%)

Query: 384  TLSKSKLLQYNLWQNNSKLTNTLQK----ISALNEEYNVEKSKNQTLQNEINRTKQLLNE 439
            +LSK+K L   L  +   +T+  QK    I+ ++ E      + Q L+NEIN++ +   E
Sbjct: 803  SLSKNKDLIQRLKADLGNMTSEKQKAEDGINKMSRELFTLTKEKQDLENEINKSGK---E 859

Query: 440  SQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSE 499
            ++ +++  + +EK      R+ EG           L QK A+ +K+    ++ ++ L ++
Sbjct: 860  NEQRLQKFKKDEK------RLSEG-----------LAQKDAEVKKL----QEFVTRLQNQ 898

Query: 500  IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
            IQELE S+ E S EL +L  + +S      A+  KL EK   +++            N K
Sbjct: 899  IQELETSKNELSSELNSLRPRFESHN----ALIPKLTEKLKSLAK------------NFK 942

Query: 560  VQEKKTEI--QLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQS 617
              E++ E+  Q + S+     E    LK++I  L+ E+      K   E+ + +L ++ +
Sbjct: 943  QLEQEKELISQELVSKGKFNDEEISSLKSEISTLASEIETLVGQKEDFEKKVTHLGQEVA 1002

Query: 618  SITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656
            S  K + + + + +   S L++  + LN Q +  SE++L
Sbjct: 1003 SKVKLLQDSKIDHDSEVSSLQKTIDSLNAQVKTISESQL 1041

>NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON}
           Anc_7.488 YBL047C
          Length = 1336

 Score = 36.2 bits (82), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 112/248 (45%), Gaps = 15/248 (6%)

Query: 400 SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
           ++L N   ++++L+++  +   K      E+ R   +    ++K+  L       +K   
Sbjct: 573 TELANLSNQVNSLSKQATITNDKKARAAQELKRVNDMKASIENKLSTLRKTHDDNMKQTE 632

Query: 460 ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519
           +LE + +  +++ + L Q+   TE      E  ++ LT+E+   ++S     D++  LN 
Sbjct: 633 VLESQLLESNKQTETLKQQLGVTEANYHAIESKLNELTTELTTAQESNTNLKDQIANLNS 692

Query: 520 QLQSERESLEAMKLKLKEKTSGISEE---ILIHEHDLEPWNIKVQEKKTEIQLVESQISL 576
              +       ++ +L EK   + ++   + ++   LE   I ++  +TEI  ++ ++ +
Sbjct: 693 MTAT-------LQTQLNEKQQNVRQQRSMVDVNSKQLEVGQINLKSMQTEIDGLDEKLQV 745

Query: 577 LQEGQVKLKNDIKVLSQEVSNQTALKIK----REEDLVNLKKQQSSITKEISNGETECND 632
               Q +L N+ +   +E  +Q   K K    R +DL   +KQ      +I   E   ND
Sbjct: 746 YLTKQNEL-NEYQKTVEEQHSQLESKYKDLALRNDDLTEREKQLEERNAQIEEQEKIYND 804

Query: 633 GRSKLKEM 640
             ++L+EM
Sbjct: 805 HVTRLQEM 812

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score = 36.2 bits (82), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 126/255 (49%), Gaps = 19/255 (7%)

Query: 380 EKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNE 439
           +K++   K  LLQY+  ++N    NTL K++A  +E     S+  T++NE+ +   L+ E
Sbjct: 710 QKEIESYKQNLLQYS--KDNE---NTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQE 764

Query: 440 SQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSE 499
            ++  K  +        S+R+L+   + L++K+K +   +AK    I   +K + SLT+ 
Sbjct: 765 RETYYKEHDS------ISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTT 818

Query: 500 IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
             +L   Q E + EL  +N Q    R  +  ++  L + T+G S    + + D E    +
Sbjct: 819 NDKL---QVELNKELTKINIQ----RLKISDLEKTLSQNTNGSSSLPRV-DQDFEKLKNE 870

Query: 560 VQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSI 619
           ++EK+ EI      ++L +E + +L+ D+    Q V +    K + ++ L  L ++ SS+
Sbjct: 871 LKEKQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSM 930

Query: 620 TKEISNGETECNDGR 634
              +   + +C D +
Sbjct: 931 NSLLQKQKAKCEDDQ 945

>KLLA0E21583g Chr5 (1926061..1927245) [1185 bp, 394 aa] {ON} similar
            to uniprot|P32468 Saccharomyces cerevisiae YHR107C CDC12
            Component of the septin ring of the mother- bud neck that
            is required for cytokinesis septins recruit proteins to
            the neck and can act as a barrier to diffusion at the
            membrane and they comprise the 10nm filaments seen with
            EM
          Length = 394

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1038 SLNNIDKSIEEFQAHKETLKDECDELKDKVVD-LEENINEFKSFEIEVNNKLEKLNGLLN 1096
            S NN   +     +H    K+E + LK    D ++     F+ +E  + N+  KLNG L 
Sbjct: 314  SANNFVAAPARKLSHNPKFKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERIKLNGDLE 373

Query: 1097 HIKNQIKTLEDSLSKLTLRK 1116
             I+ ++K LED ++ L LRK
Sbjct: 374  KIQAEVKKLEDQVATLKLRK 393

>KAFR0B01420 Chr2 (268184..269149) [966 bp, 321 aa] {ON} Anc_2.563
            YKL042W
          Length = 321

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 115/248 (46%), Gaps = 38/248 (15%)

Query: 1015 KNDI-TLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEEN 1073
            KN++ ++I  + K+ S++++ +   L++   +I+      + LK     L+ +V  L+  
Sbjct: 44   KNNLDSIIPPEYKQTSQKMEDLIYQLSHAHATIDAKNVEIDNLKRSISRLESEVDQLKGQ 103

Query: 1074 INEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTL-----------RKMHQVLM 1122
            ++  KS    +  KLEK N L +  +++IK L+D   +  L           R  H   M
Sbjct: 104  LDRTKSSATTLREKLEKYNNLYHKAQDEIKKLQDENYEKELEQNDYIQLNKRRSNHHYTM 163

Query: 1123 ALDEESEAKAPNNGTLSD-EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDD 1181
               E  +A+ P    L+D E+I  Q GH + +  +    S     G+++ SN        
Sbjct: 164  ---ESPKAEEP----LTDNEEIFAQLGHRIHDLVLTSSSSTKP--GSQIPSNS------S 208

Query: 1182 ELSALD-ITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVR 1240
            E +A+D +T  E E       I   +A ++ +EE V    +    K D ND   ++ +++
Sbjct: 209  EKTAVDSVTASEYES------ILRDNAMLKKMEEQVHDFLQLLATKQD-NDQ--RKTSLQ 259

Query: 1241 KQLEELKK 1248
            +QL E+K+
Sbjct: 260  RQLAEMKQ 267

>SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023W MYO1 Type II myosin heavy chain required for
            wild- type cytokinesis and cell separation localizes to
            the actomyosin ring binds to myosin light chains Mlc1p
            and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1871

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 121/238 (50%), Gaps = 32/238 (13%)

Query: 875  QKLNNRK--PEIELEIS---KIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVA 929
            QKLN +K   + + EI+   +I  E ++   +++S++++LQ K N  NSE+   ++ +V+
Sbjct: 889  QKLNAKKQYEDAQREITSFKEISSERESSIKQLESEKKELQLKLNQINSEISIAKKSEVS 948

Query: 930  IENLQK-LKEEHLALQDKTKAKKKKIASLKEKI--------MKIGGIE--LQVQNSKVTS 978
            +    K LK+E   L+    +K+++I  LK K+        +K+  +E   ++ + ++ +
Sbjct: 949  LTTTAKSLKDEIEELKALGTSKQREIDDLKTKLKTSDEELELKMKSLEKSFEITSKRLNT 1008

Query: 979  IVQ-----RIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKND-----ITLITDDIKEI 1028
            +V+     R  I TAK++   T ++    E E  +   L  KN+     I+L+     ++
Sbjct: 1009 LVEENKDLRGQIDTAKREAGETQRQLDSKERELKR---LVEKNEQHQTEISLLAKSRDDL 1065

Query: 1029 SERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNN 1086
                 K+ + L +  K + E++   + LK+EC  +K +   LEE I    + ++E NN
Sbjct: 1066 VSEHSKVVAELRHSRKEVSEYKQRCQKLKEECTSIKKQ---LEEEIASLATSKVEANN 1120

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1289 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1348
            F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1349 VSIVANYIKERT 1360
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
            similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 718

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 107/219 (48%), Gaps = 23/219 (10%)

Query: 873  ELQKLNNRKPEIELEISKIIMEIDTYSAEIK-----------SKERQLQEKTNIDN--SE 919
            E++KL+  K  +E  +S++ + +     E+K             + Q+Q+   + N  SE
Sbjct: 262  EIEKLSTEKTSLEERVSRLKLRLSEARNEMKMINQNSQILQEKFQTQIQQNERLQNQVSE 321

Query: 920  LQDNE-ELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGI--ELQVQNSKV 976
            L+D+E +L+V IEN    K+    ++++ +  + ++A L E   K      +L++  SK 
Sbjct: 322  LEDSENQLRVHIENTTNSKKR---VEEEIERTRAELALLTEGKFKTQSENEDLKLSVSKA 378

Query: 977  TSIVQR----IDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERI 1032
             +++      I+ L A  +    +K+KS  ELE+    L   KN++    +D+  +  +I
Sbjct: 379  QTLLAEKTKFIEELQANLRASHDTKQKSTIELEQRINDLTLEKNELVRELEDMSTLRSKI 438

Query: 1033 DKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLE 1071
            ++  + + ++   ++  Q   + LK+E  EL++    LE
Sbjct: 439  EESENEIQSVKTELDRTQVALQHLKEEHSELREHCRSLE 477

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 1333 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1383
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1384 IYK 1386
              K
Sbjct: 999  FIK 1001

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 987  TAKQKKDRTSKKKSDTEL--EKAKKTLLTSKNDITLITDDI-------KEISERIDKISS 1037
            +A+++ D    K  +TEL  + +K+ +L+ KN+ +    D        K+ SE+I+++  
Sbjct: 1127 SAQKETDTLQTKLDETELLLQSSKEEILSLKNEYSSTLSDKENLENSEKKSSEKIEELEK 1186

Query: 1038 SLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNH 1097
            + +N+ +  E   A  ++LK+EC   ++K  D+ E ++++      ++++ +KLNG+++ 
Sbjct: 1187 NFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGIIDD 1246

Query: 1098 IKNQIKTLEDSLSKLT 1113
             +  I  L + L  ++
Sbjct: 1247 KEKIISNLNEKLESIS 1262

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
           YBL047C (REAL)
          Length = 1380

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 69/143 (48%)

Query: 400 SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
           +++ N   ++++L+++ ++   K      E+ R  ++ N  Q+K+  L     Q +    
Sbjct: 602 TEMANLSNQVNSLSKQASITNEKKSRATLELKRVTEMKNSIQTKLNNLRSNHDQNVTQTE 661

Query: 460 ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519
            LE +   ++ + + LTQ+ A +E      E  ++ LT+++QE +    E  +++  LN 
Sbjct: 662 QLEAQLSQINNENETLTQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNS 721

Query: 520 QLQSERESLEAMKLKLKEKTSGI 542
              S +  L   +  +K++ S I
Sbjct: 722 MTASLQSQLNEKQQHVKQERSMI 744

>SAKL0G08316g Chr7 complement(709133..709687) [555 bp, 184 aa] {ON}
            similar to uniprot|P38801 Saccharomyces cerevisiae
            YHR081W LRP1 Substrate-specific nuclear cofactor for
            exosome activity in the processing of stable RNAs homolog
            of mammalian nuclear matrix protein C1D which is involved
            in regulation of DNA repair and recombination
          Length = 184

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 1090 KLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESE 1129
            K+   + H+ NQI+TLE  + KLT + + + L++L +E E
Sbjct: 6    KIKPYIAHLNNQIRTLEPEIKKLTAKSLDEQLLSLKDEKE 45

>NDAI0F02090 Chr6 complement(509708..512962) [3255 bp, 1084 aa] {ON}
            Anc_6.161
          Length = 1084

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 1185 ALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLE 1244
            A+D+   +T V ++ +Y ++  AN+E+LE+Y K L   +T +  +N    ++E +R++L 
Sbjct: 867  AMDLEQTKT-VEEVREYAKAFWANLEMLEDYEKYLKIIETEEEKVNKLKYQQEALRRKLA 925

Query: 1245 ELKKTRYE-EFMH 1256
            + +   +E EF+H
Sbjct: 926  QYQNPMFELEFLH 938

>NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1.110
           YNL250W
          Length = 1304

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 60/121 (49%), Gaps = 3/121 (2%)

Query: 864 NNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDN 923
           NN   ++  ++Q L N +     E S ++  I   + +I   ER LQ K NID+     N
Sbjct: 836 NNFMRQLRKDIQDLQNERESKMREHSTLLNVIKDRNLKINEIERVLQRKQNIDDDLHSKN 895

Query: 924 EELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQN-SKVTSIVQR 982
            ELK  +  +Q LK E + L++K +   K + +  E+    G +E + +N   +TS + R
Sbjct: 896 AELKEILLRIQTLKTELIELRNKKQELSKVLNNEMERFS--GEMEAKRKNLGSITSYLDR 953

Query: 983 I 983
           I
Sbjct: 954 I 954

>KLTH0F16544g Chr6 (1342328..1343485) [1158 bp, 385 aa] {ON} highly
            similar to uniprot|P32468 Saccharomyces cerevisiae
            YHR107C CDC12 Component of the septin ring of the
            mother-bud neck that is required for cytokinesis septins
            recruit proteins to the neck and can act as a barrier to
            diffusion at the membrane and they comprise the 10nm
            filaments seen with EM
          Length = 385

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 1051 AHKETLKDECDELKDKVVD-LEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSL 1109
            +H    K+E + LK    D ++     F+ +E  + N+  +LNG L  ++ ++KT+E+ +
Sbjct: 318  SHNPQFKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERIRLNGDLEEVQAKVKTMEEQV 377

Query: 1110 SKLTLRK 1116
              L LRK
Sbjct: 378  RSLQLRK 384

>KLTH0G05632g Chr7 complement(447986..450211) [2226 bp, 741 aa] {ON}
           some similarities with uniprot|Q99248 Saccharomyces
           cerevisiae YOR019W
          Length = 741

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 11/78 (14%)

Query: 234 AIDEHDGDTKIS--ETKPKLVISRKAFKNNSSK---YYINGKESNYTDVTKLLKEEGIDL 288
           A+   DG T +S  E +  LVIS+K    NS +    +I+G++  +T +  LLK+   D+
Sbjct: 205 ALSASDGYTPLSKEEKRKALVISKKVGFPNSPRTLLCHISGRKHTWTPLDWLLKKFSHDV 264

Query: 289 DHKRFLILQGEVENIAQM 306
           DH   L++   + NI +M
Sbjct: 265 DH---LVI---IANIPKM 276

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
            YHR158C (REAL)
          Length = 1168

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 19/133 (14%)

Query: 976  VTSIVQRIDILTAKQKKDRTSKKKSDTELEKAK-------KTLLTSKNDITLITDDIKEI 1028
            +  +  R+D L  K ++   SK+K  +E    K       + +L  +N+I  I +D KE 
Sbjct: 987  IDKLTNRLDDLLEKSQELTMSKEKLSSEYRALKMEHSSLSQDVLVKENEIKKIQNDYKES 1046

Query: 1029 SERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKV-VDLEENINEFKSFEIEVNNK 1087
               +D  S +L    + +E+++   + L DE DELK K  V  ++++N FKS        
Sbjct: 1047 INSMDSASKALMVSQRELEKYKTLNKKLIDELDELKFKNDVSSKDSVNGFKS-------- 1098

Query: 1088 LEKLNGLLNHIKN 1100
                NG  N ++N
Sbjct: 1099 ---TNGNFNDVEN 1108

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa] {ON}
            complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 87/189 (46%), Gaps = 15/189 (7%)

Query: 884  IELEISKIIMEIDTYSAEIKSKERQLQEKTN-IDNSELQ-----DNEELKVAIENLQKLK 937
            I L+    I+E D  S E K  E     K+N +D S L       +E+LK A E L  L 
Sbjct: 773  ISLQSKYDILEADYNSLEDKMSESDRLLKSNFLDVSNLNIIIKAQSEKLKDAEEGLTLL- 831

Query: 938  EEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSK 997
            E H  L+ K  A + + A LK K+ K+ G E +   + + +  Q ID+   + KK     
Sbjct: 832  ESHKELKSKYSALESENAELKSKLEKLDGQEFR---NNILTYSQNIDLFMNEWKK----- 883

Query: 998  KKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLK 1057
             K +TE E   K   T+K+ ++  +   +     I K+SS L+ +    E+    K+ L 
Sbjct: 884  GKLNTENEAISKDSDTNKSPVSPTSSKSQHHKAVISKLSSRLDELLHKSEDLADTKDKLT 943

Query: 1058 DECDELKDK 1066
             +  +L+ K
Sbjct: 944  TDYKQLESK 952

>AAL069C Chr1 complement(226816..228813) [1998 bp, 665 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR295C
           (PLO2)
          Length = 665

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 66/131 (50%), Gaps = 15/131 (11%)

Query: 430 INRTKQLLNESQSKIKVLEGEEKQQLKSKRILE---GEHVSLDEKLKNLTQKKAKTEKII 486
           +NR  ++  E+    + L+ EEK  + S+R LE    EH  L EK  +L ++KA+ E+++
Sbjct: 456 LNRLDEVNAEAGRLFQSLKDEEKLVVDSERRLERTRDEHDRLREKSAHLRRRKAELEELL 515

Query: 487 ATTE---------KTISSLTSEIQELEKSQKEYSD---ELETLNQQLQSERESLEAMKLK 534
           A+++           ++ L  ++  LE+     +D   EL T  Q   S   +L +    
Sbjct: 516 ASSDLDSRVSSKRARLAELRQQLMPLEQQNTAMADSNEELRTRYQTRSSHAATLSSALAS 575

Query: 535 LKEKTSGISEE 545
           L+E+ + +++E
Sbjct: 576 LRERKAALTKE 586

>CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa]
           {ON} similar to uniprot|P33895 Saccharomyces cerevisiae
           YOL069w NUF2 spindle pole body protein
          Length = 460

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 127/270 (47%), Gaps = 50/270 (18%)

Query: 394 NLWQNNSKLTNTLQKISALNE----EYNVEKSKNQTLQNEINRTKQLLNESQSKIKVL-- 447
           +L Q N  L   L+K++ L E    +YN  K K Q L  E+ +    L E +SK + L  
Sbjct: 191 DLLQKNKVLETNLKKLTILQEKLSIDYNNYKMKKQELLRELEKNSFTLIELESKKERLMN 250

Query: 448 EGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQ 507
             ++ Q L++         SL+  +  LT++K K    ++  E  +S+L   +  LEK+ 
Sbjct: 251 YNDDDQDLQN---------SLNNSIDRLTEEKKKQIGYVSKLEGNVSNLKVTVDTLEKAI 301

Query: 508 KEYSDELETLNQQLQ-SERESL--EAMKLKLKEKTS---GISEEILIHEHDL--EPWNI- 558
           +   D L  L+  LQ S R  L  E +K  L EK +    + E  +I+++D+  E  N+ 
Sbjct: 302 EHIYDILRLLSTDLQESHRAELNIEGIKGPLTEKRTRLKNLLESNVIYKYDVLKEQLNVA 361

Query: 559 -------------KVQEKKTEIQLVESQI-----SLLQEGQVKLKND-----IKVLSQEV 595
                        +  E K  IQ +E +      + +QE +V ++N+     IK+L  E+
Sbjct: 362 ETEYQRINEEHYRETLENKKLIQELEGKYNNIIHNKMQEAEVYIENEITEKKIKILQSEL 421

Query: 596 SNQTALKIKREEDLVNLKKQQSSITKEISN 625
           ++   ++I+   ++ N++   S++   I+N
Sbjct: 422 ND---IQIQFNNEIDNIELHYSTLVGHINN 448

>CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} similar to
            uniprot|P41834 Saccharomyces cerevisiae YOR075w syntaxin
            of the ER
          Length = 340

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 13/86 (15%)

Query: 931  ENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIE------LQVQNSKVTSIVQRID 984
            E LQ L+ EH  L ++   + KK+  + + IM+I G++      LQVQ+  + S++   D
Sbjct: 236  EQLQVLETEHEELINQKNEQLKKVGLINKTIMEIVGVQSELAAHLQVQSQNINSMLDNQD 295

Query: 985  ILTAKQKKDRTSKKKSDTELEKAKKT 1010
            I+        T+  K + EL+KA++ 
Sbjct: 296  II-------ETNITKGNKELKKAQRA 314

>Suva_15.303 Chr15 complement(529184..530407) [1224 bp, 407 aa] {ON}
            YHR107C (REAL)
          Length = 407

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 1051 AHKETLKDECDELKDKVVD-LEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSL 1109
            +H    K+E + LK    D ++     F+ +E  + N+  +LNG L  I+ ++K LE+ +
Sbjct: 337  SHNPKYKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERIRLNGDLEEIQGKVKKLEEQV 396

Query: 1110 SKLTLRKMH 1118
              L L+K H
Sbjct: 397  KSLQLKKSH 405

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
           YDL058W
          Length = 1657

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 78/176 (44%), Gaps = 29/176 (16%)

Query: 394 NLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEI---NRTKQL-LNESQSKIKVLEG 449
           +L ++N KL   + + S   EE NVE+ K  T ++E      T  L LN+S  +I VLE 
Sbjct: 754 DLLESNKKLHKDVNQASQTIEELNVEREKLLTSRDEYKNDTETNSLKLNKSMERISVLEK 813

Query: 450 EEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKE 509
           E                     LK++  +K K E  I    + + SLT E Q L++SQK 
Sbjct: 814 E---------------------LKDIRAEKKKAEDGINKMSRELFSLTKENQNLKESQKR 852

Query: 510 YSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKT 565
              E +    +L  +R SLE +  +++     +  E  I   +L  W  K Q  +T
Sbjct: 853 NEKERKKEADELSEKRRSLEIITKQME----ALQSEKQITLKELNEWKSKFQSCET 904

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 50/86 (58%)

Query: 1025 IKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEV 1084
            IK   E I ++SSS+++ +K+I++       L  E  ELK+   +LEE ++  +    E+
Sbjct: 1153 IKSHEETIQELSSSIDDREKNIQKLNTSINELNSEIVELKETNQELEECVSRHEKTVTEL 1212

Query: 1085 NNKLEKLNGLLNHIKNQIKTLEDSLS 1110
            N K+EK + +++  + +IK L+  +S
Sbjct: 1213 NEKIEKSDPIISSYEAEIKDLKQKIS 1238

>Skud_8.168 Chr8 complement(300599..301822) [1224 bp, 407 aa] {ON}
            YHR107C (REAL)
          Length = 407

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 1051 AHKETLKDECDELKDKVVD-LEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSL 1109
            +H    K+E + LK    D ++     F+ +E  + N+  +LNG L  I+ ++K LE+ +
Sbjct: 337  SHNPKYKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERIRLNGDLEEIQGKVKKLEEQV 396

Query: 1110 SKLTLRKMH 1118
              L L+K H
Sbjct: 397  KSLQLKKSH 405

>SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa]
           {ON} similar to uniprot|P24384 Saccharomyces cerevisiae
           YER013W PRP22 RNA-dependent ATPase/ATP-dependent RNA
           helicase in the DEAH-box family associates with the
           lariat intermediate before the second catalytic step of
           splicing
          Length = 1139

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 175 FSAVVGPNGSGKSNVIDSMLFVFGFRANKM---RQDRLSDLIHKSEKFPDLTSCSVDVEF 231
           F  +VG  GSGK+  I   L+  GF  N +    Q R    I  +++  +   C+V  E 
Sbjct: 495 FLVIVGETGSGKTTQITQYLYEEGFGRNGIIGCTQPRRVAAISVAKRVAEEVGCTVGEEV 554

Query: 232 LYAI---DEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
            Y I   DE    TKI      ++       +  SKY I
Sbjct: 555 GYTIRFEDETSPMTKIKYMTDGMLQREALLDSKMSKYSI 593

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1308 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1363
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +  
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG 639

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 109/212 (51%), Gaps = 17/212 (8%)

Query: 378  EKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK-ISALNEEYNVEKSKNQTLQNEINRTK-- 434
            EKEK++ ++K+ L   N  +    + N L+  I+ + +E    K +NQ     I++ +  
Sbjct: 1521 EKEKEIQVAKNAL--KNAEKKKKDIENDLRTTIATVEKENTTLKRENQLKSESIDKHQNN 1578

Query: 435  -QLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTI 493
              LL E  SK K L  ++  ++   R LE E+  + +++  L ++KA T + IA  EK  
Sbjct: 1579 IHLLQEELSKQKELADKKHDEI---RKLEKENSKMIDRIDKLEKQKADTNEKIANIEKEN 1635

Query: 494  SSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEI---LIHE 550
            SSL SE + L +  + + DE+  L   L+ + +SL +   +LK+K + +  E+   L   
Sbjct: 1636 SSLISERKTLVEKVENFQDEITNLKSSLE-KNDSLSSSHDELKDKFNELETELKRNLTEL 1694

Query: 551  HDLEPWNI----KVQEKKTEIQLVESQISLLQ 578
            + LE  N     KV E + ++ +VE ++S  Q
Sbjct: 1695 NKLESENKQLSDKVIEHEEKVSMVEKELSTAQ 1726

>ABR049C Chr2 complement(482243..482914) [672 bp, 223 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL041W
           (VPS24)
          Length = 223

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 453 QQLKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEI--QELEKSQKEY 510
           Q  K K IL   H  LD+ L+ L   K KT+ +I  + KT    T  I  +EL +  K+Y
Sbjct: 16  QHRKMKAILRKNHRQLDKSLRELAALKGKTQVLIKKSAKTNDVKTVRIYAKELYQINKQY 75

Query: 511 SDELETLNQQLQS 523
            D + T   QLQS
Sbjct: 76  -DRIYTSKAQLQS 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 153,843,875
Number of extensions: 7586673
Number of successful extensions: 69943
Number of sequences better than 10.0: 3790
Number of HSP's gapped: 60384
Number of HSP's successfully gapped: 7997
Length of query: 1409
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1287
Effective length of database: 39,492,147
Effective search space: 50826393189
Effective search space used: 50826393189
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)