Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B050008.259ON1409140967610.0
Smik_12.1458.259ON1418142738220.0
NDAI0B019708.259ON1415141737760.0
YLR086W (SMC4)8.259ON1418141537620.0
TDEL0F038608.259ON1399140937330.0
Skud_12.1548.259ON1417137037220.0
Suva_10.1708.259ON1416136437210.0
KAFR0B027108.259ON1416143237110.0
ZYRO0C01716g8.259ON1413137136330.0
Kpol_392.88.259ON1427142836110.0
SAKL0H17094g8.259ON1422137835470.0
KNAG0G020208.259ON1444144635190.0
AGR089C8.259ON1370133934200.0
Ecym_43118.259ON1376136933450.0
Kwal_56.238258.259ON1396138833260.0
KLTH0G13750g8.259ON1399140333250.0
TBLA0E044108.259ON1422137933180.0
TPHA0J007208.259ON1393142233140.0
KLLA0F19085g8.259ON1372137431260.0
CAGL0L12188g8.259ON1398142231070.0
TPHA0P003408.68ON121913116573e-69
Smik_6.718.68ON122813285781e-59
NDAI0G033208.68ON12317554468e-44
YFL008W (SMC1)8.68ON122510844414e-43
NCAS0C040008.68ON12232633752e-35
KAFR0C032008.68ON12238293691e-34
Kwal_23.50438.68ON12251773555e-33
KLTH0A02706g8.68ON12281583556e-33
Kpol_1011.58.68ON12212503539e-33
SAKL0B02288g8.68ON12281723521e-32
KNAG0G009108.68ON12262093441e-31
TBLA0G035308.68ON12322603361e-30
KLLA0D07502g8.68ON12438153342e-30
CAGL0F02079g8.68ON12232573314e-30
TDEL0C009608.68ON12222613262e-29
ZYRO0F03828g8.68ON12171683207e-29
Ecym_73038.68ON12221713162e-28
AGL023W8.68ON12222113082e-27
Smik_7.3467.186ON11707212921e-25
Kwal_55.204217.186ON11708752876e-25
KAFR0G029307.186ON11701902535e-21
AGR236W7.186ON11701902519e-21
ZYRO0D15642g7.186ON11701862511e-20
SAKL0F07282g7.186ON11702882483e-20
Suva_6.528.68ON12641902483e-20
KLTH0E04774g7.186ON11701892473e-20
CAGL0D05258g7.186ON11701882438e-20
KLLA0D16005g7.186ON11701922383e-19
Suva_6.1047.186ON11701902383e-19
YFR031C (SMC2)7.186ON11701902384e-19
Ecym_43907.186ON11709772375e-19
Skud_6.1197.186ON11701882341e-18
TDEL0D016201.295ON12237422341e-18
NCAS0E019207.186ON11701902313e-18
TPHA0C044407.186ON11701902269e-18
NDAI0G056301.295ON12297262232e-17
Kwal_14.24351.295ON12471942124e-16
Kpol_1018.21.295ON12112312106e-16
KAFR0A016101.295ON12271092107e-16
ZYRO0G21296g1.295ON12271082081e-15
TDEL0H026107.186ON1170862044e-15
SAKL0D06116g1.295ON12291152044e-15
TBLA0D046107.186ON11741542027e-15
Smik_10.1671.295ON12291161991e-14
NDAI0G020707.186ON1171791992e-14
Kpol_1063.207.186ON1171731992e-14
KNAG0L011607.186ON1170731972e-14
NCAS0A093301.295ON12271161972e-14
KLTH0H09966g1.295ON1224971972e-14
YJL074C (SMC3)1.295ON12301111964e-14
Suva_6.1491.295ON12301111937e-14
TPHA0I010901.295ON12161111937e-14
KLLA0A00286g1.295ON12248421883e-13
TBLA0C027401.295ON11191621873e-13
CAGL0H02805g1.295ON12191091874e-13
Ecym_63221.295ON12321091857e-13
Skud_10.1701.295ON12301111831e-12
KNAG0B052301.295ON12251891642e-10
Skud_6.648.68ON12301311597e-10
AAL182W1.295ON12313261491e-08
KNAG0L006307.101ON11081611274e-06
KLTH0D02816g7.101ON10941611194e-05
Kwal_26.72047.101ON11171881151e-04
TDEL0E013404.237ON1106851113e-04
SAKL0B09526g7.101ON10992411095e-04
CAGL0F01155g7.101ON11052421070.001
KAFR0D013307.101ON10802181060.001
ZYRO0G01584g7.101ON10881841050.001
Suva_15.1337.101ON10922381040.002
KLLA0F07997g7.101ON11192151040.002
ZYRO0B12122g4.237ON1109781030.003
NDAI0J021804.237ON11081541000.007
CAGL0H05071g4.237ON111076990.007
NCAS0J013904.237ON1096222990.008
Kpol_1044.137.101ON1103189990.009
Ecym_26257.101ON1097204990.009
Smik_15.1317.101ON1093175980.009
Skud_15.1217.101ON109388970.013
TPHA0B008404.237ON111968970.013
Skud_12.4684.237ON112068960.016
YLR383W (SMC6)4.237ON111468960.016
Suva_10.5004.237ON111568960.017
Smik_12.4704.237ON111468960.017
KNAG0B060104.237ON111768960.019
NDAI0A084507.101ON111962960.019
NCAS0I005707.101ON1095245950.020
YOL034W (SMC5)7.101ON1093206950.022
TBLA0I028904.237ON1098211950.025
TBLA0E021907.101ON1089159940.028
Ecym_53444.237ON110254940.032
TPHA0L006007.101ON111762940.032
AEL337C7.101ON1097186930.035
KLLA0E05303g4.237ON109892930.036
TDEL0H034907.101ON110380930.040
AER044W4.237ON110353890.12
KLTH0D14080g4.237ON1102142890.12
TBLA0A053001.67ON70763880.13
Kpol_483.104.237ON1118207880.15
SAKL0H03322g4.237ON111147870.22
Kwal_26.93804.237ON110285860.29
KAFR0A060404.237ON110268830.57
NCAS0B087001.67ON71572801.2
TDEL0G028102.351ON109463772.7
NDAI0F020906.161ON108473763.5
SAKL0F14894g7.488ON1297270763.6
KLTH0G05632g5.609ON74178754.3
CAGL0I02090g5.88ON113640755.8
SAKL0F04026g7.163ON113999747.3
ZYRO0F17050g1.67ON71456737.4
SAKL0G08316g5.373ON18433718.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B05000
         (1409 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  2608   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1476   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1459   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1453   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1442   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1438   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1437   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1434   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1404   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1395   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1370   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1360   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1321   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1293   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1285   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1285   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1282   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1281   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1208   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1201   0.0  
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   257   3e-69
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   227   1e-59
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             176   8e-44
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   174   4e-43
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   149   2e-35
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   146   1e-34
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   141   5e-33
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   141   6e-33
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   140   9e-33
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   140   1e-32
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   137   1e-31
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   134   1e-30
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   133   2e-30
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   132   4e-30
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   130   2e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   127   7e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   126   2e-28
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   123   2e-27
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   117   1e-25
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   115   6e-25
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   102   5e-21
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   101   9e-21
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   101   1e-20
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   100   3e-20
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   100   3e-20
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...   100   3e-20
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    98   8e-20
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    96   3e-19
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    96   3e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    96   4e-19
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    96   5e-19
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    95   1e-18
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    95   1e-18
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    94   3e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    92   9e-18
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    91   2e-17
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    86   4e-16
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    86   6e-16
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    86   7e-16
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    85   1e-15
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    83   4e-15
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    83   4e-15
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    82   7e-15
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    81   1e-14
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    81   2e-14
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    81   2e-14
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    80   2e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   2e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    80   2e-14
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    80   4e-14
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    79   7e-14
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    79   7e-14
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    77   3e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   3e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    77   4e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    76   7e-13
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    75   1e-12
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    68   2e-10
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...    66   7e-10
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    62   1e-08
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    54   4e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    50   4e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    49   1e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    47   5e-04
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    46   0.001
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   0.001
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    45   0.001
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    45   0.002
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    43   0.007
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.007
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    43   0.008
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    43   0.009
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    43   0.009
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    42   0.009
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    42   0.013
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.013
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.016
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.016
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.017
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.017
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.019
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.019
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    41   0.020
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.022
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    41   0.025
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    41   0.028
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    41   0.032
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.032
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    40   0.035
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.036
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.040
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.12 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    39   0.12 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.13 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    39   0.15 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.22 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.29 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    37   0.57 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    35   1.2  
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    34   2.7  
NDAI0F02090 Chr6 complement(509708..512962) [3255 bp, 1084 aa] {...    34   3.5  
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    34   3.6  
KLTH0G05632g Chr7 complement(447986..450211) [2226 bp, 741 aa] {...    33   4.3  
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    33   5.8  
SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa] ...    33   7.3  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   7.4  
SAKL0G08316g Chr7 complement(709133..709687) [555 bp, 184 aa] {O...    32   8.1  

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 2608 bits (6761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1304/1409 (92%), Positives = 1304/1409 (92%)

Query: 1    MSLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLI 60
            MSLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLI
Sbjct: 1    MSLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLI 60

Query: 61   LGQNDNRYAXXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXXXXXXXXXXLEL 120
            LGQNDNRYA              TLQPPDSSSSRGRKDIKSY               LEL
Sbjct: 61   LGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRRLEL 120

Query: 121  IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG 180
            IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG
Sbjct: 121  IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG 180

Query: 181  PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG 240
            PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG
Sbjct: 181  PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG 240

Query: 241  DTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEV 300
            DTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEV
Sbjct: 241  DTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEV 300

Query: 301  ENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVD 360
            ENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVD
Sbjct: 301  ENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVD 360

Query: 361  REKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEK 420
            REKNSLESGKNLALEF                YNLWQNNSKLTNTLQKISALNEEYNVEK
Sbjct: 361  REKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEK 420

Query: 421  SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXX 480
            SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ   
Sbjct: 421  SKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKA 480

Query: 481  XXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTS 540
                         SSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTS
Sbjct: 481  KTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTS 540

Query: 541  GISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA 600
            GISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA
Sbjct: 541  GISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTA 600

Query: 601  LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN 660
            LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN
Sbjct: 601  LKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN 660

Query: 661  VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQ 720
            VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQ
Sbjct: 661  VQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQ 720

Query: 721  QCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD 780
            QCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD
Sbjct: 721  QCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD 780

Query: 781  TLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDD 840
            TLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDD
Sbjct: 781  TLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDD 840

Query: 841  YNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSA 900
            YNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSA
Sbjct: 841  YNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSA 900

Query: 901  EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXXXXXXXX 960
            EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQD               
Sbjct: 901  EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEK 960

Query: 961  XXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSKNDITL 1020
               IGGIELQVQNSKVTSIVQRIDILTA              ELEKAKKTLLTSKNDITL
Sbjct: 961  IMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITL 1020

Query: 1021 ITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSF 1080
            ITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSF
Sbjct: 1021 ITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSF 1080

Query: 1081 EIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD 1140
            EIEV            HIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD
Sbjct: 1081 EIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSD 1140

Query: 1141 EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK 1200
            EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK
Sbjct: 1141 EQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEK 1200

Query: 1201 YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI 1260
            YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI
Sbjct: 1201 YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI 1260

Query: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320
            ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL
Sbjct: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320

Query: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1380
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ
Sbjct: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1380

Query: 1381 LVGIYKCENRTHSATIKNREILNSDINRE 1409
            LVGIYKCENRTHSATIKNREILNSDINRE
Sbjct: 1381 LVGIYKCENRTHSATIKNREILNSDINRE 1409

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1476 bits (3822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 795/1427 (55%), Positives = 994/1427 (69%), Gaps = 42/1427 (2%)

Query: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISP------INNSKSHTPR 57
            P +KRQK    E   PE   +D  A   L++  Q    +++  P       + +KSHTPR
Sbjct: 5    PLSKRQKRKAVEE--PELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHTPR 62

Query: 58   KLILGQNDNRYA-XXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXXXXXXXXX 116
            KL+L   +NRYA                LQPP  +SSRGR D K+Y              
Sbjct: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-GTSSRGR-DYKAYSQSPPRSPGRSPTR 120

Query: 117  XLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVVGPFHTSF 175
             LEL+QLSPVKN+R++L++LY++H S +K++ RLFIN+L L NFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 176  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAI 235
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L SCSV V F Y I
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 236  DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295
            DE  G ++I E KP LVI+RKAFKNNSSKYYINGKES+YT+VTKLLK EGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 296  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENR 355
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ + +IE+LNE+C+EKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 356  FEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEE 415
            FEIVDREKNSLESGK  ALEF                + + Q+NSKL +TL+KIS+LN++
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 416  YNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL 475
            +  EK K Q    ++   K    E + +I   +  EK  +  +R LEG  VSL+E+ KNL
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 476  TQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535
                              S     ++EL   Q E+  E++ LNQ L+ ER  L+ +KL L
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 536  KEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEV 595
            K+KT  IS EI+ HE +LEPW++++QEK+++IQL ES++SLL+E Q KLK +++ + +++
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 596  SNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEAR 655
              + A K + ++ ++NLKK+ SS+  E S GE   +    KL+EM+ VLN  RQRA EAR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 656  LALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVET 715
             +L+  QN+ KVLTAL KLQKSGRI GFHGRLGDLG IDN++DVA+STACPRLDD+VV+T
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 716  VECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFY 775
            VEC QQCI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFDL+KPKD KF  AFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 776  SVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQ 835
            SVLRDTLVA+ LKQAN VAYG++R+RVVT+DGKLID+SGT+SGGGNHVSKGLM L     
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895
            N  DDY PE+V +IE +LS++E NF +AN+  +EME EL+ L +++P IE +ISK  ME 
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXXX 955
            D+ ++E+   E+Q++E     ++ L D  ++ + ++NL++LK EH  LQ           
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 956  XXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSK 1015
                    IGG +LQ+QNSKV S+ QR+DIL A              ++ K +K L  S+
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1016 NDITLITDDIKEISERID--KISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEEN 1073
             D+ L ++++K I E++   K+  S N+I K  E F    E LK+E ++LK+ V + EEN
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDI-KMTETFNLRSE-LKEESEQLKEMVAETEEN 1078

Query: 1074 INEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAP 1133
            I+EFKS EIE+            HIK +I   E  LS+L++R +   L  LD        
Sbjct: 1079 IDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILD-------- 1130

Query: 1134 NNGTL----SDEQIHDQTGHELTNTAVQD-----------DD--SMDIDNGAEVISNGLP 1176
             N T+    +D +I      E  ++  QD           DD  SMDID  +  +  G+P
Sbjct: 1131 -NNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIP 1189

Query: 1177 ILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKR 1236
              S++EL  LDI L+E E+S+L  YI+ T+ +I VLEEY +RL EFK RKLDLN AV KR
Sbjct: 1190 RFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKR 1249

Query: 1237 ETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1296
            + V+ Q+E LKK R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS
Sbjct: 1250 DEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1309

Query: 1297 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369

Query: 1357 KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            KERTKNAQFIVISLRNNMFELAQQLVGIYK +NRT S T+KN +ILN
Sbjct: 1370 KERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1459 bits (3776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 786/1417 (55%), Positives = 999/1417 (70%), Gaps = 29/1417 (2%)

Query: 2    SLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQS---ISPINNSKSHTPRK 58
            ++P+ KRQKV E  S TPEQ  E+++ +    SPL R EHQQS   +SP   SKSHTPRK
Sbjct: 6    NIPSPKRQKVLE--SHTPEQQEENRREDDE--SPL-RFEHQQSAVSLSPPAISKSHTPRK 60

Query: 59   LILGQNDNRYAXXXXXXXXXXXXXXTLQPPDSSSS--RGRKDIKSYXXXXXXXXXXXXXX 116
            LIL Q+DNRYA              +LQPP++SSS  RGR+DIK Y              
Sbjct: 61   LILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTR 120

Query: 117  XLELIQLSPVKNNRI-KLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSF 175
             LELIQLSPVKNNRI KL+ELY   NSQ KKERLFINKL LNNFKSYAG+QV+GPF+T+F
Sbjct: 121  KLELIQLSPVKNNRIRKLQELY---NSQIKKERLFINKLVLNNFKSYAGEQVIGPFNTNF 177

Query: 176  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAI 235
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L SCSVDVEF Y +
Sbjct: 178  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVV 237

Query: 236  DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295
            D+ +G +KI + KPKL+I+RKAFKNNSSKY+INGKES+YT+VTKLLKEEGIDLDHKRFLI
Sbjct: 238  DKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLI 297

Query: 296  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENR 355
            LQGEVENIAQMKPKAE+E DDGLLEYLEDIIGT+ YK  IEK+ IE+++LNEICIEKENR
Sbjct: 298  LQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENR 357

Query: 356  FEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEE 415
            FEIV+REKNSLES KN ALEF                YN+ + + KL +TLQK+S L EE
Sbjct: 358  FEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEE 417

Query: 416  YNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL 475
            Y  E +K +  Q E N+ +    +   KI  ++ + K     KR L+ +  SL+EK+K+ 
Sbjct: 418  YQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSY 477

Query: 476  TQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535
            T+                 +  +EI+ L   Q+E    L++L  +L+ E+  LE +KL L
Sbjct: 478  TRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSL 537

Query: 536  KEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEV 595
            K+KT+ IS EI  HE +LEPW  ++QEKK EIQ+ ESQISLLQE Q KLK++I+ L  ++
Sbjct: 538  KDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDL 597

Query: 596  SNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEAR 655
              Q   K  +EE L++LK Q S+I+ E   GE+EC + +SK+K+M++VL  QRQ+  +AR
Sbjct: 598  KCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDAR 657

Query: 656  LALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVET 715
              LA V+N+ KVL+AL+KLQKSGRI GF+GRLGDLG IDN YD+A+STA  RLDDIVV++
Sbjct: 658  SRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDS 717

Query: 716  VECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFY 775
            VECGQ CIEYLRKNKLGYARFILL+KLR+     IQTP+NV RLFDL+KP    F+PAFY
Sbjct: 718  VECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFY 777

Query: 776  SVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQ 835
            SVLR+TLVAKDLKQANRVAYG  R+RVVT+DGKLID+SGT++GGG   ++GLM L++KGQ
Sbjct: 778  SVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQ 837

Query: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895
               D Y+ +D+E+IEK+L ++E NF+ AN+ ++EME  LQ+L +RKPE+ELEISK +M+ 
Sbjct: 838  ENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDT 897

Query: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIEN-LQKLKEEHLALQDXXXXXXXXX 954
            D  S E++S + QL++K        Q+ +E+ V IE+ L  L++E+  L D         
Sbjct: 898  DISSKELESTQDQLKQKITFYERHTQNKDEV-VEIEHQLNLLQKEYQLLLDSTKNISEKI 956

Query: 955  XXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTS 1014
                     IGGI+LQ+QNSKV SI+Q IDI+ +              E+ +++K L  +
Sbjct: 957  DKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGA 1016

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
            + D    + ++   S+ ++ +  SL +ID++  + +     L+ EC  LK+K+ + E   
Sbjct: 1017 ELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEG 1076

Query: 1075 NEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQV---------LMALD 1125
             +FKS+EI+V            HIK  IK  ++ L  L LR    +         +  +D
Sbjct: 1077 TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVD 1136

Query: 1126 EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSA 1185
              S       G    +Q      + + N     +  M+ID+ A+  S G+P +S  +L  
Sbjct: 1137 RTSHG----GGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQ 1192

Query: 1186 LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE 1245
            +D+  +E E+  LE+Y+  T+ NI+VLEEY +RL ++ +RKLDLN AV++RE ++K L+E
Sbjct: 1193 IDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLLDE 1252

Query: 1246 LKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1305
            LKK RY+EFM GFGIISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPKKSWR
Sbjct: 1253 LKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWR 1312

Query: 1306 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1365
            NI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Sbjct: 1313 NIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1372

Query: 1366 IVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            IVISLRNNMFELAQQL+GIYK +N+T SA I+N++ L
Sbjct: 1373 IVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1453 bits (3762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/1415 (54%), Positives = 993/1415 (70%), Gaps = 18/1415 (1%)

Query: 4    PNTKRQK---VTEPESKTPEQGT--EDQQANASLRSPLQRPEHQQSISPINNSKSHTPRK 58
            P +KRQK     EPE  + +QG   ED Q    +      PE        + SKS+TPRK
Sbjct: 5    PLSKRQKRKSAQEPEL-SLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPRK 63

Query: 59   LILGQNDNRYA-XXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXXXXXXXXXX 117
            L+L   +NRYA                LQPP  +SSRGR D KSY               
Sbjct: 64   LVLSSGENRYAFSQPTNSTTTSLHVPNLQPP-KTSSRGR-DHKSYSQSPPRSPGRSPTRR 121

Query: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVVGPFHTSFS 176
            LEL+QLSPVKN+R++L+++YD H S SK++ RLFIN+L L NFKSYAG+QVVGPFHTSFS
Sbjct: 122  LELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSFS 181

Query: 177  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAID 236
            AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP L SCSV V F Y ID
Sbjct: 182  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVID 241

Query: 237  EHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLIL 296
            E  G ++I E KP L+I+RKAFKNNSSKYYIN KES+YT+VTKLLK EGIDLDHKRFLIL
Sbjct: 242  ESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLIL 301

Query: 297  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRF 356
            QGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ + +IE+LNE+C+EKENRF
Sbjct: 302  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRF 361

Query: 357  EIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEY 416
            EIVDREKNSLESGK  ALEF                + L Q+NSKL +TL+KIS+ N++ 
Sbjct: 362  EIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDL 421

Query: 417  NVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLT 476
              EK K Q    +++  K    E + +I     +EK  +  +R LEG  VSL+E+ KNL 
Sbjct: 422  EDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLV 481

Query: 477  QXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLK 536
                             S   + ++EL   Q E+  E++ L Q L+ ER  L+ +KL LK
Sbjct: 482  SKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLK 541

Query: 537  EKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVS 596
            +KT  IS EI+ HE +LEPW++++QEK+++IQL ES++SLL+E Q KLK +++ L +++ 
Sbjct: 542  DKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKIL 601

Query: 597  NQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656
             +   K + ++ +++LKK+ +S+  E S GE        KLKEM+ VLN  RQRA EAR 
Sbjct: 602  AKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARS 661

Query: 657  ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETV 716
            +L+  QN+ KVLTAL +LQKSGRI GFHGRLGDLG ID+++DVA+STACPRLDD+VV+TV
Sbjct: 662  SLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDTV 721

Query: 717  ECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYS 776
            EC Q CI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFDL+KPK+ KF  AFYS
Sbjct: 722  ECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFYS 781

Query: 777  VLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQN 836
            VLRDTLVA++LKQAN VAYG++R+RVVT+DGKLID+SGTMSGGGNHV+KGLM L     +
Sbjct: 782  VLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQSD 841

Query: 837  YFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEID 896
              DDY PE+V++IE++LS++E NF +A++  +EME EL+KL + +P++E +ISK  ME D
Sbjct: 842  KVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEAD 901

Query: 897  TYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXXXX 956
            + ++E+   E+Q++E        + D  +L V ++NL++L+ E+  LQ            
Sbjct: 902  SLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIKG 961

Query: 957  XXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSKN 1016
                   IGGI+LQ+QNSKV S+ Q++DIL A              ++ K +K L  S+ 
Sbjct: 962  LQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSER 1021

Query: 1017 DITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINE 1076
            D+ L +D++K I E++     +L   D ++ E    K  LK++ ++LK+++ D+EE+INE
Sbjct: 1022 DVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESINE 1081

Query: 1077 FKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES----EAKA 1132
            FKS EIE+            +IK++I   E  L++L++R +   L  LD+      +   
Sbjct: 1082 FKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDV 1141

Query: 1133 PNNGTLSDE----QIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDI 1188
             NN  L  E    +  D++  +   T+  +   M+ID  ++ +S G+P LS+DEL  LD+
Sbjct: 1142 KNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELDV 1201

Query: 1189 TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK 1248
             L+E+++++L  Y+E T+ +I VLEEY +RL EFK RKLDLN+AV KR+ V++QL  LKK
Sbjct: 1202 ELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKK 1261

Query: 1249 TRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS 1308
             R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+
Sbjct: 1262 KRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1321

Query: 1309 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1368
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1322 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1381

Query: 1369 SLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            SLRNNMFELAQQLVG+YK +NRT S TIKN +ILN
Sbjct: 1382 SLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1442 bits (3733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 752/1409 (53%), Positives = 980/1409 (69%), Gaps = 25/1409 (1%)

Query: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILGQ 63
            P TKRQ+V + ES+      E +  N S +SPL         S  N++ SHTP+KL++G 
Sbjct: 5    PLTKRQRVNDNESR------EFEAVNGSTKSPL--------TSNSNSTISHTPKKLVIGT 50

Query: 64   NDNRYAXXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXXXXXXXXXXLELIQL 123
            ND+  +              +LQ P+SSS RGR+  ++Y               LELI++
Sbjct: 51   NDDTTSQSQPIVSSSSLQAPSLQHPNSSS-RGREQ-RTYSQSPPRSPGRSPTRKLELIKI 108

Query: 124  SPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNG 183
            SPVK NR++L+ LYDA  SQ    RL INKL L +FKSYAG+QVVGPFH+SFSAVVGPNG
Sbjct: 109  SPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNG 168

Query: 184  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTK 243
            SGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L SCSV+V F Y +DE DG T+
Sbjct: 169  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTR 228

Query: 244  ISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENI 303
            I E KP LV++RKAFKNNSSKYY+N KESNYT+VT+LLK+EGIDLDHKRFLILQGEVENI
Sbjct: 229  IDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENI 288

Query: 304  AQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREK 363
            AQM+PKAEKE +DGLLEYLEDI GT+KYK  IE  L EIE LNE CIEKENRF IVD+EK
Sbjct: 289  AQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEK 348

Query: 364  NSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKN 423
            +SLE+GK+ ALEF                Y +WQN+ KLT+TL K S L  + + E  K 
Sbjct: 349  SSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKY 408

Query: 424  QTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXX 483
                 E++  K    +   +I+ L  EEK  L  KR L+ + V+++EK+K++ Q      
Sbjct: 409  SETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAE 468

Query: 484  XXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGIS 543
                      ++  + ++EL +SQ +Y  EL+ LNQ+L +ER  LE +K+ LKEKT  IS
Sbjct: 469  KLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNIS 528

Query: 544  EEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKI 603
              I  +E DLEPW+ ++Q+K+ EIQL ES++SLL++   ++  DI+ L  E++     K+
Sbjct: 529  AGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKL 588

Query: 604  KREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQN 663
             +E+ +  LK+++S +T E+     EC+   ++LK+M  +L  QRQR  +AR A ++ QN
Sbjct: 589  AKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQN 648

Query: 664  RGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCI 723
            +  VLTAL KLQKSGRI GFHGRLGDLG ID  YDVA+STACPRL+DIVVE+VECGQQCI
Sbjct: 649  KSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCI 708

Query: 724  EYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLV 783
            EYLRKNKLGYARFILLDKLR F+T  IQTP+NVPRLFDL+KPKD KF+PAFYSVLRDTL 
Sbjct: 709  EYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLA 768

Query: 784  AKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNP 843
            A+ L QANRVAYG++R+RVV+LDGKLID+SGTMSGGG+HV +GLM L +      D ++P
Sbjct: 769  AQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSP 828

Query: 844  EDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIK 903
            E+V Q+E +L++KEK+F++A++ F EME++L+KL +R PEI+L++SK++ME +++ +E+K
Sbjct: 829  EEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELK 888

Query: 904  SKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXXXXXXXXXXX 963
             KE+ L E+          NEE ++A   ++ LK+E  AL D                  
Sbjct: 889  LKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIME 948

Query: 964  IGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSKNDITLITD 1023
            IGG ELQ+QNSKVTS +QR++ILT+              EL+K+ K +  ++ D+ L + 
Sbjct: 949  IGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQ 1008

Query: 1024 DIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIE 1083
            +I  + E  D +  +L +++KS++E Q     + ++ D+LK ++  +E    EFKS +IE
Sbjct: 1009 EIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIE 1068

Query: 1084 VXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDE---ESEAKAPNNGTLSD 1140
            +            HI  +++ LE  L+ L +R + + L  LDE    + +K PN      
Sbjct: 1069 INDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKR 1128

Query: 1141 EQIHDQTGHELTNTAV------QDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETE 1194
             +  D T  E   + V       +D+ M++D     + NGLP +S+ EL +LD+  +  +
Sbjct: 1129 TEGADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQ 1188

Query: 1195 VSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEF 1254
            + DL+ Y++S + ++E+LEEY KRL E K RK+DLN+AV +R+ +R++L ELKK R++EF
Sbjct: 1189 IEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEF 1248

Query: 1255 MHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGE 1314
            M GFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGE
Sbjct: 1249 MQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGE 1308

Query: 1315 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1374
            KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM
Sbjct: 1309 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1368

Query: 1375 FELAQQLVGIYKCENRTHSATIKNREILN 1403
            FELAQQLVGIYK +N T SA++KN +ILN
Sbjct: 1369 FELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1438 bits (3722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/1370 (55%), Positives = 960/1370 (70%), Gaps = 23/1370 (1%)

Query: 51   SKSHTPRKLILGQNDNRYA-XXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXX 109
            ++SHTPRKL+L   +NRYA                LQPP   SSRGR D K+Y       
Sbjct: 56   ARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-KVSSRGR-DYKAYSQSPPRS 113

Query: 110  XXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVV 168
                    LEL+QLSPVKN+RI+L++LYD+H S  K++ RLFINKL L+NFKSYAG+QVV
Sbjct: 114  PGRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVV 173

Query: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228
            GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL +CSV 
Sbjct: 174  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVA 233

Query: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288
            V F Y IDE  G ++I E KP LVI+R+AFKNNSSKYYIN KES+YT+VTKLLK+EGIDL
Sbjct: 234  VHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDL 293

Query: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348
            DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ L +IESLNEI
Sbjct: 294  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEI 353

Query: 349  CIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQK 408
            C+EK NRFEIVDREKNSLESGK  ALEF                + + Q+NSKL +TL+K
Sbjct: 354  CLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEK 413

Query: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468
            IS+LN E+  EK K Q    E++  K    + + +I      EK     KR LEG  VSL
Sbjct: 414  ISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSL 473

Query: 469  DEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528
            +E+ KNL                  S      QEL++ Q E+  E++ LNQ L+ ER  L
Sbjct: 474  EERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIIL 533

Query: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588
            + +KL LK+KT  IS +I+ HE + EPW++++QEKK++IQL ES++SLL+E + KLK + 
Sbjct: 534  DDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNA 593

Query: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648
            + L +++ ++   K + +  +++L ++  S+    S GE +      KLKEM+ +LN  R
Sbjct: 594  EALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHR 653

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708
            QRA EAR +L+  QN+  VLTAL KLQKSGRI GFHGRLGDLG IDN++DVA+STACPRL
Sbjct: 654  QRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRL 713

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768
            DD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFD++KPKD 
Sbjct: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDP 773

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
            KF  AFYSVL+DTLVA+DLKQAN+VAYG+RR+RVVT+DGKLID+SGTMSGGGNHV KGLM
Sbjct: 774  KFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLM 833

Query: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888
             L     +  +DY PE+V +IE +L+++EKNF +AN+  +EME EL+K+ +++P++E +I
Sbjct: 834  RLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQI 893

Query: 889  SKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXX 948
            S+  ME D+ ++E+   E+Q +E     +  + +  ++   ++NL+ L+ E+  LQ    
Sbjct: 894  SRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETR 953

Query: 949  XXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAK 1008
                           IGG +L  QNSKV S+ QRIDIL                ++ K +
Sbjct: 954  TKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQ 1013

Query: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068
            K L   + D  L ++++K I E++ +   +L   D ++ E    K  LKD+ ++LK+++ 
Sbjct: 1014 KQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLT 1073

Query: 1069 DLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMAL---- 1124
            ++EENI+EFKS EIE+            HIKN+IK  +  L+ L++R +   L  L    
Sbjct: 1074 EMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQ 1133

Query: 1125 ---------DEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGL 1175
                     DE+   +   +G   DE+I ++      + A  +  SM+ID  +  IS G+
Sbjct: 1134 MDVVEDGIKDEQDADQDKPSGIPDDEKIQEK------DDADNNHHSMNIDEMSSEISRGI 1187

Query: 1176 PILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDK 1235
            P L ++EL  LDI L+E+++S L  YI  T  +I VLEEYV+RL EFK RKLDLN AV K
Sbjct: 1188 PKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQK 1247

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1295
            R+ V++QLE LKK R++EFM+GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF
Sbjct: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307

Query: 1296 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1355
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1367

Query: 1356 IKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405
            IKERTKNAQFIVISLRNNMFELAQQL+GIYK +NRT S T+KN +IL  D
Sbjct: 1368 IKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1437 bits (3721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 759/1364 (55%), Positives = 957/1364 (70%), Gaps = 16/1364 (1%)

Query: 51   SKSHTPRKLILGQNDNRYA-XXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXX 109
            +KSHTPRKL+L   +NRYA                LQPP++ S RGR D K+Y       
Sbjct: 56   AKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPS-RGR-DYKAYSQSPPRS 113

Query: 110  XXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVV 168
                    LEL+QLSPVKN+RI+L++LYD+H    +++ RLFI+KL L NFKSYAG+QVV
Sbjct: 114  PGRSPTRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVV 173

Query: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228
            GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L SCSV 
Sbjct: 174  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVA 233

Query: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288
            V F Y +DE  G ++I E KP LVI+RKAF+NNSSKYYINGKESNYT VTKLLK EGIDL
Sbjct: 234  VHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDL 293

Query: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348
            DHKRFLILQGEVENIAQMK KAEKESDDGLLEYLEDIIGT+ YK LIE  L +IE+LNEI
Sbjct: 294  DHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEI 353

Query: 349  CIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQK 408
            C+EKENRFEIV+REKNSLESGK  ALEF                + L Q+NSKL +TL+K
Sbjct: 354  CLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEK 413

Query: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468
             S+LN+++  EK K Q    E++  +    E + ++     +EK     KR LE   VSL
Sbjct: 414  TSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSL 473

Query: 469  DEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528
            +E+ KNL                  S     ++EL   Q E+  E++ LNQ L+ ER  L
Sbjct: 474  EERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRIL 533

Query: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588
            + +KL LK+KT  IS EI+ HE DLEPW++++QEKK++IQL ES++SLL+E QVKLK + 
Sbjct: 534  DDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNA 593

Query: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648
            + L + ++ + A K + +  +++LKK   S+    S GE + +    KLKEM+ +LN  R
Sbjct: 594  EALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHR 653

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708
            QRA EAR +L+  +N+ KVLTAL +LQKSGRI GFHGRLGDLG ID+ +DVA+STACPRL
Sbjct: 654  QRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRL 713

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768
            DD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FN   + TP+NVPRLFDL+KPKD 
Sbjct: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDP 773

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
            KF  AFYSVLRDTLVA+DLKQAN VAYG+RR+RVVT+DGKLID+SGTMSGGGNHV KGLM
Sbjct: 774  KFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM 833

Query: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888
             + +   +  DDY PE+V +IE +LS++EKNF +AN+  +EME EL+K+ +++P++E +I
Sbjct: 834  RIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQI 893

Query: 889  SKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXX 948
             +  ME D+ ++E+   E Q++E     +  + D  +L   ++ L+ L+ E+  LQ    
Sbjct: 894  LRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETK 953

Query: 949  XXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAK 1008
                           IGG  LQ+QNSKV S+ QRIDIL A              ++ K +
Sbjct: 954  TKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQ 1013

Query: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068
            K L   + DI L ++++K I E+ ++I   L   D  +      K  L+++ ++LK+KV 
Sbjct: 1014 KQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVA 1073

Query: 1069 DLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALD--- 1125
            ++E  I+EFKS E+E+            +IK+ IK  E  L++L++R +   L+ LD   
Sbjct: 1074 EMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQ 1133

Query: 1126 ------EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILS 1179
                  E  + +  N   +S E   +  G E  N    D   M+ID  ++ +S G+P LS
Sbjct: 1134 MDILDKEGEDRQETNQEDISGEAKGETQGEEGDN---DDRHCMNIDETSDEVSRGIPRLS 1190

Query: 1180 DDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETV 1239
            +DEL  L+I L+E ++ +L  YI++T+ +I VLEEY +RL EFK RKLDLN AV KR+ V
Sbjct: 1191 EDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEV 1250

Query: 1240 RKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1299
            ++QLE LKK R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP
Sbjct: 1251 KEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1310

Query: 1300 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1359
            PKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1311 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1370

Query: 1360 TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            TKNAQFIVISLRNNMFELAQQLVG+YK +NRT S T+KN +ILN
Sbjct: 1371 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1434 bits (3711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1432 (53%), Positives = 978/1432 (68%), Gaps = 51/1432 (3%)

Query: 4    PNTKRQKVTEPESK-TPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILG 62
            P +K+QKV   E + TP Q  +D             PE    ++  +  KSHTPRKL+LG
Sbjct: 5    PLSKKQKVVSDEERITPNQNEQDNDKT--------HPE----VTASSFLKSHTPRKLLLG 52

Query: 63   QNDNRYAXXX-----XXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXXXXXXXXXX 117
              DN+Y                     LQPP S  SRGR D K+Y               
Sbjct: 53   SADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGR-DKKAYSQSPPRSPGRSPVRK 111

Query: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177
            LELIQLSP+KNNRI+L++LY++ N    K RL+I+KL L +FKSYAG Q+VGPF+TSFSA
Sbjct: 112  LELIQLSPIKNNRIELQKLYNSKNQN--KVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSA 169

Query: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FP++ SCSV+V F Y IDE
Sbjct: 170  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDE 229

Query: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297
            +DG +KI E +  LV+ RKAFKNNSSKYYINGKESNYT+VT+LLKEEGIDLDHKRFLILQ
Sbjct: 230  NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQ 289

Query: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357
            GEVENIAQMK KAEKE DDGLLEYLEDIIGTSKYK LIE  ++EIE+LNEIC+EKE RFE
Sbjct: 290  GEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFE 349

Query: 358  IVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYN 417
            IV+ EKNSLES K+ ALEF                Y L+Q N+KL  TL KIS       
Sbjct: 350  IVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQ 409

Query: 418  VEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ 477
             E+SK + +Q+EI+++ + L E+  KI     +E++ ++ KR  +G+ VS++E++KNLTQ
Sbjct: 410  EERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQ 469

Query: 478  XXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE 537
                                S +++L+  Q  Y  E   L ++L  ER  L+ +KL LK+
Sbjct: 470  KKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKD 529

Query: 538  KTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSN 597
            KT  IS +I ++E D+EPW  K+QEK+ +IQL ES+ISLL+E Q KLK  +  L  E+ +
Sbjct: 530  KTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDD 589

Query: 598  QTALKIKREED-----LVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRAS 652
                 +++E D     + NLKK+Q S+ KE+S GE+EC+  + K KEM+ +LN  RQRA 
Sbjct: 590  -----VRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAI 644

Query: 653  EARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIV 712
            +AR AL   +N+  VL+AL +LQKSGRI GFHGRLGDLG I + YD+A+STAC RLDDIV
Sbjct: 645  DARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIV 704

Query: 713  VETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVP 772
            V++VECGQQCIEYLRKNKLGYARFILLDKLR+F    +QTP+NV RLFDL++P D KF  
Sbjct: 705  VDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSN 764

Query: 773  AFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQR 832
            AFYSVLRDTLVA D++QANRVAYG+RRYRVVTLDGKLID+SGTM+GGG+HVSKGLM L+ 
Sbjct: 765  AFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKN 824

Query: 833  KGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKII 892
                + + Y   DVE+IE+DL+++E NF++A++   EM NEL++L +++PEIELEI+K++
Sbjct: 825  SNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLL 884

Query: 893  MEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXX 952
            M++D+ + ++  KE+QL+E        +   + L  A   LQ L+ EH AL+D       
Sbjct: 885  MDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKE 944

Query: 953  XXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLL 1012
                       IGG ELQ+QNSKV+S+ +RI I+ A              EL+K ++   
Sbjct: 945  KINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFK 1004

Query: 1013 TSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEE 1072
             ++ D T   +D++ +   +  I + L   +   +     K+ L  +C+ LK+K+ D+EE
Sbjct: 1005 QAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEE 1064

Query: 1073 NINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE----- 1127
            ++NE+KSFEIE+            + K  I++L   L    +R + Q L  +  E     
Sbjct: 1065 SMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNS 1124

Query: 1128 ------------SEAKAPNNGTLSDEQIHDQTGHELTN---TAVQDDDSMDIDNGAEVIS 1172
                        S +  PN     DE   +   ++  N      QD D MD+DN  E +S
Sbjct: 1125 VGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVS 1184

Query: 1173 NGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDA 1232
             G+P L+DD+L ++D+  +E+E++ L+ Y+E+++A+IE+LEEY++RL EFK RKLDLN  
Sbjct: 1185 KGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTT 1244

Query: 1233 VDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1292
            V +R+ VR +LE+LKKTR++EFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1245 VARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEG 1304

Query: 1293 VTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1352
            VTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1305 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1364

Query: 1353 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404
            ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T SAT+KN++ILN 
Sbjct: 1365 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1404 bits (3633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1371 (54%), Positives = 979/1371 (71%), Gaps = 18/1371 (1%)

Query: 44   SISPINNSKSH--TPRKLILGQNDNRYAXXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKS 101
            + S   N+ +H  TPRKL++G  DNRYA               LQPP ++SSRGR   K+
Sbjct: 38   TTSSSQNTFAHAKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQPP-ATSSRGRGS-KT 95

Query: 102  YXXXXXXXXXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKS 161
            Y               LELIQ+SP+KN+R++L+++YDA  +Q++  RL I++L L +FKS
Sbjct: 96   YSQSPPRSPGRSPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKS 155

Query: 162  YAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPD 221
            YAG+QVVGPF+TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE++P 
Sbjct: 156  YAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPS 215

Query: 222  LTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLL 281
            L SCSV+V F Y IDE  G+T+I E KP LV++RKAF+NN+SKYY+N +E+NY +VTKLL
Sbjct: 216  LPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLL 275

Query: 282  KEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIE 341
            K+EG+DLDHKRFLILQGEVENIAQMK KAE+E +DGLLEYLEDIIGT+KYK LIEK+L +
Sbjct: 276  KKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLAD 335

Query: 342  IESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSK 401
            +ESLN+ICIEKENRF+IVDREKNSLE+GK  AL F                Y++  +N K
Sbjct: 336  MESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMK 395

Query: 402  LTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRIL 461
            L NTL KI+ LN++   E  KN +++ E+++ +   +E +SK+K    EEKQ L  KR L
Sbjct: 396  LKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKREL 455

Query: 462  EGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQL 521
            +G++V  +EK+KN  +                SS  + + EL++ Q +Y + L+ LN+Q 
Sbjct: 456  DGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQT 515

Query: 522  QSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQ 581
            + E+  LE +K  LK+KT+GIS EI   E +LEPWN ++QEKKT+IQL ESQISL++E +
Sbjct: 516  EVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAE 575

Query: 582  VKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMK 641
             KL  +I    QE+  +    ++  ++L +L  Q  S+ +EIS GE EC + R +LKEM+
Sbjct: 576  AKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQ 635

Query: 642  NVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAV 701
            N+LN QRQ+A +AR AL+N +N+ KVLTAL +LQKSGRI GFHGRLGDLG ID  YDVA+
Sbjct: 636  NILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAI 695

Query: 702  STACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFD 761
            STACPRL+DIVVETVECGQQCIEYLRKNKLGYARFILLDKLR FN ++I TP++VPRLFD
Sbjct: 696  STACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFD 755

Query: 762  LIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGN 821
            LI PKD KF  AF+SVL +TLVA DLKQANRVAYG++R+RVVTLDG LID+SGTMSGGG+
Sbjct: 756  LIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGS 815

Query: 822  HVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRK 881
             VS+GLM + R      + Y+ E+V Q+E +L ++EKNF++A++  Y+ME +L+ L  ++
Sbjct: 816  RVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKE 875

Query: 882  PEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHL 941
            P IE  IS++ MEI+++++EIK KE Q+ E     ++   +N EL+  I+++Q LK+E  
Sbjct: 876  PAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFK 935

Query: 942  ALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXX 1001
            ++Q+                  IGG EL++Q+SKV S++QRIDI+ +             
Sbjct: 936  SIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTE 995

Query: 1002 XELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECD 1061
             E+ K+ K  L +  D+     +I+ +   I+ +  SLN + +S+   Q  KE L +E  
Sbjct: 996  NEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESR 1055

Query: 1062 ELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVL 1121
             L+DK+ D+ E+I  FKSFE+E+            H+K +IK  E+ L  L +R + Q+L
Sbjct: 1056 TLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQIL 1115

Query: 1122 MAL-DEESEAKAPNNGTLSD-EQIHDQTGH------------ELTNTAVQDDDSMDIDNG 1167
              L DE + A  P+   +SD E+     G             ++ +   Q D+ MD+++G
Sbjct: 1116 HDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDG 1175

Query: 1168 AEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKL 1227
             E    GL   S+DEL  ++I  +E E+ DL+ ++++++A+I+VLEEY +RL EFK+R+L
Sbjct: 1176 GEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRL 1235

Query: 1228 DLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLD 1287
            DLN AV++R  V+++L+ELKK R++EFM GFGIISMTLKEMYQMITMGGNAELELVD+LD
Sbjct: 1236 DLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLD 1295

Query: 1288 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
            PFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1296 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1355

Query: 1348 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKN 1398
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +N+T SATIKN
Sbjct: 1356 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKN 1406

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1395 bits (3611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/1428 (53%), Positives = 974/1428 (68%), Gaps = 31/1428 (2%)

Query: 4    PNTKRQKVTEPESKTPE--QGTEDQQANASLRSPLQRPEHQQSISPIN--NSKSHTPRKL 59
            P +KR K+ E      E     +DQ+ N   R  ++     Q  + ++  N KS TP+KL
Sbjct: 5    PLSKRPKLVEANLNANELDHNDDDQRYN---RQEIKVSPTTQDAAAVSHLNFKSQTPKKL 61

Query: 60   ILGQNDN-RYAXXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXX----XXXXXXXX 114
            IL   D+                  +L PP  SSSRGR   ++Y                
Sbjct: 62   ILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRT-ARTYSQSPPRSPARSPARSP 120

Query: 115  XXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTS 174
               LELIQLSPVKN+RI L+++Y++ N + + ERL I+KL L++FKSYAG QVVGPFH+S
Sbjct: 121  TRKLELIQLSPVKNSRIALQKIYESKN-EKQIERLCIDKLVLHDFKSYAGTQVVGPFHSS 179

Query: 175  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYA 234
            FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FPDL SCSV+V F Y 
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYV 239

Query: 235  IDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFL 294
            ID+ DG T I+  K KLVI+RKAFKNN+SKYYINGKESNYT VTKLLK+EGIDLDH RFL
Sbjct: 240  IDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFL 299

Query: 295  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKEN 354
            ILQGEVENIAQMKPKAE + DDGLLEYLEDIIGT+KYK LIEK   EIE+LNEICIEKEN
Sbjct: 300  ILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKEN 359

Query: 355  RFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNE 414
            RFEIVDREK SLESGK+ ALEF                Y LWQ+N KL+ TL+K+S + E
Sbjct: 360  RFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKE 419

Query: 415  EYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKN 474
            E+   K K+ T + ++N   +  +E    IK  + +EK+    KR  + E VSL+E+ KN
Sbjct: 420  EFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKN 479

Query: 475  LTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLK 534
            + +                S+   +I++L K++ EY  +L+ LN QLQ ER  LE +K+ 
Sbjct: 480  IMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKIS 539

Query: 535  LKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQE 594
            LK+KT   S+EI  HE +LEPWN+++Q KK++IQ+ ES+ISL++EG+VKL+NDI+ L+  
Sbjct: 540  LKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSL 599

Query: 595  VSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEA 654
            +S +   KI RE+++ +L+ + + ITKE+S G+TE  + + KL+EMK VLN  RQ+A +A
Sbjct: 600  ISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDA 659

Query: 655  RLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVE 714
            R +L+  +N+ +VL +L++LQKSGRI GF+GRLGDLG ID+ YD+A+STACPRL+D+VVE
Sbjct: 660  RTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVE 719

Query: 715  TVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAF 774
            TVECGQQCIEYLRKNKLGYARFILL+KLR+F+ N I TP NVPRLFDL+   D KF+PAF
Sbjct: 720  TVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAF 779

Query: 775  YSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKG 834
            YSVLRDTLV  +LK ANRVAYG +R+RVVTL G+LIDVSGTMSGGG   S+GLM L + G
Sbjct: 780  YSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSG 839

Query: 835  QNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIME 894
             + F  Y  EDVE+IEK+L+ +EKNFE+AN  F EME EL++L +RKP++ELEISK  +E
Sbjct: 840  NSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELE 899

Query: 895  IDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXX 954
            I ++  E +  ++QL EK    +  + +NEEL      L  L+ ++ +LQ          
Sbjct: 900  ITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRI 959

Query: 955  XXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTS 1014
                     +GGI+LQVQ+SKV SI+Q+ DIL                EL++  K     
Sbjct: 960  KFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSEC 1019

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
              D+   TD ++    ++ KIS SL+  +  + E +  +E      + LKD++ + EEN+
Sbjct: 1020 STDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEFEENL 1079

Query: 1075 NEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPN 1134
            N FK F++E              IK  I++ +  L  L +R +   L  LD  +  +   
Sbjct: 1080 NSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEE 1139

Query: 1135 NGTLSDEQIHDQTGHELTNTA-----------------VQDDDSMDIDNGAEVISNGLPI 1177
            + ++ D  +     + L N+                    +D  M+ID     IS G+P 
Sbjct: 1140 DVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPR 1199

Query: 1178 LSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRE 1237
            +S+DE   +D+  +E +   L+ YI++ + NI+VLEEY +R+ E+K RKLDLN+AVD+RE
Sbjct: 1200 ISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDERE 1259

Query: 1238 TVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1297
             VR+ L++LKKTR+EEFM GFG+IS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319

Query: 1298 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1357
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379

Query: 1358 ERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405
            ERTKNAQFIVISLRNNMFELA+QLVGIYK  N+T SAT++N +I+N D
Sbjct: 1380 ERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1370 bits (3547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1378 (53%), Positives = 949/1378 (68%), Gaps = 34/1378 (2%)

Query: 53   SHTPRKLILGQNDNRYAXXXXXXXXXXXXXXTLQPPDSSSSRGRKDI-KSYXXXXXXXXX 111
            S TPRKL+LG  + +YA               LQPP+   SRGR+   +S          
Sbjct: 52   SPTPRKLVLGSPEKKYAYSQPSTSSSLSVP-NLQPPNVDGSRGRRFYSQSPPRSPHRSPN 110

Query: 112  XXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKK--ERLFINKLTLNNFKSYAGQQVVG 169
                  LELIQLSPVKNNR +L+++YD  N    +   RL I+KL+L+NFKSYAG Q++G
Sbjct: 111  RSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIG 170

Query: 170  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDV 229
            PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +P+L SCSVD+
Sbjct: 171  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDI 230

Query: 230  EFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLD 289
             F Y +DE DG T+  + KP +VI+RKAF+NNSSKYYI+GKESNYT+VT+LL+++GIDLD
Sbjct: 231  HFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLD 290

Query: 290  HKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEIC 349
            HKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGT+KYK  IE  L+EI++LN++C
Sbjct: 291  HKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVC 350

Query: 350  IEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKI 409
            +EKENRFE+V++EKNSLESGK+ ALEF                Y++WQ+  KL+ TL KI
Sbjct: 351  VEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKI 410

Query: 410  SALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLD 469
            S LNE    EK+K    Q E+ + ++  N+ + ++  L+ E K     +R+++ E  S++
Sbjct: 411  SELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSME 470

Query: 470  EKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLE 529
            EK +NL +                +    +++EL  SQK+Y ++L  LN+ L  ER  L+
Sbjct: 471  EKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLD 530

Query: 530  AMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIK 589
             +KL L++KTS IS EI  HE DLEPWN ++QEKK++++L ESQI++L+E + K   +I 
Sbjct: 531  EIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNII 590

Query: 590  VLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQ 649
             L  E+         +E  +  L+ +Q++I K I  GE EC    SKL EMKNVL   RQ
Sbjct: 591  QLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650

Query: 650  RASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLD 709
            RA EAR  L+NV+N+ KVL+AL +LQ+SGRI GFHGRLGDLGTID+ YDVA+STACPRLD
Sbjct: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710

Query: 710  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSK 769
            DIVV+ VECGQQCIE+LRKNKLGYARFI+LDKLR FN + IQTP+ VPRLFDL++ K+ K
Sbjct: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770

Query: 770  FVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM 829
            F+PAFYSVLRDTLV  DLKQANRVAYG+RR+RVVTLDGKLID SGT+SGGG HV KGLM 
Sbjct: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLM- 829

Query: 830  LQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEIS 889
              +  Q     Y PE+V+ IEK+L+++EKNF +A   F++ME  L+K  +R+PEIE+EI+
Sbjct: 830  --KSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIA 887

Query: 890  KIIMEIDTYSAEIKSKERQLQE-KTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXX 948
            K  ++I++ S E+K K+ QL+E +T+ D   ++D  EL  A   LQ L EE+  +++   
Sbjct: 888  KRRLDIESSSTELKLKQEQLKELETDRDGGSVED-RELADAESKLQVLSEEYDEIENETK 946

Query: 949  XXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAK 1008
                           IGG +LQ+QNSKV SI ++I+I+++              +L++ +
Sbjct: 947  NKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLE 1006

Query: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068
                 + NDI     +I +IS    ++ + +  +D S+ E ++ KE +++E + +K  + 
Sbjct: 1007 NQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLE 1066

Query: 1069 DLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMAL---- 1124
            +   N ++FKS EIE+            HIK +IK  +D L+ L +R + Q L AL    
Sbjct: 1067 EKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGK 1126

Query: 1125 ------------DEESE------AKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDN 1166
                        DEE +      +  PN   + +EQ  +Q   + T+  +   DSMDID 
Sbjct: 1127 LPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEI---DSMDIDE 1183

Query: 1167 GAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRK 1226
                 SNGLP  S+ +L ++ I  VE ++ +L  Y+++   +I+VLEEY +RL E+K RK
Sbjct: 1184 YENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRK 1243

Query: 1227 LDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSL 1286
            LDLN AV KR+ VRK  EELKK R ++FM GF IISMTLKEMYQMITMGGNAELELVDSL
Sbjct: 1244 LDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSL 1303

Query: 1287 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            DPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDF
Sbjct: 1304 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDF 1363

Query: 1347 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T S T++N +ILN 
Sbjct: 1364 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNG 1421

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1360 bits (3519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1446 (51%), Positives = 979/1446 (67%), Gaps = 55/1446 (3%)

Query: 4    PNTKRQKVTEPESKTPEQG---------TEDQQANASLRSPLQR--PEHQQSISPINNSK 52
            P++K+++    ++ TP Q           +++  N + +S L    P+ Q S+SP++  K
Sbjct: 5    PSSKKRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPLDFKK 64

Query: 53   SHTPRKLILGQNDNRYAXXXXXXXXXXXXXX-TLQP---PDSSSSRGRKDIKSYXXXXXX 108
            + TPRKLI+G ++N+YA                LQ    P S  SRGR+ IK Y      
Sbjct: 65   TVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR-IKMYSQSPPR 123

Query: 109  XX----XXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQ-SKKERLFINKLTLNNFKSYA 163
                         LELIQLSP+KN+R++L++LYDAHN++  K  RL+I+KL L+NFKSYA
Sbjct: 124  SPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183

Query: 164  GQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLT 223
            G+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+F +L 
Sbjct: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243

Query: 224  SCSVDVEFLYAIDEH----DGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTK 279
             CSV+V F Y  DE+    DGDT   E +  LVI+RKAFKNNSSKY+INGKESN+T+VTK
Sbjct: 244  FCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301

Query: 280  LLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339
            LLKE+GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT  YK LIE+  
Sbjct: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361

Query: 340  IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNN 399
            +EIE++NE+CIEKENRF IVD EKNSLE  K+ ALEF                Y+L+ NN
Sbjct: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNN 421

Query: 400  SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459
             K+  TL +I +L  ++  EK ++     E+   +  ++ES++ +  L  EEK  ++ KR
Sbjct: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481

Query: 460  ILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQ 519
             +  + VSL+E  KNL Q                S    E+QE  + Q+EY  E+  L++
Sbjct: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSK 541

Query: 520  QLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQE 579
            Q + E + L  +KL+LK+KT   S+EI   E +LEP N ++QEKK++I+LVE +I L+++
Sbjct: 542  QREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601

Query: 580  GQVKLKNDIKVLSQEVSNQTALKIKR-----EEDLVNLKKQQSSITKEISNGETECNDGR 634
             + K+  +I+ L +E+     LK+++     E+D+ +L K + ++ KE   G+ EC D  
Sbjct: 602  SKRKVGAEIESLKEEL-----LKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAG 656

Query: 635  SKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTID 694
             KL EMK +LN  RQ+  EAR  ++  QN+ KVLT+L ++Q+SGRI GFHGRLGDLG I 
Sbjct: 657  VKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIA 716

Query: 695  NTYDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPK 754
            + YDVA+STACPRLDD+VVE+VECGQ CIE+LRKNKLGYARF++LDKL+ F+ + IQTP+
Sbjct: 717  DQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPE 776

Query: 755  NVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSG 814
            NVPRLFDL+KPK+ +F PA YSVLRDTLVAKDLKQANRVAYG+RR+RVVTLDG+LID+SG
Sbjct: 777  NVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISG 836

Query: 815  TMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENEL 874
            TMSGGG+ V KGLM L  K     + ++ ED++++E +L+ +EK F++A+  F+ ME EL
Sbjct: 837  TMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQEL 896

Query: 875  QKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQ 934
            +KL +R+P++ELEISK +++ID  + +I+    QL EK+N     ++D ++L + + NL+
Sbjct: 897  RKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLE 956

Query: 935  KLKEEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXX 994
             L +E   LQD                  IGG ELQ+QNSKV+S+ QRIDIL A      
Sbjct: 957  ALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSK 1016

Query: 995  XXXXXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKE 1054
                    EL+KA+K+L+ S  + T  T++I     R +   +SL +I+KS+E  Q  K 
Sbjct: 1017 TVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKI 1076

Query: 1055 TLKDECDELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTL 1114
             L+ E +   DK+ +  EN+NEFK+ ++E+            ++K +   L + L+   L
Sbjct: 1077 NLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRL 1136

Query: 1115 RKMHQVLMALDEESEAKA---PNNGT-------------LSDEQIHDQTGHELTNT--AV 1156
            R +   L  L EE   +A   P  GT              +D  + +     L+N+    
Sbjct: 1137 RDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVA 1196

Query: 1157 QDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYV 1216
             D+ SMD+D+  +++S G+P LSD ELS +D   +  E++ L+ +I +   NIE+LEEY 
Sbjct: 1197 SDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYA 1256

Query: 1217 KRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGG 1276
            KRL EFK RK+DLN++V +R  +   +EELKK RY EFM GF IISMTLKEMYQMITMGG
Sbjct: 1257 KRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGG 1316

Query: 1277 NAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1336
            NAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1317 NAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1376

Query: 1337 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK EN T +ATI
Sbjct: 1377 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATI 1436

Query: 1397 KNREIL 1402
            +NRE L
Sbjct: 1437 RNREDL 1442

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1321 bits (3420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1339 (52%), Positives = 914/1339 (68%), Gaps = 34/1339 (2%)

Query: 84   TLQPPDSSS-SRGRKDIKSYXXXXXXXXXXXXXXXLELIQLSPVKNNRIKLRELYDAHNS 142
            +LQPP +   SRGR     Y               +ELIQLSP+KN+R++L+ LYD    
Sbjct: 45   SLQPPVAHQISRGRS---QYSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDT--K 99

Query: 143  QSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 202
            Q K ERL I  L L NFKSYAG+QVVGPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRAN
Sbjct: 100  QKKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRAN 159

Query: 203  KMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNS 262
            KMRQ +LS LIHKSEK+PDL  CSV+++F Y +DE DG T++   KP+L + RKAFKNN+
Sbjct: 160  KMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNT 219

Query: 263  SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
            SKYY+NGKES YT+VT+LL++EGIDLDHKRFLILQGEVE+IAQMKPKAE E DDGLLEYL
Sbjct: 220  SKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYL 279

Query: 323  EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXX 382
            EDIIGT+KYK  IE+ L+E++SLN+IC+EKENRF++V++EK SLE GK+ AL F      
Sbjct: 280  EDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKD 339

Query: 383  XXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEI----NRTKQLLN 438
                      Y+L+ N SKL  TL  +S    +   EK+K    Q EI    + ++QL N
Sbjct: 340  LTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLAN 399

Query: 439  ESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTS 498
                ++  +    K+ L   R LE E VS +EK K+L Q                    +
Sbjct: 400  ----RLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCEN 455

Query: 499  EIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNI 558
            +I+E     +EY   L TLN  +   +  LE MKL L +KT  I++E+ + E +LEPW  
Sbjct: 456  KIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTN 515

Query: 559  KVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSS 618
            KV+EKK+EI+LVES+IS+++E  +KL+++I  LSQE+         REE +  L  + SS
Sbjct: 516  KVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSS 575

Query: 619  ITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSG 678
            I   I  GE EC   RSKL+EMK VL   RQR ++AR A+++ +N+ KVLTAL +LQKSG
Sbjct: 576  IRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSG 635

Query: 679  RIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFIL 738
            RI G+HGRLGDLGTID+ YD+A+STACPRLDDIVV+TVECGQQCIE+LRKNKLGYARFIL
Sbjct: 636  RIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFIL 695

Query: 739  LDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR 798
            LDKLR FN     TP+NVPRLFDL+KPK+ KF PAFYSVLRDTLV  DL QANRVAYG++
Sbjct: 696  LDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK 755

Query: 799  RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEK 858
            RYRVVTLDGKLID+SGTM+GGG+  + GLM    K       Y PE+V+++E++L+++EK
Sbjct: 756  RYRVVTLDGKLIDISGTMTGGGDRAASGLM----KSTQQSSLYTPEEVQRMEEELNEREK 811

Query: 859  NFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSK-ERQLQ-EKTNID 916
            NF++A   F EME+ LQ   +R+PEIE+E+SK  M+I+T SAE++SK ER+L+ E++N  
Sbjct: 812  NFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSN-- 869

Query: 917  NSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKV 976
             + ++D+ EL+ A E L  L  +  +                     IGG+ELQ  NSKV
Sbjct: 870  KTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKV 929

Query: 977  TSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKIS 1036
             S+ Q+I I+ A              EL++A+K  +T+K+DI     +I+++    D IS
Sbjct: 930  DSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTIS 989

Query: 1037 SSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXX 1096
            + +  + K + + Q    TL DE    K ++    E I+ + S EIE+            
Sbjct: 990  TGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLAN 1049

Query: 1097 HIKNQIKTLEDSLSKLTLRKMHQVLMALDEE------SEAKAPNN------GTLSDEQIH 1144
            ++K ++   +  LS L LR + QV++ L+E       S +  P+        ++ +  + 
Sbjct: 1050 YLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLA 1109

Query: 1145 DQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIES 1204
              + +E   +  +++ SM++D  A V+ NGLP L D EL+ +D+  +E ++  L+ YI++
Sbjct: 1110 SPSPNERKISIAENNLSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDN 1169

Query: 1205 TDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMT 1264
            +  +IE+L+EY KRL E++ R++DLN+A+ KR+  R   E LKK R +EFM GFGIIS+T
Sbjct: 1170 STVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISIT 1229

Query: 1265 LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVF 1324
            LKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVF
Sbjct: 1230 LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVF 1289

Query: 1325 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1384
            ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGI
Sbjct: 1290 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI 1349

Query: 1385 YKCENRTHSATIKNREILN 1403
            YK  N T S T++NR+I+N
Sbjct: 1350 YKNSNMTRSTTLQNRDIIN 1368

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1293 bits (3345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1369 (51%), Positives = 913/1369 (66%), Gaps = 29/1369 (2%)

Query: 55   TPRKLILGQNDNRY-AXXXXXXXXXXXXXXTLQPPDSSS-SRGRKDIKSYXXXXXXXXXX 112
            TP KL+ G    ++ A              +LQPP  S  SRGR     Y          
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRS---VYSQSPPRSPNR 71

Query: 113  XXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFH 172
                 +ELIQLSP+KN+R++L+++YD   + +K  RL I  L LNNFKSYAG QVVGPFH
Sbjct: 72   SPARRIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFH 129

Query: 173  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFL 232
            +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L+ CSV++ F 
Sbjct: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189

Query: 233  YAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKR 292
            Y +D+ DG+TK+     +L + RK FKNN+SKYYINGKES+YT+VT+ L+ EGIDLDHKR
Sbjct: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249

Query: 293  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEK 352
            FLILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGT+KYK  I   L+E+++LN+IC+EK
Sbjct: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309

Query: 353  ENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISAL 412
            E RFE+V++EK SLE+GK  ALEF                +++ +   KL  TL KISA 
Sbjct: 310  EIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAF 369

Query: 413  NEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKL 472
             E+   E++K   LQ EI   ++L +  + +I  +  E+ Q +K K  L+ E VS +EKL
Sbjct: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429

Query: 473  KNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMK 532
            K+L Q                    + I+ L ++Q E+ + L  LN+ L SER  L+A+K
Sbjct: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIK 489

Query: 533  LKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLS 592
            + L++KTS ISEE+   E +LEPW  K++ K ++I+L ES+I +++E ++KL+ +I  L 
Sbjct: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549

Query: 593  QEVSNQTALKIKREEDLVN-LKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRA 651
            +++ +    +I+  +  +N L+K+ ++IT  IS  + EC+  + KL +MK VL   RQR 
Sbjct: 550  KDIESYKD-RIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRM 608

Query: 652  SEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDI 711
            ++AR+AL+NV+N+ KVL AL +LQKSGRI GFHGRLGDLGTID+ YD+A+S ACPRLDDI
Sbjct: 609  TDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDI 668

Query: 712  VVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFV 771
            VVETVEC QQCIE+LRKNKLGYARFILLDKL+ FN   + TP+NVPRLFDL  PK+  F 
Sbjct: 669  VVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFA 728

Query: 772  PAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQ 831
            PA YSVLRDTLVAKDL QANRVAYG RR+RVVTLDGKLID+SGTMSGGG+ V KGLM   
Sbjct: 729  PALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLM--- 785

Query: 832  RKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKI 891
            +  Q   D Y  E+V+++E +L+D+E NF++A + F EME  LQK  +R+P I++EISK 
Sbjct: 786  KSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKH 845

Query: 892  IMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXX 951
             ++IDT S+E++SK+  L E  +   +  +DN  L+     L  L  E +AL+D      
Sbjct: 846  KIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKN 905

Query: 952  XXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTL 1011
                        IGG++LQ QNSKV S+ Q++ I+ A              E+ +A K  
Sbjct: 906  EQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQK 965

Query: 1012 LTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLE 1071
            L ++NDI     ++ + +   + +   L   +  IE  +  KE L  E +  K  + D  
Sbjct: 966  LGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKA 1025

Query: 1072 ENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES--- 1128
              + +FKS EIE+            HIK +I   ++ L+ L LR + Q+L  LDE +   
Sbjct: 1026 AYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPL 1085

Query: 1129 -----EAKAPNNGTLSDEQIHDQTGHELTNTA---------VQDDDSMDIDNGAEVISNG 1174
                  A  P+N  + +  + D         A           D +SMD+D  A  I  G
Sbjct: 1086 ESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPG 1145

Query: 1175 LPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVD 1234
            LP L++ EL  +DI  +  E++ L++Y+++  A+I++LEEY  RL E+K RKLDLN++V+
Sbjct: 1146 LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE 1205

Query: 1235 KRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1294
            KRE +R + E LKK+R EEFM GFGIISMT+KE+YQMITMGGNAELELVDSLDPFSEGV 
Sbjct: 1206 KREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVL 1265

Query: 1295 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1354
            FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1266 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1325

Query: 1355 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403
            YIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N T S T++N +ILN
Sbjct: 1326 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1285 bits (3326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/1388 (50%), Positives = 924/1388 (66%), Gaps = 60/1388 (4%)

Query: 51   SKSHTPRKLILGQNDNRYAXXXXXXXXXXXXXXTLQPPDS--SSSRGRKDIKSYXXXXXX 108
            S+S TPRKL+LG  D R+A               LQP  +  SSSRGR     Y      
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQPVSSSSSNVPH-LQPLKNELSSSRGR----VYSQSPPR 86

Query: 109  XXXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVV 168
                     LELIQLSP+K +R++ ++  ++       +RL I++L L+NFKSYAG QVV
Sbjct: 87   SPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVV 146

Query: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228
            GPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  PDL SC VD
Sbjct: 147  GPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVD 206

Query: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288
            + F Y  DE DG T I + KP +VI RKAF+NN+SKYY+NGKES+YT +T+LL++EGIDL
Sbjct: 207  IFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDL 266

Query: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348
            DHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGT++YK LIE  L EI  LN+I
Sbjct: 267  DHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDI 326

Query: 349  CIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQK 408
            C EKENRFEIV+REK+SLE GKN ALE+                Y+LW+N  KL +T +K
Sbjct: 327  CEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEK 386

Query: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468
            I+   E+ + EK+K      E+   K  L   +  +  L   EK+    KR  + + VSL
Sbjct: 387  IAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSL 446

Query: 469  DEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528
            +EKLKNLTQ                S+  ++++EL   Q+++  +L  LN  ++ E+E L
Sbjct: 447  EEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKL 506

Query: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588
            + +K  LK+K S ISE+I   E +LEPWN+K+QEKK +++L E+ IS+ +E   K++ DI
Sbjct: 507  DEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDI 566

Query: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648
             ++++ +        ++   + +L+K+Q  I ++++ G++EC++   K+KEMK +L   R
Sbjct: 567  ILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHR 626

Query: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708
            QR+ +AR +L+  +N+ KVL AL +LQ+SGRI GFHGRLGDLGTID+ YDVA+STACPRL
Sbjct: 627  QRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRL 686

Query: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768
            DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR+FN + I+TP+NVPRL+DL++P + 
Sbjct: 687  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNP 746

Query: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
            KF  AFYSVLRDTLVAKDLK+AN+VAYG++RYRVVTLDGKLID+SGTMSGGGN  ++G+M
Sbjct: 747  KFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM 806

Query: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888
              +++  + F     E+V+QI+K+LS++E NF++A +  +EME  LQKL +R+PEIEL+I
Sbjct: 807  KSEQQSNSAF---TAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDI 863

Query: 889  SKIIMEIDTYSAEIKSKERQ----LQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQ 944
            SK  ++ID+ S+E+K+ E +    LQEK   ++S    NEEL  A   L+ LK E+  L+
Sbjct: 864  SKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESS----NEELSTAEVKLKSLKSEYRELE 919

Query: 945  DXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXEL 1004
            +                  +GG +LQ+Q+S V S+ QRI I+ A              +L
Sbjct: 920  NEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLA-------KSKKTKTDL 972

Query: 1005 EKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELK 1064
            +KA+  +   +     + +++K  S+    I ++L++  K ++E       LKDE +  +
Sbjct: 973  KKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTE 1032

Query: 1065 DKVVDLEENINE-------FKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKM 1117
            ++V   EE+I+E       F++ EI+              +  +      SL+ L +R +
Sbjct: 1033 ERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDV 1092

Query: 1118 HQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDID------------ 1165
               L ALDE  E ++ N      E   +  G E    +    D MD+D            
Sbjct: 1093 TATLQALDESLENESKN------EVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEA 1146

Query: 1166 ----------NGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEY 1215
                      N  E + NGLP L +DEL   ++  VE E+  L+ Y+E+  A+IE+LEEY
Sbjct: 1147 QLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEY 1206

Query: 1216 VKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMG 1275
             +RL E+K RK+DLN AV +R+ VR+  E LKK R +EFM GF  I M LKEMYQMITMG
Sbjct: 1207 ARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMG 1266

Query: 1276 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1335
            GNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1267 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1326

Query: 1336 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT 1395
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N T S  
Sbjct: 1327 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVA 1386

Query: 1396 IKNREILN 1403
            ++N ++++
Sbjct: 1387 LQNTDLID 1394

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1285 bits (3325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1403 (51%), Positives = 938/1403 (66%), Gaps = 69/1403 (4%)

Query: 42   QQSISPINNSKSHTPRKLILGQNDNRYAXXXXXXXXXXXXXXTLQPPDS--SSSRGRKDI 99
            ++S+     S+S TPRKL+LG  D R+A               LQP  S  SSSRGR   
Sbjct: 23   EESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSSNVPY-LQPLKSELSSSRGR--- 78

Query: 100  KSYXXXXXXXXXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNF 159
              Y               LELIQLSP K  R++ ++           ERL IN+L+L+NF
Sbjct: 79   -VYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNF 137

Query: 160  KSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKF 219
            KSYAG QVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE  
Sbjct: 138  KSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAH 197

Query: 220  PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTK 279
            P+L SC V+V F Y  DE DG T + + +P LV++RKAFKNN+SKYY+NGKES+YT VT+
Sbjct: 198  PNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTE 257

Query: 280  LLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339
            LL++EGIDLDHKRFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGT+KYK LIE+ L
Sbjct: 258  LLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTL 317

Query: 340  IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNN 399
            ++I+ LN++C EKENR+EIV+REK+SLESGK+ ALEF                + LW+N+
Sbjct: 318  VQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNS 377

Query: 400  SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS---KIKVLEGEEKQQLK 456
             K TNT +KI  L E+ + E++K    + EI   KQL +ES+S    I+ ++  E     
Sbjct: 378  FKSTNTQEKIKTLEEKLSAERAKYTEHKREI---KQLESESKSLNVTIRGIKDSESSLTS 434

Query: 457  SKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELET 516
             KR  + + VSL+EKLKN++Q                ++  ++++EL K Q +Y  EL+ 
Sbjct: 435  EKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDE 494

Query: 517  LNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISL 576
            LN+ L  E+  L+ +K+ LK KT  IS +I   E +LEPWN+K+QEK+++I+L E++IS+
Sbjct: 495  LNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISV 554

Query: 577  LQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSK 636
            L+E   K+  +I     ++SN      ++ + +  L+K+ + I ++I  G+TEC++  +K
Sbjct: 555  LKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNK 614

Query: 637  LKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNT 696
            +KEMK VL   RQR+ +A+ +L+  +N+ KVL+AL +LQ+SGRI GFHGRLGDLGTID+ 
Sbjct: 615  MKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDK 674

Query: 697  YDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNV 756
            YDVA+STACPRLDD+VVETVECGQQCIE+LRKNKLGYARFILLDKLRSFN NTIQTP NV
Sbjct: 675  YDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNV 734

Query: 757  PRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTM 816
             RLFDL+ P D+KF  AFYSVLRDTLVAKDLK+ANRVAYG++R+RVVTLDGKLID+SGTM
Sbjct: 735  SRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTM 794

Query: 817  SGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQK 876
            SGGGNH + G+M  +R   N    +  E+V QI+++L+++E+NF++A +  +EME+ LQ 
Sbjct: 795  SGGGNHRASGMMKSER--LNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQS 852

Query: 877  LNNRKPEIELEISKIIMEIDTYSAEIK---------SKERQLQEKTNIDNSELQDNEELK 927
            L +R+PEIE +ISK  MEID+  +EIK          KE++L E +  D++ ++ N    
Sbjct: 853  LKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESS--DDTLIEAN---- 906

Query: 928  VAIENLQKLKEEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILT 987
                 L  LK E   L+                   IGG +LQ+Q S V SI QRI I  
Sbjct: 907  ---SRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITL 963

Query: 988  AXXXXXXXXXXXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIE 1047
                           +L++ +K       DI   T++++ I E    ISSS    D  I 
Sbjct: 964  GKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIKEL---ISSS----DNKIL 1016

Query: 1048 EFQAHKETLKDECDELKDKVVDLEENINE-------FKSFEIEVXXXXXXXXXXXXHIKN 1100
            E +A  + L+ E +E+++KV ++E  I E       F  FE+++            HI  
Sbjct: 1017 ELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGK 1076

Query: 1101 QIKTLEDSLSKLTLRKMHQVLMALD---------------EESEAKA--PNNGTLSD-EQ 1142
                L   L  L +R +   L  L+               + SEA++  P+NG L + + 
Sbjct: 1077 DGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDT 1136

Query: 1143 IHDQTGHELTNTAVQDDDSMDIDNGAEVIS--NGLPILSDDELSALDITLVETEVSDLEK 1200
            +    G+E   TA Q +D MD+D   E+ +  + LP L++ +L  L++  VE E+  L  
Sbjct: 1137 VEGCMGNE--PTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLND 1194

Query: 1201 YIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGI 1260
            ++E+  A+IEVLEEY KRL +F+ RKL+LN AV++R++VR+  + L+K R +EFM+GF  
Sbjct: 1195 FVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNT 1254

Query: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320
            ISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSL
Sbjct: 1255 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSL 1314

Query: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1380
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ
Sbjct: 1315 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1374

Query: 1381 LVGIYKCENRTHSATIKNREILN 1403
            LVGIYK  N T S  ++N++++N
Sbjct: 1375 LVGIYKNRNMTKSVALENKDLIN 1397

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1282 bits (3318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1379 (51%), Positives = 938/1379 (68%), Gaps = 14/1379 (1%)

Query: 35   PLQRPE-HQQSISPINNSKSHTPRKLILGQNDNRYAXXXXXXXXXXXXXXTLQPPDSSSS 93
            P Q  E H Q  S   + +S TPRKLI+   D+R+               +LQ P  S+ 
Sbjct: 49   PYQGQEKHIQPQSQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTG 108

Query: 94   RGRKDI-KSYXXXXXXXXXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFIN 152
            R  K   +S                LELIQLSP+KNNR +L+++Y+   +Q +  RL I 
Sbjct: 109  REHKFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIE 168

Query: 153  KLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 212
            +L L NFKSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DL
Sbjct: 169  RLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDL 228

Query: 213  IHKSEKFPDLTSCSVDVEFLYAIDEHDGD-TKISETKPKLVISRKAFKNNSSKYYINGKE 271
            IHKSEK+P+L+SCSV++ F Y ID+ +G  +KI E+K KLV+ RKAFKNNSSKYYIN KE
Sbjct: 229  IHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKE 288

Query: 272  SNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKY 331
            S++T VT LLK EGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGTS Y
Sbjct: 289  SSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHY 348

Query: 332  KQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXX 391
            K  IE +L ++E+LNEICIEKENRF IV++EK+SL  GKN AL++               
Sbjct: 349  KVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKY 408

Query: 392  XYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEE 451
             + L+ +N KLT+TL KI+   E Y+ E  K  T+  E+   K L +E  +  K L   +
Sbjct: 409  QHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKEL---KNLQDEEITLNKRLNETK 465

Query: 452  KQQ---LKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQK 508
            K +   L ++R    E +S  E +KN+ +                +   ++++ L   Q+
Sbjct: 466  KYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQE 525

Query: 509  EYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQ 568
            +Y+ ++E LN++L+ E+  LE +K+ LK KT   S EIL +E +LEP+ I++QEK ++IQ
Sbjct: 526  DYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQ 585

Query: 569  LVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGET 628
            L++S+ISLL E +  L N+I  + + +  +    ++  E +   K+Q     KE+ +G+ 
Sbjct: 586  LLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDI 645

Query: 629  ECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLG 688
            E N    K++EM++ L+  RQ+A+++R +L+NVQN+  VLTAL+KLQKSGRI GF+GRLG
Sbjct: 646  EFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLG 705

Query: 689  DLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTN 748
            DLG ID  YDVA+STACPRL+D+VV++V+CGQQCI+YLRKN+LGYARFILLDKLR FN N
Sbjct: 706  DLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLN 765

Query: 749  TIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGK 808
             I+TP N PRLFDLI+ ++ KF+PAFYSVLRDTLVA +L  AN+VAYG+RR+RVVTLDGK
Sbjct: 766  RIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGK 825

Query: 809  LIDVSGTMSGGGNHVSKGLMML-QRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAF 867
            LID+SGTMSGGGN+V +GLM L Q   +N F+  +PE+V+++E++L   EKNF++A N+ 
Sbjct: 826  LIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSL 885

Query: 868  YEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELK 927
             EM  E+  +  + P  EL ISK  +EI+    EIK    QL+EK  I + E  +N+E+K
Sbjct: 886  KEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIK 945

Query: 928  VAIENLQKLKEEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILT 987
            VA + LQ LK+E+ +L D                   GGIEL++QNSKVTS+V ++ I+ 
Sbjct: 946  VADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVN 1005

Query: 988  AXXXXXXXXXXXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIE 1047
            +               L+K +  L T+K++      +++   +++  +S  L  ++  I 
Sbjct: 1006 SKQKNDKSAIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDIN 1065

Query: 1048 EFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLED 1107
            + Q  KE +    D  K+K  +LEE+   FKSFE+E+            H++ QI  L+ 
Sbjct: 1066 DTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDT 1125

Query: 1108 SLSKLTLRKMHQVLMALDEESEA-KAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDN 1166
             L+ LT+R++ Q L + DE  E      NG   D Q    T   L + +  + D+MDID+
Sbjct: 1126 ELNALTIREISQNLESFDERLEKYDISKNGATEDTQ---HTSSALNSVSNINTDTMDIDS 1182

Query: 1167 GAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRK 1226
                I+ G+  LS+ E++ LDI  ++ E+ +LE+ +E + ANIE+LEEYV+RL+E+K RK
Sbjct: 1183 TDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRK 1242

Query: 1227 LDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSL 1286
             DL++++ ++ET +++ E LKK R EEF  GF IIS+TLKEMYQMITMGGNAELELVDSL
Sbjct: 1243 SDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSL 1302

Query: 1287 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1303 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1362

Query: 1347 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405
            RNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK EN T SAT+ N ++LN D
Sbjct: 1363 RNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRD 1421

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1281 bits (3314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1422 (50%), Positives = 950/1422 (66%), Gaps = 55/1422 (3%)

Query: 2    SLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLIL 61
            +LP+ K+QKV + ES +P      + A +   SPLQ         P+   KS+TP K+I+
Sbjct: 3    ALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVAN-----DPL---KSYTPMKVII 54

Query: 62   GQN-DNRYAXXXXXXXXXXXXXXTLQPPDSSSSRGRKDIKSYXXXXXXXX----XXXXXX 116
              N  N  +              +LQ P SSSSRGR  +K+Y                  
Sbjct: 55   SNNHSNSISPLPSQLMSSSTQPPSLQHP-SSSSRGRA-VKAYSQSPPRSPDRSPVRSPTR 112

Query: 117  XLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFS 176
             LELIQLSP+KN+R +L+++Y +   + K ER+ +NKL L+NFKSYAG Q +GPFH+SFS
Sbjct: 113  KLELIQLSPIKNSRSELQKIYSSK-QEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFS 171

Query: 177  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAID 236
            AVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE++PDLTSC+VDV F Y ID
Sbjct: 172  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID 231

Query: 237  EHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLIL 296
              D  TKI+ +K  L+I+R+AFKN++SKYY+NGKESNY  +T LLKEEGIDLDH RFLIL
Sbjct: 232  YPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLIL 291

Query: 297  QGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRF 356
            QGEVENIAQMKPKAEKE DDGLLEYLEDIIGT+KYK+LI+K  IEIE+LN+ICIE+ENRF
Sbjct: 292  QGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRF 351

Query: 357  EIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEY 416
            +I+DREK SLES K  ALE+                Y +WQNN KL+NTL+KI+ L +EY
Sbjct: 352  DIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEY 411

Query: 417  NVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLT 476
            N EK+KN  L+N+I+  ++L  ++Q +++ L  +EK+ + +KR L+ ++VS  E+LKN+ 
Sbjct: 412  NQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIE 471

Query: 477  QXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLK 536
            +                SS    ++    ++K +  +L  L+  L +E + LE +KL LK
Sbjct: 472  KKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLK 531

Query: 537  EKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVS 596
            +KT G+SEEIL  E DLEPWNIK+ E K+EIQ+ ES+ +L +E + KLK +I+ L ++V+
Sbjct: 532  DKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVN 591

Query: 597  NQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARL 656
             ++ L   R +++ NL  +  +++KE+  G  E      KL EM+ +L   RQ+A++AR 
Sbjct: 592  EKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDART 651

Query: 657  ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETV 716
            +L+NV+NR KVL AL KLQKSGRI GFHGRLG+LG ID  YDVA+STACPRL+DIVV++V
Sbjct: 652  SLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSV 711

Query: 717  ECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYS 776
            ECGQQCIEYLRKN LG+ARFILLDKL  F+   I TP+NVPRLFDLIK  D KF+PAFYS
Sbjct: 712  ECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYS 771

Query: 777  VLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQN 836
            VLR+TLVA DLK+AN VAYG+ RYRVVTL G LID+SGTMSGGGN  SKG M L      
Sbjct: 772  VLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNSTSK 831

Query: 837  YFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEID 896
                Y+ E+V +IEK+LS +EKN++ A N   EME EL+ L   +P+IELEISK+  EID
Sbjct: 832  EKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEID 891

Query: 897  TYSAEIKSKERQLQEK--------------TNIDNSELQDNEELKVAIENLQKLKEEHLA 942
            +   E   K +QL E               T +DN+    NE+ K+ IE+  K K++ + 
Sbjct: 892  SLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKL-IESQMKSKKDRIK 950

Query: 943  -LQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXX 1001
             LQD                  IGGI+LQ+QNSKV S+ ++  IL               
Sbjct: 951  ELQD--------------KIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIE 996

Query: 1002 XELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECD 1061
             ++ K  K L  S++D T + +    +   +  I   L   + ++   Q  K TL+++ +
Sbjct: 997  SDVRKLSKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSE 1056

Query: 1062 ELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVL 1121
               +++ ++E  ++EFK+ E+E              IK  +K LE+  S L++R++   L
Sbjct: 1057 ITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDL 1116

Query: 1122 MALD-EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSD 1180
              L+ +E EA+       +D        +++ N      D M I++    I+ G+P   +
Sbjct: 1117 DLLNIKEQEAQKIKTELYAD--FEQNQSNDVIN------DEMIIEDNNNEIAKGIPSYME 1168

Query: 1181 DELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVR 1240
             +    DI+ +E E+  L+ Y E    ++++LEEY +R+ E++ RK DLN +V++R+ VR
Sbjct: 1169 SDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVR 1228

Query: 1241 KQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1300
            K+LE+LKK R+ EFM  F IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPP
Sbjct: 1229 KELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPP 1288

Query: 1301 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1289 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1348

Query: 1361 KNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            KNAQFIVISLRNNMFELA+QLVGIYK  N+T SAT+KN +IL
Sbjct: 1349 KNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1208 bits (3126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1374 (49%), Positives = 904/1374 (65%), Gaps = 40/1374 (2%)

Query: 48   INNSKSHTPRKLILGQNDNRYAXXXXXXXXXXXXXX---TLQPPDSSSSRGRKDIKSYXX 104
            ++ S + TPRKL+LG  + +YA                 +LQPP + + RGR+  +S   
Sbjct: 21   VSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQSPPR 80

Query: 105  XXXXXXXXXXXXXLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAG 164
                         LELI+LSP K+ R++L+++++A+   S  +RL I+KL LNNFKSYAG
Sbjct: 81   SPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTS--QRLCIDKLVLNNFKSYAG 138

Query: 165  QQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTS 224
             Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+FP L S
Sbjct: 139  IQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLAS 198

Query: 225  CSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEE 284
            CSV + F Y  D  +G+TKI  +   +V+ R+AFKNNSSKYY+NGKESNYT+VT+LLKEE
Sbjct: 199  CSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEE 258

Query: 285  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIES 344
            GIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGT+K+K  IEK L EIE+
Sbjct: 259  GIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIET 318

Query: 345  LNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTN 404
            LNE+C+EKENRFE+VD+EK +LESGK  ALEF                  ++ +N KL  
Sbjct: 319  LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLAT 378

Query: 405  TLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGE 464
            +  KISALN E+  EKS+ + LQ E       +N ++ +   LE E K     KR LE +
Sbjct: 379  SCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD 438

Query: 465  HVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSE 524
             ++ DEKLK++ +                 +  +EI+ L+K+  +   EL  LN  +  E
Sbjct: 439  FIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIE 498

Query: 525  RESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKL 584
            +E L  +K+ L EKT  +S+E+   E  LEP+  ++QEK++EI+L E++I++L+     L
Sbjct: 499  KEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNL 558

Query: 585  KNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVL 644
              +   +  ++ +    ++K++E   +L+ ++S +   IS  + EC + + +  EM++VL
Sbjct: 559  LKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVL 618

Query: 645  NMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTA 704
              QRQ   EA+  L   QN+ +VL AL KLQ SGRI GFHGRLGDLGTID+ YD+A+STA
Sbjct: 619  IQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTA 678

Query: 705  CPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIK 764
            CPRLDDIVVETVECGQQCI++LRKNKLGY RFILLDKLR  N + I TP+NVPRLFDLI 
Sbjct: 679  CPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLIT 738

Query: 765  PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVS 824
            P    F PAFYSVLRDTLVA+DL+QANRVAYG+RR+RVVTLDGKLID+SGTMSGGG+   
Sbjct: 739  PVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQ 798

Query: 825  KGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEI 884
             GLM   R        Y+ ++VE++E  LS KE N+  A +  +EME+ LQKL +R PEI
Sbjct: 799  SGLM---RSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEI 855

Query: 885  ELEISKIIMEIDTYSAEIKSKERQLQE-----KTNIDNSELQDNEELKVAI--ENLQKLK 937
            +++ISKI +E  +  AE++S  ++L +       N  N +   +EE K+ I  ++LQ+  
Sbjct: 856  DIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTI 915

Query: 938  EEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXX 997
            +     QD                   GGIEL++Q +KV S+ Q I+IL           
Sbjct: 916  DASKFSQDKIDDLKDRIMQK-------GGIELKMQIAKVASLEQHIEILHEKQKKEKTRS 968

Query: 998  XXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLK 1057
                 +L +A +       ++ +   DI  +SE+++ I      I++ + E    K  L 
Sbjct: 969  KKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELN 1028

Query: 1058 DECDELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKM 1117
               ++LK +++ +E + NEFK+ E+E             ++K Q+++ E SL  L +R +
Sbjct: 1029 SSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDV 1088

Query: 1118 HQVLMALDE-------ESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEV 1170
             ++L  L++       +  AK  N   +  + I D          V ++D+M+ D+G   
Sbjct: 1089 SKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITD----------VGNNDAME-DSGEAA 1137

Query: 1171 ISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLN 1230
              +GLP L++ EL  LD+  +E E+  L+ Y+++ + +IEVLEEY +RL E++ RKLDLN
Sbjct: 1138 THSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLN 1197

Query: 1231 DAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFS 1290
             AV KRE VR + E  K  R E+FM GFGIISMTLKEMYQMITMGGNAELELVDSLDPFS
Sbjct: 1198 QAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFS 1257

Query: 1291 EGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1350
            EGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1258 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1317

Query: 1351 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404
            IVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK  N T S T++N +IL+S
Sbjct: 1318 IVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHS 1371

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1422 (48%), Positives = 918/1422 (64%), Gaps = 54/1422 (3%)

Query: 4    PNTKRQKVTEPESK-----TPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRK 58
            P +KRQKVTE + +     TP+  T +Q                   SP    ++ TPR 
Sbjct: 5    PVSKRQKVTEEDEEEDVIHTPKAVTFEQ-------------------SP----RAITPRN 41

Query: 59   LILGQNDNRYAXXXXXXXXXXXXXXTLQPPDS-SSSRGRKDIKSYXXXXXXXXXXXXXXX 117
            L+  +N N                 +L PP+S  S+RGR D KSY               
Sbjct: 42   LLGSENRNVLPTGGSQNLQIP----SLLPPESLGSARGR-DFKSYSQSPPRSPGRSPTRR 96

Query: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177
            L+LI+LSP+KN+R +L++LY++     KKERLFI++L LN+FKSYAG+QV+GPFHTSFSA
Sbjct: 97   LKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSA 156

Query: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL SCSV+V F Y ID+
Sbjct: 157  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDK 216

Query: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297
             DG T I ETK  LV++RKAFKNN+SKY++NGKESNYT+VT LLK+EGIDLDHKRFLILQ
Sbjct: 217  DDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQ 276

Query: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357
            GEVENIAQMK KAEKE+DDGLLEYLEDIIGTSKYK+ IEK  +EIESLNEIC+EKENRF 
Sbjct: 277  GEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFS 336

Query: 358  IVDREKNSLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYN 417
            IV+REKNSLESGK  AL+F                YNL Q+N KL + L K + + +E  
Sbjct: 337  IVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQT 396

Query: 418  VEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ 477
             ++ + +   + I+     LN  ++ ++ +  EE    K+KR LE + V  ++ + NL  
Sbjct: 397  KQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDS 456

Query: 478  XXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE 537
                            +S   EIQ + + Q   ++    L+  L  E+E LE +KLKL+E
Sbjct: 457  KRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLRE 516

Query: 538  KTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSN 597
            KT  ++ +I  +E +L PWN + Q+ K EI++ ES++S+++E +  L+NDI  L   + +
Sbjct: 517  KTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILS 576

Query: 598  QTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLA 657
            Q      +E+++ +L +Q++ + +E   GE EC + ++ L  ++  +   RQ+A E R  
Sbjct: 577  QKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRST 636

Query: 658  LANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVE 717
             +  +N  KVL+AL +LQKSGR+ GFHGRLGDL  ID  YDVA+STACPRL+D+VV+TVE
Sbjct: 637  YSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVE 696

Query: 718  CGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSV 777
             GQQCIEYLRKNKLGYARFILLDKL +FNTN I TP    RLFDLI  K+ +F  AFYSV
Sbjct: 697  SGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSV 756

Query: 778  LRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNY 837
            LRDTLV ++++QANRVAYG++RYRVVTLDG LID+SGTM+GGG +VSKGLM L +     
Sbjct: 757  LRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKG 816

Query: 838  FDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDT 897
               ++PE+V+ IE +L+ KE  ++ A +A++EME EL++L +R PEI+  +SK  M+I+T
Sbjct: 817  SAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIET 876

Query: 898  YSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQD---XXXXXXXXX 954
               +I S    L+EK     S    N+    +I  L KLKE    L D            
Sbjct: 877  AHNDINSNINVLEEKRKKLESMKNQNDP---SITLLAKLKELKSKLDDIDVQTKSTKDKI 933

Query: 955  XXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTS 1014
                     +GG EL+ Q+  VT I  +I   +                L+K  K L  +
Sbjct: 934  KTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEA 993

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
              ++T  + + +       +I S L +I +SIE  + ++  L+ E +   +++   ++ +
Sbjct: 994  NEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVV 1053

Query: 1075 NEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE------- 1127
            +++KS  +E              +K  IK   D LS+LT+R + QVL  +  E       
Sbjct: 1054 SDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDK 1113

Query: 1128 SEAKAPNNGTL---SDEQIHDQTGHELTNTAVQDDD----SMDIDNGAEVISNGLPILSD 1180
            S+ K  N   +    D+ I   + ++  N   ++DD     M+ID+    I+ G+P+LS 
Sbjct: 1114 SDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSA 1173

Query: 1181 DELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVR 1240
             EL+ +D   VE  ++ L+ +I S++AN++VLEEY  R  EF  RK DLN AV  R++V+
Sbjct: 1174 SELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVK 1233

Query: 1241 KQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1300
             +LE +K+ RY+EFM GF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPP
Sbjct: 1234 DRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPP 1293

Query: 1301 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1294 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1353

Query: 1361 KNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402
            KNAQFIVISLRNNMFEL +QLVGIYK EN T SA + N +++
Sbjct: 1354 KNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  257 bits (657), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 341/1311 (26%), Positives = 603/1311 (45%), Gaps = 175/1311 (13%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7    LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 214  HKSEKFPDLTSCSVDVE---FLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGK 270
            ++     D      D E   ++ A  E DG          + + R       S Y I+ K
Sbjct: 67   YRDIASADENEFGEDGERSAYVKAFYEKDGTV--------VELMRAITAGRDSVYKIDNK 118

Query: 271  ESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSK 330
             + Y   +  L  E I +  + FL+ QG+VE IA   P+        L +  E++ G+ K
Sbjct: 119  TTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPRQ-------LTKLFEEVSGSIK 171

Query: 331  YKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXXXXXX 390
            YK+  E+   +IE L+E   E       +  E    E G +   ++              
Sbjct: 172  YKKEYEELKEKIEKLSESAAESAKNRRRIQGEMKIYEDGISKDEKYKKQLEVRDKLQVHL 231

Query: 391  XXYNLWQ-------NNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSK 443
              + L+        +  KL     K+  L ++ N E++  +  +NE+ +   L  + Q++
Sbjct: 232  ALWQLFHLEQEEKLSTKKLKEVKNKVMKLTDQVNEEETNVKKAKNEVIKETSLQMKQQNR 291

Query: 444  IKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQEL 503
            +   E E+   L     ++    S +++L N+ +                S    +++ +
Sbjct: 292  LDYKEKEKDNLLSELTPIQLSQRSAEKRLANIEKRIESIARDMERQKTYVSRYEKQLKVV 351

Query: 504  EKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEK 563
            +K++  + +EL+  N      R + E MKL  +     ++E     +  L   N + ++ 
Sbjct: 352  KKTKDTFEEELKQSNSNPDKYRLNDEDMKLYERLNEQYLTEGGFELDTKLSLLNNEKKDI 411

Query: 564  KTEIQLVESQISLLQ-----EGQVKLKN-DIKV--LSQEVSNQTALKIKREEDLVN-LKK 614
              E++L++ +I + +     E  VK +N +++   LS E++ + +L +    +L N LKK
Sbjct: 412  DDELELLQKRIDMSKNRITDEFAVKGENFELQAVELSSELNEKNSLHL----NLANKLKK 467

Query: 615  QQSSITKEISNGETECNDG-RSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYK 673
             QS I +  SN E E N   R  L ++ +    QR+   E +L   NV     +L   + 
Sbjct: 468  IQSDI-ESTSNKEYELNHKLRDTLVKLDDASANQRETLKEKKLR-ENVS----MLKRFFP 521

Query: 674  LQKSGRIVGFHGRLGDLGTIDN-TYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKL 731
                    G  G + DL       Y +AVST   +  D +VV+T+   Q+CI YL+K + 
Sbjct: 522  --------GVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRA 573

Query: 732  GYARFILLDKLRSF----NTNTIQTPKNVPRLFDLIKPKDS--KFVPAFYSVLRDTL-VA 784
            G   FI LD + +F     T  IQ    V    D  +  D   ++V +  S++ DTL +A
Sbjct: 574  GIISFIPLDTIDAFVPTLPTTNIQGITLVLNAIDYDQEYDKAMQYVCS-DSIMCDTLSIA 632

Query: 785  KDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGG-----GNHVSK----GLMMLQRKGQ 835
            K LK  + V       ++VTL+G LI  +G M+GG     GN   K    GL+ L+ K  
Sbjct: 633  KSLKWKHNVT-----SKLVTLEGTLIHRAGLMTGGVSKEQGNRWDKEEYQGLVTLKDKL- 686

Query: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895
                      + QIE+ LS+  K F +      ++E+ + +LN+   ++  +IS+I   I
Sbjct: 687  ----------LIQIEQ-LSNNSKTFAIEAR---DLESNISQLNSSISDLRTQISQINRSI 732

Query: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDXXXXXXXXXX 955
            +   AE++  E  L+++      E + N +L   +E+++K K E                
Sbjct: 733  EENKAEVQYHEDMLKKEY-----EPKQN-QLNTKLESIEKSKSE---------------- 770

Query: 956  XXXXXXXXIGGIELQVQNSKVTSIVQRIDI-LTAXXXXXXXXXXXXXXELEKAKKTLLTS 1014
                    IG  EL +QN+       ++   +                EL++ +K +L  
Sbjct: 771  -------IIGQKEL-LQNTVFKEFHNKLGFTIQEYEHHSGEALRQSNKELQQLEKQVLNI 822

Query: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074
            ++ +    +  +   +R  K    L N + +IE  Q ++  +  +  ++++ ++++++ +
Sbjct: 823  ESKLQFEVERYESTEKRHKKAQIDLENNNSTIESLQENEAEVVAKIKDIENGMLEIKKVL 882

Query: 1075 NEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSK----LTLRKMHQVLMALDEESEA 1130
             +F S EI+               K ++   EDSLS+    LT     ++  ++ EE E 
Sbjct: 883  EDF-SKEID-------------RKKKKLAIAEDSLSEKSELLTTSTNEKI--SIKEEIEK 926

Query: 1131 K------APNNGTLSDEQIHDQTGHELTNTAVQ--DDDSMDIDNGAEVISNGLPILSDDE 1182
            K         N  +S+ Q+   +  +L N  +   D+D++ I N   +    LP    + 
Sbjct: 927  KDLEKLGILTNCKISNIQVPVASKIDLNNLPIGKIDNDAILISNEISLDYKTLPAKYKES 986

Query: 1183 LSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQ 1242
             S+   + +E E+  +E  ++    N       V R  E K R    + A D+ ET++KQ
Sbjct: 987  SSSKIRSALEHEIEVVEDLLQDLQPNARA----VDRFDEAKER---FDSASDETETLKKQ 1039

Query: 1243 LEEL-------KKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSL 1286
              +L       KK R E F   F  +S  ++ +Y+ +T          GGNA L L D  
Sbjct: 1040 ERKLLTQFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDED 1099

Query: 1287 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            +PF  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD 
Sbjct: 1100 EPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDV 1159

Query: 1347 RNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
             N+  +ANYI++ +  + QFIVISL+N+MFE +  LVGI++ +    S  +
Sbjct: 1160 TNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  227 bits (578), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 326/1328 (24%), Positives = 576/1328 (43%), Gaps = 200/1328 (15%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7    LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 214  HKS----------EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSS 263
            ++               D    S + +  Y    +    K+ E     +ISR    N  +
Sbjct: 67   YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMR--IISR----NGDT 120

Query: 264  KYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 323
             Y I+ K  +Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E
Sbjct: 121  SYKIDEKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFE 173

Query: 324  DIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXX 383
            ++ G+ +YK+  ++   +IE L++   E       +  E  + + G N   E+       
Sbjct: 174  EVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKK 233

Query: 384  XXXXXXXXXYNLW---QNNSKLTNTLQ----KISALNEEYNVEKSKNQTLQNEINRTKQL 436
                     + L+   Q   +LT+ L     +IS+L E+ N E    Q  ++   +   +
Sbjct: 234  SELQKFQALWQLYHLEQQKEELTDKLSASNSEISSLKEKINHEMKSLQRSKSSFVKESAV 293

Query: 437  LNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSL 496
            +++ +SK+  +  ++++ +   R+++    +  +++ ++ +                 SL
Sbjct: 294  ISKQKSKLNYIIKDKEKLVSDLRLIKVPQQAAGKRVLHIEKRI--------------ESL 339

Query: 497  TSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPW 556
              ++Q     QK Y +  ET   QL+   +S +  + ++KE      ++  ++E+DLE +
Sbjct: 340  QRDLQR----QKAYVERFET---QLKVVTKSKKTFEEEIKESARNY-DKFKLNENDLETY 391

Query: 557  NIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQ 616
            N   ++  TE        S+L+E      ND + + +E+      +  +  D+      +
Sbjct: 392  NCLHEKYLTE------NGSILEEKIALYNNDKQEIQEELD-----RFNKRADI-----SK 435

Query: 617  SSITKEIS-NGE---TECNDGRSKLKEMKNVLNMQRQ---RASEARLALANVQNRG---- 665
              IT+E+S  GE   T+ ND R+ L E KN ++ +R    +  ++ +  AN Q       
Sbjct: 436  RRITEELSVTGEKLDTQLNDLRASLNE-KNAVHTERLHELKKLQSDIESANNQEYDLNFK 494

Query: 666  --KVLTALYKLQKSGR------------------IVGFHGRLGDLGTIDN-TYDVAVSTA 704
              + L  +  L  + R                    G  G + DL       Y +AVST 
Sbjct: 495  LRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTI 554

Query: 705  CPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDL- 762
              +  D ++VE +   Q+CI +L+K + G A FI LD + +    T+  P +   +  + 
Sbjct: 555  LGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQEYILSIN 613

Query: 763  IKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNH 822
                + ++  A   V  D+++   LK A  + + +       +  KL+ + G +      
Sbjct: 614  AIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNK------GVRAKLVTIEGALIHKA-- 665

Query: 823  VSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNF----ELANNA------FYEMEN 872
               GLM     G    D  N  D E+ +  +S K+K      EL+N+         E+EN
Sbjct: 666  ---GLMTGGISG----DANNRWDKEEYQSLMSLKDKLLVQIDELSNSQRSNSIRAREVEN 718

Query: 873  ELQKLNNRKPEIELEISKIIMEIDTYSAEIKSK----ERQLQEKTNIDNSELQDNEELKV 928
             +  LN+    +  ++++    +D  + EIK      E+++Q K      +L D E  K 
Sbjct: 719  SVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHNDLLEKEIQPKITELEKKLDDLENTKN 778

Query: 929  AIENLQKLKEEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTA 988
             +E     KE+ +   D                    G EL  Q SK             
Sbjct: 779  GLE-----KEKEILQNDIFKEFTSKIGFSIKEYENHSG-ELMRQQSK------------- 819

Query: 989  XXXXXXXXXXXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEE 1048
                          EL++ +K +LT +N +   TD +     R +K    L      +  
Sbjct: 820  --------------ELQQLQKQILTVENKLQFETDRLNTTQRRYEKARKDLEKAQVEMSS 865

Query: 1049 FQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDS 1108
             +  +  ++ + + +  K   LEEN N     E ++             + +    LED 
Sbjct: 866  LEEQEHAIEMKIESIGSK---LEENKNHLVELEKKLVTKQS-------DLNSSEDILEDM 915

Query: 1109 LSKLTLRKMHQVLMALDEES----EAKAPNNGTLSDEQ--IHDQTGHELTNTAVQDDDSM 1162
             S L + K  +  +  D E     +  A  N  +S+    I  QT  +    + +D D++
Sbjct: 916  NSNLQVLKRERDGIKEDVEKNDLEKVTALKNCKISNINLPILSQTTLDDFPISSRDSDAI 975

Query: 1163 DIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEF 1222
             I N   V   GLP    +  S      +E ++ ++E+ +     N   +E Y +    F
Sbjct: 976  TISNSIVVDYKGLPKKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERYDEAEGRF 1035

Query: 1223 KTRKLDLNDAVDKRETVRK----QLEELKKTRYEEFMHGFGIISMTLKEMYQMIT----- 1273
            +     +N+  ++ +T  K    Q  ++K+ R E F   F  +S  L  +Y+ +T     
Sbjct: 1036 EV----INNETEQLKTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNS 1091

Query: 1274 ----MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY 1329
                 GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y
Sbjct: 1092 NVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSY 1151

Query: 1330 KPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKCE 1388
            +P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+ +
Sbjct: 1152 QPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQ 1211

Query: 1389 NRTHSATI 1396
                S  I
Sbjct: 1212 QENSSKII 1219

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  176 bits (446), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 190/755 (25%), Positives = 329/755 (43%), Gaps = 106/755 (14%)

Query: 682  GFHGRLGDLGTID-NTYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 739
            G  G + DL     + Y +AVST   +  D I+V+ +   Q+CI + +K + G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 740  DKLRSFNTNTIQTPKNVPRLFDLIKP-----KDSKFVPAFYSVLRDTLVAKDLKQANRVA 794
            D + S      Q   N+P   D I        D ++  A   V  D+++   L  A  + 
Sbjct: 594  DTISSE-----QPTLNLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLK 648

Query: 795  YGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDL 853
            + +  R ++VT++G LI  +G M+GG   +SK             D  N  D E+ +  +
Sbjct: 649  WNKGVRSKLVTIEGALIHKAGLMTGG---ISK-------------DSNNRWDKEEYQSLM 692

Query: 854  SDKEK----------NFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIK 903
            + K+K             L++    ++E EL  LN     + +++S++   +D    EI 
Sbjct: 693  TLKDKLLLQVEEISTKSRLSSTRARDVEIELSTLNAEISSLRMQLSQVQRSLDENKTEIN 752

Query: 904  SKERQLQEKTNIDNSELQDN--------EELKVAIENLQKLKEEHLALQDXXXXXXXXXX 955
             +   L ++ N     L++          ELK   E LQ   E    L D          
Sbjct: 753  HQNTLLDQQYNPKLKSLKEKVDEFDKSWNELKSNKEKLQ--NEIFKELTDKVGFTIEEYE 810

Query: 956  XXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSK 1015
                        ELQ    ++ +I  ++                    LEKA +TL + +
Sbjct: 811  RHSGELLRKQSKELQQLQKEILNIENKLQFEIERLENTQKRLTSAESNLEKAHETLKSLQ 870

Query: 1016 NDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENIN 1075
             D   + + +K+I   I+   + L++++K     Q     +++   EL D    L+ N +
Sbjct: 871  KDENELAEQVKQIESEINSARNELDSVNKVFTAQQLDINRMEESLGELNDNSQTLKRNRD 930

Query: 1076 EFKSFEIEVXXXXXXXXXXXXHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNN 1135
            E K                           ++ L ++ + K  +V       +    P  
Sbjct: 931  EIKE-----------------------DIAKNDLERIGILKNAKV-------TNIDIP-- 958

Query: 1136 GTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEV 1195
              +S+  + D     +    +   + +D+D  A      LP    +E+ +     ++T++
Sbjct: 959  -VISETNLSDLPIDRIDEDTISVSNEIDVDYTA------LPAKYKEEMGSATKNELDTKI 1011

Query: 1196 SDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDK-RETVRKQLEE---LKKTRY 1251
             ++E  ++    N    +    R TE + R   ++   +K + T RK L++   +KK R 
Sbjct: 1012 KNVEDLLDVLQPNARAAD----RFTEAQERFEIIDGETEKIKTTERKALQQFLKIKKKRK 1067

Query: 1252 EEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKK 1302
            E F + F  +S  L  +Y+ +T          GGNA L L D  +PF+ GV +   PP K
Sbjct: 1068 ELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLK 1127

Query: 1303 SWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TK 1361
             ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     
Sbjct: 1128 RFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNP 1187

Query: 1362 NAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            N QFIVISL+N MFE +  LVG+++ +    S  +
Sbjct: 1188 NLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIV 1222

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  174 bits (441), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 273/1084 (25%), Positives = 466/1084 (42%), Gaps = 189/1084 (17%)

Query: 404  NTLQKISALNEEYNVEKSKNQ------TLQNEINRTKQLLNESQSKIKVLEGEEKQQLKS 457
            N LQK  AL + Y++E+ K +       L +EI+  K  +N   +++K L+  +   +K 
Sbjct: 231  NELQKFQALWQLYHLEQQKEELTDKLSALNSEISSLKGKIN---NEMKSLQRSKSSFVKE 287

Query: 458  KRILEGEHVSLDEKLKN---LTQXXXXXXXXXXXXXXXXSSLTSEIQELEKS---QKEYS 511
              ++  +   LD   K+   L                  S +   I+ L+K    QK Y 
Sbjct: 288  SAVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYV 347

Query: 512  DELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVE 571
            +  ET   QL+    S EA + ++K+      ++  ++E+DL+ +N  + EK     L E
Sbjct: 348  ERFET---QLKVVTRSKEAFEEEIKQSARNY-DKFKLNENDLKTYNC-LHEK----YLTE 398

Query: 572  SQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEIS-NGE--- 627
               S+L+E    L ND + + +E+      +  +  D+      +  IT+E+S  GE   
Sbjct: 399  GG-SILEEKIAVLNNDKREIQEELE-----RFNKRADI-----SKRRITEELSITGEKLD 447

Query: 628  TECNDGRSKLKEMKNVLNMQRQ---RASEARLALANVQNRG------KVLTALYKLQKSG 678
            T+ ND R  L E KN L+ +R    +  ++ +  AN Q         + L  +  L  + 
Sbjct: 448  TQLNDLRVSLNE-KNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQ 506

Query: 679  R------------------IVGFHGRLGDLGTIDN-TYDVAVSTACPR-LDDIVVETVEC 718
            R                    G  G + DL       Y +AVST   +  D ++VE +  
Sbjct: 507  RETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTV 566

Query: 719  GQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDL----IKPKDSKFVPAF 774
             Q+CI +L+K + G A FI LD + +    T+  P +   +  +     +P+  K +   
Sbjct: 567  AQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYV 625

Query: 775  Y--SVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQ 831
               S++ +TL +AKDLK    +     R ++VT++G LI  +G M+GG +          
Sbjct: 626  CGDSIICNTLNIAKDLKWKKGI-----RGKLVTIEGALIHKAGLMTGGISG--------- 671

Query: 832  RKGQNYFDDYNPEDVEQIEKDLSDKEKNF----ELANNA------FYEMENELQKLNNRK 881
                   D  N  D E+ +  +S K+K      EL+N          E+EN +  LN+  
Sbjct: 672  -------DANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLLNSDI 724

Query: 882  PEIELEISKIIMEIDTYSAEIKSK----ERQLQEKTNIDNSELQDNEELKVAIENLQKLK 937
              +  ++++    +D    EIK      E+++Q K      +L D E  K   +NL K K
Sbjct: 725  ANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTK---DNLVKEK 781

Query: 938  EEHLALQDXXXXXXXXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXX 997
            E   ALQ+                      EL  Q SK                      
Sbjct: 782  E---ALQNNIFKEFTSKIGFTIKEYENHSGELMRQQSK---------------------- 816

Query: 998  XXXXXELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNID---KSIEE------ 1048
                 EL++ +K +LT +N +   TD +     R +K    L N     KS+EE      
Sbjct: 817  -----ELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIE 871

Query: 1049 -----FQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVXXXXXXXXXXXXHIKNQIK 1103
                  ++  E  K+  DEL+ K V  +  +N  +    ++             IK  I+
Sbjct: 872  MKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIE 931

Query: 1104 TLE-DSLSKLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSM 1162
              + + ++ L   K+  + + +  E+        T+ D  I           +  D++++
Sbjct: 932  KFDLERVTALKNCKISNINIPISSET--------TIDDLPI-----------SSTDNEAI 972

Query: 1163 DIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEF 1222
             I N  ++   GLP    +  +      +E ++ ++E+ +     N   LE Y +    F
Sbjct: 973  TISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRF 1032

Query: 1223 KTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT--------- 1273
            +    +      + + +  Q  ++KK R E F   F  +S  L  +Y+ +T         
Sbjct: 1033 EVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVEL 1092

Query: 1274 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1333
             GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P
Sbjct: 1093 AGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSP 1152

Query: 1334 LYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTH 1392
             +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+ +    
Sbjct: 1153 FFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENS 1212

Query: 1393 SATI 1396
            S  I
Sbjct: 1213 SKII 1216

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  149 bits (375), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 143/263 (54%), Gaps = 38/263 (14%)

Query: 1158 DDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVK 1217
            D+D++ I N  +V  N LP     E SA  I        +LE +I S +  + VL+   +
Sbjct: 966  DEDTIAISNEIDVDYNDLPA-KYKESSATTIR------EELENHIRSIEDTLNVLQPNAR 1018

Query: 1218 RLTEFKTRKLDLNDAVDKRETVRKQLEELK--------------KTRYEEFMHGFGIISM 1263
             +  F       +DA ++ E V K+ E+LK              K R E F + F  ++ 
Sbjct: 1019 AVERF-------DDAQERFEVVEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNE 1071

Query: 1264 TLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGE 1314
             L  +Y+ +T          GGNA L L D  +PF+ G+ +  MPP K ++++  LSGGE
Sbjct: 1072 HLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGE 1131

Query: 1315 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNN 1373
            KT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     + QFIVISL+N 
Sbjct: 1132 KTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNT 1191

Query: 1374 MFELAQQLVGIYKCENRTHSATI 1396
            MFE +  LVG+Y+ +    S  +
Sbjct: 1192 MFEKSDALVGVYRQQQENSSKIV 1214

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 101/187 (54%), Gaps = 22/187 (11%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 214 HK------SEKFP-DLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
           ++      SE+ P D         ++ A  E DG  K+ E    + I      N  + Y 
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMDG--KVVELMRTINI------NGDTTYK 118

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
           I+ K  +Y      L++E I +  K FL+ QG+VE IA        +S   L +  E+I 
Sbjct: 119 IDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QSALDLSKLFEEIS 171

Query: 327 GTSKYKQ 333
           G+ +YK+
Sbjct: 172 GSIQYKK 178

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score =  146 bits (369), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 206/829 (24%), Positives = 379/829 (45%), Gaps = 88/829 (10%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 214 HK-------SEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
           ++       SE   D +  +    ++ A  E +  T        + + R   +N  + Y 
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTAYVKAFYEKENKT--------IELMRTISRNGDTNYK 118

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
           I GK  +Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E++ 
Sbjct: 119 IGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLFEEVS 171

Query: 327 GTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXX 386
           G+ +YK+  ++   ++E L++   E       +  E  + + G N   E+          
Sbjct: 172 GSIQYKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDEEYKSKVAKKKEL 231

Query: 387 XXXXXXYNLWQNNSK-------LTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNE 439
                 + L+    K       + +T  K+S L ++ + E+   Q  +  I +   ++ +
Sbjct: 232 QTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDKIHNEERNLQRAKTSIAKEMSIITK 291

Query: 440 SQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSE 499
            + KI     E+++     ++++   +S  +++ N+ +                   T++
Sbjct: 292 KKDKIDYKLKEKEKIASDLKLIKLPQLSTIKRIGNIEKRIESFEKDIERQSSFVERFTNQ 351

Query: 500 IQELEKSQKEYSDELETLNQQLQS------ERESLEAMKLK-LKEKTSGISEEILIHEHD 552
           ++ + K+++ +  EL+  +           E+E+ +++  K L    S I E+I+I+E+D
Sbjct: 352 LKVVTKTKEAFERELKETSMNFDKYRLNDEEKENYQSLNEKYLTSGGSSIEEKIMINEND 411

Query: 553 LEPWNIKVQEKKTEIQLVESQISLLQEG-----QVKLKNDIKVLSQEVSNQTALKIK--- 604
                   QE   E+   E  I + ++       V+L+N+ ++ + E++  T L  K   
Sbjct: 412 -------KQEVGEELNRFEKLIDISKQRINDVLMVELENN-QLRASELT--TLLNEKNSI 461

Query: 605 REEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMKNVLNMQRQRASEARLALANVQN 663
             E L  LK  QS I +  SN E + N   R  L ++ ++   QR+   E +L   NV  
Sbjct: 462 HAERLKELKGLQSDI-ESASNQEYDLNYKLRETLVQIDDLSANQRESMKERKLR-ENVA- 518

Query: 664 RGKVLTALYKLQKSGRIVGFHGRLGDLG-TIDNTYDVAVSTACPR-LDDIVVETVECGQQ 721
              +L  L+         G  G + DL     + Y +AVST   R  D ++V+     Q+
Sbjct: 519 ---MLKRLFP--------GVKGLVYDLCHPKKDKYSLAVSTCLGRNFDSVIVDNASVAQE 567

Query: 722 CIEYLRKNKLGYARFILLDKLRS-FNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRD 780
           CI YL+K + G A FI L+ + S   T ++   +      + I+  D ++  A   V  D
Sbjct: 568 CIAYLKKQRAGSASFIPLETIDSEIPTLSVSNSQGCILAINAIEY-DPRYERAMQYVCSD 626

Query: 781 TLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFD 839
           T++   L  A R+ + +  + ++VTL+G LI  +G M+GG +  S      +   + Y  
Sbjct: 627 TIICDTLVIAKRLKWVEGVKAKLVTLEGALIHKAGLMTGGVSKDSNN----RWDKEEYQS 682

Query: 840 DYNPED--VEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDT 897
             N +D  + QIE ++S + +   +      ++EN L  LN     + +++++I   ID 
Sbjct: 683 LMNLKDKLIHQIE-EVSQQGRASSMKAR---DLENNLSVLNTEISNVRIQLTQITRLIDE 738

Query: 898 YSAEIKSKERQLQEKTNIDNSEL-QDNEELKVAIENLQKLKEEHLALQD 945
              E+  + R + E+ +   SEL +    L+++I NLQ  KE+   LQD
Sbjct: 739 NKIELGYQNRLINEEYSPKMSELNKKKNNLEISISNLQTDKEK---LQD 784

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 136/250 (54%), Gaps = 12/250 (4%)

Query: 1158 DDDSMDIDNGAEVISNGLPILSDDELSALDITL-VETEVSDLEKYIESTDANIEVLEEYV 1216
            DD++ +I N  ++    LP     E  A  +   ++TE+ ++E+ +     N   +E + 
Sbjct: 966  DDEAKNIFNSIDIEYEKLPA-KFKESGAFSLKQQLDTEMKEVEEALNVLQPNARAVERFD 1024

Query: 1217 KRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITM-- 1274
                 F+    +      +   +  Q  ++KK R E F   F  ++  L  +Y+ +T   
Sbjct: 1025 DAQERFEVVDTETETLKTEERKILAQFLKIKKRRRELFEKAFEHVTNHLDSIYRELTRDP 1084

Query: 1275 -------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALH 1327
                   GGNA L L D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++
Sbjct: 1085 HSSAELSGGNASLTLEDEDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTMAALALLFAIN 1144

Query: 1328 KYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYK 1386
             ++P+P +V+DE+DAALD RNV  +A YI+     N QFIVISL+N MFE +  LVG+Y+
Sbjct: 1145 SFQPSPFFVLDEVDAALDVRNVERIAAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVYR 1204

Query: 1387 CENRTHSATI 1396
             +    S  +
Sbjct: 1205 QQQENSSKIV 1214

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  141 bits (355), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 111/177 (62%), Gaps = 11/177 (6%)

Query: 1235 KRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDS 1285
            K + V +    +K+ R E F   F  +S ++ E+Y+ +T          GGNA L L D 
Sbjct: 1045 KEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDE 1104

Query: 1286 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD
Sbjct: 1105 DEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALD 1164

Query: 1346 FRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYK-CENRTHSATIKNRE 1400
              NV  VA+YI+ +   + QFIVISL+N MFE +Q LVG+++  +N T  A   N E
Sbjct: 1165 ISNVERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTLNLE 1221

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  141 bits (355), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 104/158 (65%), Gaps = 10/158 (6%)

Query: 1239 VRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1289
            V +Q  ++++ R + F   F  +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1290 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1350 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYK 1386
              +A YI++R   N QFIVISL+N MFE +Q LVG+++
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFR 1209

 Score =  120 bits (301), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 236/999 (23%), Positives = 418/999 (41%), Gaps = 172/999 (17%)

Query: 154  LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
            + L NFKSY G+  +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7    IELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLI 66

Query: 214  HKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNN------------ 261
            ++       T    D +  Y+ + HD +   S    K   S    +N+            
Sbjct: 67   YRG------TLQDGDADSGYS-ETHDNENNPSSAYVKAFYSPSGQENDVAELTRTITLSQ 119

Query: 262  SSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 321
             S Y +NG+  ++      L+ E I +  + FL+ QG+VE +A  KP+        L   
Sbjct: 120  ESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTL 172

Query: 322  LEDIIGTSKYKQ---LIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXX 378
             E + G+ +YKQ    + ++L +  S     I+   R  I  +   S + G N   E+  
Sbjct: 173  FEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLK---SFKEGVNKDEEYRK 229

Query: 379  XXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLN 438
                            +WQ    L +   K  +L E     + + Q+L +E+N  +Q++ 
Sbjct: 230  HLEERNKLQQQLI---VWQ----LFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQIVA 282

Query: 439  ESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTS 498
            +     K L   +KQ L +K     +   L +K K +                    L++
Sbjct: 283  K-----KKLSYAKKQTLAAK-----QRTRLSDKTKKVDHLTSSLLPIKSSKESIDKRLSA 332

Query: 499  EIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE------KTSGISEEILIHEHD 552
             + ++E  Q++  D  E+L +Q + + + +   K   +       K+SG        +  
Sbjct: 333  AVTKIESLQRDI-DRQESLVKQYEHQLKVVNKAKTNFQAEIDESAKSSG--------DFK 383

Query: 553  LEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTAL--------KIK 604
            L   N+K  E   E   + S  S L++  +  KN+    SQE+S++  L        ++K
Sbjct: 384  LNEANLKRYEDLKET-FLSSGGSELEDKLLLEKNE----SQEISDEIELYSRQLDASRLK 438

Query: 605  REEDLVN----LKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALAN 660
              E+L      L+ + S +TKE+S   ++ +    KLKE+++       R  E    L  
Sbjct: 439  VNEELGAEKEALENEVSELTKELSGKTSQVSAAVKKLKELQSRAEYNNNREYEVSFKLKE 498

Query: 661  VQNRGKVLTAL-------YKLQKSGRIV-----GFHGRLGDLGTIDN-TYDVAVSTACPR 707
               +   + A         KL+++  I+     G  G + +L       Y VAVST   +
Sbjct: 499  TLTKLDDMNATQRETAKERKLRENVSILRRLFPGVRGLVHELCRPKKEKYTVAVSTILGK 558

Query: 708  -LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQT----PKNVPRLFDL 762
              D ++V+     QQC+ +L+K + G   FI LD   + + N +       K      D 
Sbjct: 559  SFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLD---TIDVNKVSMMALDTKGCTLAIDA 615

Query: 763  IK-----PKDSKFVPAFYSVLRDTL-VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTM 816
            I       +  ++V +  S++ D+L +AKDLK    V     R ++V+LDG ++  +G M
Sbjct: 616  IDYERDLERAMQYVCS-DSIICDSLAIAKDLKWRRNV-----RAKLVSLDGSIVHKAGLM 669

Query: 817  SGG-----GNHVSK----GLMMLQRK--GQ-NYFDDYNPEDVEQIEKDLSDKEKNFELAN 864
            +GG     GN   K    GLM L+    G+ +     N  D E+I       E      N
Sbjct: 670  TGGTTKSSGNRWDKEEYQGLMSLKDTLLGEISELSSANTIDSERIR----STENELSFLN 725

Query: 865  NAFYEMENEL----QKLNNRKPEIELEISKIIMEID--------TYSAEIKSKERQLQEK 912
            +    +  +L    + LN ++ EI+ +   I  E +          +A  K+  R  +EK
Sbjct: 726  SDVMSLRTQLNQVKRSLNEKETEIQYQQELIKGEFEPKIQSLKEAMTAHAKTTARFEEEK 785

Query: 913  TNIDNSELQDNE-ELKVAIENLQKLKEEHLALQDXXXXXXXXXXXXXXXXXXIGGIE--L 969
              + +S   D E ++   +   +K   E +  Q                   I GIE  L
Sbjct: 786  DRLLDSVYADFEGDIGFKVSQYEKHSGEMMRRQ---------LEDLRKLQMQIAGIEKKL 836

Query: 970  QVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTLLTSKNDITLITDDIKEIS 1029
            + +  ++ S  +R                    ++EKAK  L    +D   ITD+I+ + 
Sbjct: 837  EFETERLQSTQER--------------QQRVQVDIEKAKIKLEALNSDEQRITDEIQGVE 882

Query: 1030 ERIDKISSSLNN----IDKSIEEFQAHKETLKDECDELK 1064
              I++  + L+N    I+K + E  + +ET+++  + L+
Sbjct: 883  LTINEEQTRLDNLQNEINKDLVELNSSEETIQEATEHLQ 921

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  140 bits (353), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 137/250 (54%), Gaps = 12/250 (4%)

Query: 1158 DDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVK 1217
            D+D++ I N  EV  + LP    +  +      +E E+ D E+ +     N + +E Y +
Sbjct: 964  DNDTILISNEIEVDYDELPAEYKESGNEAVGQKIEKEIKDAEEKLMELQPNSKAVERYDE 1023

Query: 1218 RLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---- 1273
               +F     +      K   +  Q   +KK R E F   F  ++  +  +Y+ +T    
Sbjct: 1024 AKDKFDEIDKETEGLKKKERKLLTQFVNIKKKRKELFEKAFEYVNEHIDPIYRELTKNPN 1083

Query: 1274 -----MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1328
                  GGNA L L D  +P++ GV +   PP K ++++  LSGGEKT+++LAL+FA++ 
Sbjct: 1084 SSVELAGGNASLTLEDEDEPYNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINS 1143

Query: 1329 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA--QFIVISLRNNMFELAQQLVGIYK 1386
            Y+P+P +V+DEIDAALD  NV  +A YI +R  N   QFIVISL+N+MFE ++ LVGIY+
Sbjct: 1144 YQPSPFFVLDEIDAALDITNVERIATYI-QRHGNPELQFIVISLKNSMFEKSEALVGIYR 1202

Query: 1387 CENRTHSATI 1396
             +    S  I
Sbjct: 1203 HQKENSSRII 1212

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 84/162 (51%), Gaps = 25/162 (15%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L LNNFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 214 HKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLV-----------ISRKAFKNNS 262
           ++               FL   DE + +  ++     +            + R    +  
Sbjct: 67  YRG--------------FLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGD 112

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIA 304
           S Y IN K  +Y   T  L++E I +  K FL+ QG+VE IA
Sbjct: 113 STYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 112/172 (65%), Gaps = 10/172 (5%)

Query: 1235 KRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDS 1285
            K + +R+Q  ++K++R E F   +  +S  + ++Y+ +T          GG+A L L D 
Sbjct: 1048 KEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDE 1107

Query: 1286 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345
             +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1108 DEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1167

Query: 1346 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
              NV  +A YIK   + N QFIVISL+N+MFE +Q LVG+++ +    S  I
Sbjct: 1168 NTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/191 (31%), Positives = 98/191 (51%), Gaps = 24/191 (12%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L+NFKSY G   VG    +F++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 214 HKSEKFPDLTSCSVDVE-----------FLYAIDEHDGDTKISETKPKLVISRKAFKNNS 262
           ++  +  D      +             ++ A    +G     E  P +   R   ++  
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEG-----EESP-IEFMRTISRSGE 120

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
           S Y +NGK   Y D T +L++E I +  + FL+ QG+VE IA        +S   L +  
Sbjct: 121 SAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIAS-------QSAGELTKLF 173

Query: 323 EDIIGTSKYKQ 333
           E I G+ +YK+
Sbjct: 174 EQISGSVQYKR 184

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 124/209 (59%), Gaps = 21/209 (10%)

Query: 1197 DLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEE---------LK 1247
            +L + IE  +  +E+L+   + +  F   +   N A+D  ET R + EE          K
Sbjct: 1001 ELTRSIEEVNEMLEILQPNARAVGRFDEAQERFN-AIDN-ETERLKSEERKIYAQFLKTK 1058

Query: 1248 KTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVM 1298
            K R E F   F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   
Sbjct: 1059 KKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHAT 1118

Query: 1299 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1358
            PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI++
Sbjct: 1119 PPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRK 1178

Query: 1359 R-TKNAQFIVISLRNNMFELAQQLVGIYK 1386
                + QFIVISL+N+MFE +  LVG+Y+
Sbjct: 1179 HGNPSLQFIVISLKNSMFEKSDALVGVYR 1207

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  134 bits (336), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 141/260 (54%), Gaps = 36/260 (13%)

Query: 1173 NGLPI--LSDDE-LSALDITLVETEVS-------DLEKYIESTDANIEVLEEYVKRLTEF 1222
            N LPI  + DD  L + DI +   E+S       D EK +E     I+  E+ +  L   
Sbjct: 966  NNLPIDKIDDDAILISNDIKVSFNELSKKYKKKQDYEKNLEDISNEIKETEDILLELQPN 1025

Query: 1223 KTRKLDLNDAVDKRETVRKQLEELK--------------KTRYEEFMHGFGIISMTLKEM 1268
                  L++A DK E +  + E LK              K R E F   F  ++  ++ +
Sbjct: 1026 AKAHDRLDEAKDKFEVIDNETETLKTEEKEILTKFLNIKKKRKELFESCFDFVNEHIEPI 1085

Query: 1269 YQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSS 1319
            Y+ +T          GG A L L D  +PF+ GV +   PP K ++++  LSGGEKT+++
Sbjct: 1086 YKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYHATPPLKRFKDMEYLSGGEKTVAA 1145

Query: 1320 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELA 1378
            LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI++   K+ QFI+ISL+N MFE +
Sbjct: 1146 LALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYIRKHGNKDLQFIIISLKNTMFEKS 1205

Query: 1379 QQLVGIYK--CENRTHSATI 1396
              LVG+++   EN + + T+
Sbjct: 1206 DALVGVFRQQTENSSKALTL 1225

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 111/195 (56%), Gaps = 16/195 (8%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 214 HKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESN 273
           H+S +    ++      ++ A  +    ++I+E    + +S +        Y INGK ++
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITELMRIVNLSGETI------YKINGKTTS 120

Query: 274 YTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQ 333
           + + +  L +E I +  K FL+ QG+VE IA        +S   L +  E + G+ +YK+
Sbjct: 121 FKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGSIQYKK 173

Query: 334 LIEKDLIEIESLNEI 348
             E DL++ E LN+I
Sbjct: 174 --EYDLLK-EDLNKI 185

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa]
           {ON} similar to uniprot|P32908 Saccharomyces cerevisiae
           YFL008W SMC1 Subunit of the multiprotein cohesin complex
           essential protein involved in chromosome segregation and
           in double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1243

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 205/815 (25%), Positives = 357/815 (43%), Gaps = 116/815 (14%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L+NFKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 214 HK----------------------SEKFPDLTSCSVD------VEFLYAIDEHDGDTKIS 245
           ++                      SE  P+  + S +      V  +Y  D+ D  TK  
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTK-- 124

Query: 246 ETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQ 305
                   +R    +  S Y IN +  +Y    + L+ E I +  K FL+ QG+VE IA 
Sbjct: 125 -------FTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIAS 177

Query: 306 MKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIE-SLNEICIEKENRFEIVDREKN 364
             P++       L   LE + G+  YK   EK   E + +L E      +R ++    +N
Sbjct: 178 QGPES-------LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKV----QN 226

Query: 365 SLESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQ 424
            L+S K                      + LW+    L + L++   L +   V K++  
Sbjct: 227 DLKSFKEGVQRDEQYRTSLEIRDQLKHNFILWE----LFHILKRRKKLVDSLTVSKTETT 282

Query: 425 TLQNEINRTKQLLNESQ----------SKIK---VLEGEEKQQLKSKRILEG-EHVSLDE 470
            L+N+++  +++L + +          SK+K   V    EK  L+S  +  G E ++  +
Sbjct: 283 ALKNKLSDEERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIK 342

Query: 471 KLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEA 530
           ++ NL +                    ++++ + K++K +  ELE ++  L     S E 
Sbjct: 343 RIHNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEED 402

Query: 531 MK----LKLKEKTSG---ISEEILIHEHDLEPWNIKVQEKKTEIQLVESQIS-LLQEGQV 582
           +K    LK K  +SG   I E++ I ++D    N + +     ++    +IS  LQ    
Sbjct: 403 LKQYELLKEKYLSSGGSHIEEKLAILKNDEFELNEESELINKRLKTTRERISDELQVDVD 462

Query: 583 KLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMK 641
            L+ D+  ++Q ++++ ++   + ++   ++    S    + N E E N   R  L ++ 
Sbjct: 463 ALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLES----LKNKEYELNFSLRDVLLKID 518

Query: 642 NVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDN-TYDVA 700
           ++   QR+   E +L   NV     +L  LY         G  G + DL       Y +A
Sbjct: 519 DLNADQRETKKERKLR-ENVS----MLKRLYP--------GVKGLVHDLCHPKKEKYAIA 565

Query: 701 VSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTP-KNVPR 758
           VST   +  D I+V+++    +CI YL+K + G A FI LD   + + N    P  NV  
Sbjct: 566 VSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLD---TIDVNPPSLPVSNVQG 622

Query: 759 LFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGT 815
               I     +     A   V  D+++  +L  A  + + +  + ++VTL+G LI  +G 
Sbjct: 623 CLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKAGQ 682

Query: 816 MSGGGNHVSKGLMMLQRKGQNYF--DDYNPEDV--EQIEKDLSDKEKNFELANNAFYEME 871
           M+GG            +K QN +  D+Y    V  +QI ++L+     F   N    E+E
Sbjct: 683 MTGGT----------AQKNQNRWNKDEYQGLMVLKDQITEELTALSDKFRADNMKSRELE 732

Query: 872 NELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKE 906
           NE+  LNN    +  +I+++   +   + EIK  E
Sbjct: 733 NEISLLNNEISSLRTQITQLERTLSGKNVEIKHNE 767

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  132 bits (331), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 139/257 (54%), Gaps = 26/257 (10%)

Query: 1158 DDDSMDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVK 1217
            DD++++I    E+  + LP    +  SA     +  ++ D++  +E    N   +E    
Sbjct: 966  DDEAIEIAKKIEIDFSKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPNARAVE---- 1021

Query: 1218 RLTEFKTRKLDLNDAVDK-----RETVRKQLEE---LKKTRYEEFMHGFGIISMTLKEMY 1269
            R  + K+R     D VDK     +   RK  +E   +K+ R E F + F  I+  L  +Y
Sbjct: 1022 RFDDAKSR----FDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIY 1077

Query: 1270 QMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1320
              +T          GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++L
Sbjct: 1078 SELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAAL 1137

Query: 1321 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQ 1379
            AL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE + 
Sbjct: 1138 ALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSD 1197

Query: 1380 QLVGIYKCENRTHSATI 1396
             LVG+++ +    S  +
Sbjct: 1198 ALVGVFRQQQENSSKIV 1214

 Score =  124 bits (312), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 181/724 (25%), Positives = 326/724 (45%), Gaps = 122/724 (16%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L NFKSY G   V    ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 214 HKSEKFPDLTSCSVD-------VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
           ++     + T    D         ++ A  E+DG  K+ E     +ISR       + Y 
Sbjct: 67  YRDIISRENTPTGADNDENGNRTAYVKAFYEYDG--KVVELMR--LISRLG----DTSYK 118

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
           ++G    Y + ++ L+ + I +  K FL+ QG+VE IA   P        GL + +E++ 
Sbjct: 119 LDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEVS 171

Query: 327 GTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXXXXXX 386
           G+ +YK+  E+   + + + +   E   +   +  E  + + G +   E+          
Sbjct: 172 GSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRV 231

Query: 387 XXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKV 446
                  +LWQ                  Y++E  + Q LQ         L ESQ+ + V
Sbjct: 232 QTN---LSLWQ-----------------LYHMEDERYQCLQK--------LEESQNDVDV 263

Query: 447 ----LEGEEKQQLKSKRILEGEHVSLDEK---LKNLTQXXXXXXXXXXXXXXXXSSLTSE 499
               LE EEK     K+ L  E V L +K   ++++++                ++  + 
Sbjct: 264 IREKLEAEEKNLEVFKKALSKEAVLLTKKKNHIRSISKEKEKAESDLKVVKIPQNASINR 323

Query: 500 IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKT---SGISEEIL--------- 547
           ++ L+K        +++L + L+ E  +LE  K +LK  T   +   +EIL         
Sbjct: 324 LKNLDK-------RVDSLQKDLEREEANLEKYKHQLKVVTDSKNAFEQEILSKSKNNNKF 376

Query: 548 -IHEHDLEPWN-IKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQ--EVSNQTALKI 603
            + E DL+ ++ +K +        +E  ++LL   + ++  D+K+++   E+S Q     
Sbjct: 377 TLSEDDLKLYDELKGEYLNNGGIEIEDTLNLLDNKKEEITADLKIINDKVEISKQ----- 431

Query: 604 KREEDLVNLKKQQSSITKEISNGETECNDGRS-KLKEMKNV-------------LNMQRQ 649
           + E++LV  K++Q +  ++ +    E ND  S KL E++               LN  + 
Sbjct: 432 RIEDELVTKKEEQDAKIRDSTLLLNEKNDLHSHKLDELRKTQKDIEYWNNKEFDLN-HKL 490

Query: 650 RASEARLALANVQNR-----GKVLTALYKLQKSGRIVGFHGRLGDLGTID-NTYDVAVST 703
           R +  +L   N   R      K+   +  L++     G  G + +L     + Y +AVST
Sbjct: 491 RDTLVKLDDLNATQRESNKERKLRENVAMLKRF--FPGVRGLVHELCKPKRDKYKLAVST 548

Query: 704 ACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPR---- 758
              +  D ++V+++   Q+CI +L+K + G   FI LD   + +  T + P  VP     
Sbjct: 549 VLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLD---TIDAATPRMP--VPESETY 603

Query: 759 --LFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGT 815
               + ++ KD   V A Y V  DT++  +L  A  + + +    ++VTLDG LI+ +G 
Sbjct: 604 TLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGL 662

Query: 816 MSGG 819
           M+GG
Sbjct: 663 MTGG 666

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  130 bits (326), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 132/261 (50%), Gaps = 45/261 (17%)

Query: 1171 ISN-GLPILSDDELSALDITLVETEV---------------------------SDLEKYI 1202
            ISN  +PI+SD +L +L I  ++ E                               E+ +
Sbjct: 943  ISNMQIPIVSDVDLQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEAVEKGFEREL 1002

Query: 1203 ESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRK-------QLEELKKTRYEEFM 1255
            +  D  + VL+   K    F   +       D+ E ++K       Q  ++K+ R   F 
Sbjct: 1003 KQVDEILNVLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIKIKRKRKSLFE 1062

Query: 1256 HGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRN 1306
              F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +++
Sbjct: 1063 EAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHATPPLKRFKD 1122

Query: 1307 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQF 1365
            +  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+     + QF
Sbjct: 1123 MEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIRRHGNPDLQF 1182

Query: 1366 IVISLRNNMFELAQQLVGIYK 1386
            IVISL+N MFE +  LVG+Y+
Sbjct: 1183 IVISLKNTMFEKSDALVGVYR 1203

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 102/189 (53%), Gaps = 27/189 (14%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 214 HK---SEKFPDLTSCSVD------VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSK 264
           ++   SE+  D  S  V+      V+  Y+     GD+ I        +SR   K   + 
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFYS----KGDSTIE-------LSRSISKGGDTT 115

Query: 265 YYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 324
           Y +NGK  +Y      L++E I +  K FL+ QG+V  IA        +S   L ++ E+
Sbjct: 116 YRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIAS-------QSAMELTQFFEE 168

Query: 325 IIGTSKYKQ 333
             G+ +YK+
Sbjct: 169 FSGSIQYKK 177

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  127 bits (320), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 101/168 (60%), Gaps = 10/168 (5%)

Query: 1239 VRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1289
            V  Q  ++KK R   F   F   S  +  +Y+ +T          GG+A L L D  +PF
Sbjct: 1041 VIAQFLKIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPF 1100

Query: 1290 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            + G+ +   PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV
Sbjct: 1101 NAGIRYHATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNV 1160

Query: 1350 SIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
              +A YI +   ++ QFIVISL+N MFE +  LVG+Y+ +    S  +
Sbjct: 1161 DRIAAYISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1208

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 105/202 (51%), Gaps = 22/202 (10%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L NFKSY G   VG   ++F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 214 HKS----EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
           ++     E   D    +  V+  Y            ++   + +SR   +N  ++Y +NG
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFYL-----------KSDSTVELSRSISRNGDTQYKMNG 115

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
           K   Y    + L+EE I +  + FL+ QG+V  IA        +S   L +  E+I G+ 
Sbjct: 116 KNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLFEEISGSI 168

Query: 330 KYKQLIEKDLIEIESLNEICIE 351
           +YK+  +    +++SLN+   E
Sbjct: 169 QYKKEYDSLKGKVDSLNQSAAE 190

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  126 bits (316), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 106/171 (61%), Gaps = 11/171 (6%)

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMIT---------MGGNAELELVDSL 1286
            RE+  K L+ +K+ R + F+  F  ++  +  +Y+ +T          GG+A L L D  
Sbjct: 1042 RESKEKYLK-IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDED 1100

Query: 1287 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD 
Sbjct: 1101 EPYLAGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDV 1160

Query: 1347 RNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
             NV  +A YIK   +   QFIVISL++N+F  +Q + G+++ +    S  I
Sbjct: 1161 TNVERIAAYIKRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 98/190 (51%), Gaps = 20/190 (10%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L LNNFKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 214 HKSEKFPD------LTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
           ++  +  D       +  S  V+  Y  D++       E   K+   R       S Y I
Sbjct: 67  YRG-RMDDRSDEHVASPKSAYVKAFYLKDDN------GEQGTKIEFMRIIQNTGDSVYRI 119

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           +GK  ++    + L+ E I +  + FL+ QG+VE IA        +S   L +  E + G
Sbjct: 120 DGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVSG 172

Query: 328 TSKYKQLIEK 337
           + +Y++  E+
Sbjct: 173 SVQYQREYER 182

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  123 bits (308), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 124/211 (58%), Gaps = 14/211 (6%)

Query: 1200 KYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDK-RETVRKQLE---ELKKTRYEEFM 1255
            K I++T   ++   + V+R  E + +   ++   DK +E+ RK  E   ++K+ R   F+
Sbjct: 1001 KAIDNTLTELQPNSKAVERFDEARDQFNAVSGESDKLKESERKAKELYLKIKEKRINTFL 1060

Query: 1256 HGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRN 1306
              F  +   +  +Y+ +T          GG+A L L D  +P+  G+ +   PP K +++
Sbjct: 1061 ACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYHATPPMKRFKD 1120

Query: 1307 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQF 1365
            +  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI+   +   QF
Sbjct: 1121 MDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIRRHASPKMQF 1180

Query: 1366 IVISLRNNMFELAQQLVGIYKCENRTHSATI 1396
            IVISL++N+F  ++ + G+++ ++   S  I
Sbjct: 1181 IVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

 Score =  122 bits (306), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 184/717 (25%), Positives = 323/717 (45%), Gaps = 110/717 (15%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L + NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 214 HKSEKFPDLTSC------SVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
           ++  +  +  S       S  V   Y   +  G       + ++  +R       S Y +
Sbjct: 67  YRG-RMEEGGSAHENNPKSAYVTAFYVKQDASG------AERRMEFTRVIHNTGDSTYKL 119

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           +GK   Y +   +L+ E I +  + FL+ QG+VE IA        +S   L +  E + G
Sbjct: 120 DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTKLFEQVSG 172

Query: 328 TSKYKQLIE---------------------KDLIEIESLNEICIEKENRFEIVDREKNSL 366
           + +Y++  E                     K  I+++S  E  ++KE ++  +  E+  L
Sbjct: 173 SVQYQREYERLKDDYEKASAEYNESLKARRKMQIDLKSFKE-GVQKEEQYISLLAERVKL 231

Query: 367 ESGKNLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTL 426
           +       +F                 +L  + +KL+   +++S  NEE  + KSK+   
Sbjct: 232 QQ------QFMLWQLFHLQSKRSGLVASLKDSKAKLSQLKRQLS--NEEAILGKSKSLVA 283

Query: 427 QNEI---NRTKQLLNESQSKIK----VLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXX 479
           + E+    R + LL + Q K +    +L     +Q  ++R+     V++++++ +L +  
Sbjct: 284 KEELLLARRRETLLQKQQDKARLNAQLLPVGSARQGTTRRM-----VNIEKRIDSLQRDI 338

Query: 480 XXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDELE-------TLNQQLQSERESLEAMK 532
                           L ++++ + K++  +  ELE       TL+++ + E E L+ + 
Sbjct: 339 ERQESYVKQ-------LKNQLKVVGKTKASFEAELEKSASGKFTLSEEQKKEYEELKEVY 391

Query: 533 LKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQ-EGQVKLKNDIKVL 591
           L     +SG SE     E  L     K +E   EI + E +I + +   +  LK DI+ L
Sbjct: 392 L-----SSGGSE----FEEKLAILQNKKEELSEEIAVFEKRIGISKTRAEHDLKVDIERL 442

Query: 592 SQEVSNQTA-LKIK---REEDLVNLKKQQSSITKEISNGETECNDG-RSKLKEMKNVLNM 646
             EVS +T  L  K     E +   K+ QS I +  +N E E +   R  L ++ ++   
Sbjct: 443 EVEVSERTGNLNDKNAIHSEKVREWKQIQSEI-ESANNKEYELSYKLREVLAKLDDLSAN 501

Query: 647 QRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDN-TYDVAVSTAC 705
           QR+   E +L       R  V T L +L       G  G + DL       Y V VST  
Sbjct: 502 QRETNKERKL-------RENVAT-LRRL-----FPGVRGLVHDLCRPKKEKYAVGVSTIL 548

Query: 706 PR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIK 764
            +  D ++V+++   QQCI YL+K++ G A FI LD + + ++ T+    N   +  L  
Sbjct: 549 GKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDT-SSPTLPAGDNTGCILTLDA 607

Query: 765 PK-DSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGG 819
            + +S    A   V  D+++   L  A  + + +  + ++VTL+G LI  +G M+GG
Sbjct: 608 IEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLMTGG 664

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  117 bits (292), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 174/721 (24%), Positives = 321/721 (44%), Gaps = 87/721 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            DLI+K  +   +T  SV + F    D+ +     + + P++ ++R+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF-DNTDKSNSPIGFANS-PQISVTRQVVLGGTSKYLING 119

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 330 KYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKN---LALEFXXXXXXXXXX 386
            ++   EK    + S  E  ++ ENR  + +  +  LE  +N   + LEF          
Sbjct: 173 MFEDRKEKAERTM-SKKETKLQ-ENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKT 230

Query: 387 XXXXXXYNLWQNNSKLTN---------------------TLQKISALNEEYNVEKSKNQT 425
                 Y+ +    K T+                     T+Q+I++LNE+  VE+ K+Q 
Sbjct: 231 ERIVVSYDYYNLKHKHTSIRETLENGEAHMKNLNEFIEKTIQEINSLNED--VEEIKHQK 288

Query: 426 LQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXX 485
            + E+N+        + KI  LE +E   L     L+    SL  K++NL          
Sbjct: 289 -EKELNK--------EGKISKLEKKENSLLNEISRLK---TSLSIKVENLNDTNEKLKSV 336

Query: 486 XXXXXXXXSSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEE 545
                   + L  +     K++K+Y    + + QQL  +R+  +  +  +   T+GIS  
Sbjct: 337 EADITTSSTKLNDKKIAYTKTEKDY----KIVQQQLSEKRDLYKRKEELVSTLTTGISST 392

Query: 546 ILIHEHDLEPWNIKVQEKKTEIQLVESQIS-------LLQEGQVKLKNDIKVLSQEVSNQ 598
                     +N ++ + KTE+  +   I        LL++  + ++  +K  +++  N+
Sbjct: 393 GAADGG----YNAQLGKAKTELNDISLAIKKSNMRMDLLKKELLTIEPKLKEATKD--NE 446

Query: 599 TALK-IKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLA 657
            ++K +K  +++ N  K Q+ +  E     +   D   K  +MK+        A   +  
Sbjct: 447 LSIKHVKECQEICN--KLQAQLV-EFGFDPSRIKDLEQKENKMKSQYYQICNEAEHLKRR 503

Query: 658 LANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVST-ACPRLDDIVVETV 716
           +AN++      T  Y   ++  + G  GRL  L   +  Y  A+ T A  RL ++VV   
Sbjct: 504 VANLEFN---YTKPYPDFETSSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDS 560

Query: 717 ECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSK 769
           +   Q +E  R  K      I LDK+  R      ++      P  V    +LI+  D  
Sbjct: 561 QTATQLLEGGRLRK--RVTIIPLDKIYTRPITPQVLELAKSIAPGKVELAINLIRF-DKP 617

Query: 770 FVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828
              A   +  ++L+  D + A ++ +  + R R +TL G + D  GT+SGG  + S+ L+
Sbjct: 618 VTKAMEFIFGNSLICDDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLL 677

Query: 829 M 829
           +
Sbjct: 678 V 678

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  115 bits (287), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 210/875 (24%), Positives = 385/875 (44%), Gaps = 154/875 (17%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            DLI+K  +   +T  SV + F  + D+++      E+ PK+ ++R+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFANS-DKNNSPIGF-ESYPKISVTRQIVLGGTSKYLING 119

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 330 KYKQLIEK----------DLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXX 379
            ++   EK           L EI SL +         E V+ + N L + K   L+F   
Sbjct: 173 MFEDRREKAERTMNKKETKLQEIRSLLQ---------EEVEPKLNKLRNEKRAFLDFQET 223

Query: 380 XXXXXXXXXXXXXY-------------NLWQNN----SKLTNTLQ--KISALNEEYNVEK 420
                        +             N +QN+    S+LT ++Q  K+   N E +++ 
Sbjct: 224 QSDLENTSKIVNAFVFSSLVQKRKNIENAFQNSESRISELTASVQQTKVELTNLEEDLDT 283

Query: 421 SKNQTLQNEINRTKQLLNESQSKIKVLEGE---EKQQLKSKRILEGEHVSLDEKLKNLTQ 477
            + Q  +NE+ +   L     SK++ LE +   E  +LK+         SL   ++N+ Q
Sbjct: 284 IRTQK-RNEMRKDGAL-----SKLEALETQLINEVSRLKT---------SLSLTIENINQ 328

Query: 478 XXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYS---DELETLNQQLQSERESLEAMKLK 534
                           +SL  +    + ++ EY+   D ++ L+QQLQ++ E L  +   
Sbjct: 329 ENGKRESLERSIRGIQTSLQEKSAISKNAENEYNELHDLVQNLSQQLQTKEELLSTLTTG 388

Query: 535 LKEK---TSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVL 591
           +       SG S ++   +  L    I+VQ  + +I +++ +++  +   V    D K L
Sbjct: 389 ISSTGATNSGYSAQLSNTKARLNDARIQVQRFEMKINILKKELAANEPKIV----DAKSL 444

Query: 592 SQEVSNQ--------TALKIKREE-----DLV-NLKKQQSSITKEISNGETECNDGRSKL 637
           S+E   Q        + LK+  E+     DL  +LK+++SS+              +SK+
Sbjct: 445 SEEAKKQVEVTGIQCSDLKMHLEKLGFNPDLFKSLKEEESSL--------------KSKI 490

Query: 638 KEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTY 697
             + N +   R++ +    A +   ++    +          + G   +L  L   + + 
Sbjct: 491 YNLSNDMEGLRRKVANIDFAYSKPSDKFDPTS----------VKGVAAQLFSLNEENFSS 540

Query: 698 DVAVS-TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ--- 751
             A+   A  RL ++VV       Q +E  R  K      I L+K+  R  + +T+    
Sbjct: 541 ATALQICAGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAK 598

Query: 752 --TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGK 808
              P +V    +LI  +D +   A   +   +L+ +D + A +V +  + R R +TL G 
Sbjct: 599 QLAPDSVELALNLIGYED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGD 657

Query: 809 LIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPE-----DVEQIEKDLSD---KEKNF 860
           + D  GT+SGG  + +  +++  +K   Y  + +       DV +  K  S+   K KN 
Sbjct: 658 IYDPEGTLSGGSRNNNSSILIDIQKYNAYSRNLSESEAKLADVTKRIKQYSEVLQKTKNL 717

Query: 861 E----LANNAFYEMENELQ-----KLNNRKPEIELEISKIIMEIDTYS-------AEIKS 904
           +    LA + F+  E  L      +L +R  EI+ EI   +  + + S       AE+ S
Sbjct: 718 QNELNLATHKFHLAERNLANNPSVQLMSRNKEIQDEIQMCLESMRSGSEDIKKLEAEVAS 777

Query: 905 KERQLQEKTNIDNSELQDNEELKVAIENLQKLKEE 939
            E+ + E +    S+L   +ELK  I +++K  EE
Sbjct: 778 VEKDMLEFSKDKGSKL---DELKREISHIRKDIEE 809

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  102 bits (253), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 104/190 (54%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           I +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGD-TKISET-KPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV V F    D  D D + I  T  PK+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVF----DNSDRDNSPIGFTNSPKISVTRQVVLGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TKMFEDRREK 180

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  101 bits (251), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 101/190 (53%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI--SETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +   SV + F    D  D  +     ET PK+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF----DNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TRMFEDRREK 180

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 12/139 (8%)

Query: 703 TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKN 755
            A  RL +++V+  +   Q +E  R  K      I L+K+  R  NT+ +       P  
Sbjct: 547 CAGGRLFNVIVDNEKTASQLLERGRLRK--RVTIIPLNKISARVINTDALNKAKSLAPGA 604

Query: 756 VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAY-GQRRYRVVTLDGKLIDVSG 814
           V    +LI   +++   A   +   +L+ +D   A +V +  Q R R +TLDG + D  G
Sbjct: 605 VELALNLI-GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEG 663

Query: 815 TMSGGG-NHVSKGLMMLQR 832
           T+SGG  +H S  L+ +Q+
Sbjct: 664 TLSGGSRSHTSSLLIDIQK 682

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 100/186 (53%), Gaps = 19/186 (10%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           I +L ++ FKSYA + V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS----ETKPKLVISRKAFKNNSSKY 265
            DLI+K  +   +T  SV + F       + D K S    E  PKL ++R+     +SKY
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF------SNLDPKCSPIGFENSPKLSVTRQIILGGTSKY 115

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
            ING  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEA 168

Query: 326 IGTSKY 331
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 144/288 (50%), Gaps = 31/288 (10%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D   + I  E+ PK+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328 TSKY---KQLIEKDLIEIES-LNEI--CIEKENRFEIVDREKNSLESGKNLALEFXXXXX 381
           T  +   ++  EK + + E+ L EI   +E+E     ++ +   L + K   LEF     
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEIRTLLEEE-----IEPKLEKLRNQKRAFLEFQETQT 225

Query: 382 XXXXXXX---XXXXYNLWQNNSKLTNTLQKISALNEEYN--VEKSKNQ 424
                         Y++   NS +  TLQ  +A  EE N  ++K+KN+
Sbjct: 226 DLEKTLRILNAYEYYDMATKNSTIKETLQNSTARVEELNNFIQKTKNE 273

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 98/190 (51%), Gaps = 23/190 (12%)

Query: 154 LTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 213
           L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 214 HKS----------EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSS 263
           ++           +   D  + + +    Y    +    K+ E      ++R   +N  +
Sbjct: 103 YRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVE------LTRLISRNGDT 156

Query: 264 KYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 323
            Y I+GK   Y D +  L+ E I +  K FL+ QG+VE IA   P         L    E
Sbjct: 157 TYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT-------DLSRMFE 209

Query: 324 DIIGTSKYKQ 333
           ++ G+ +YK+
Sbjct: 210 EVSGSIQYKK 219

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 103/189 (54%), Gaps = 13/189 (6%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS-ETKPKLVISRKAFKNNSSKYYIN 268
            DLI+K  +   +T  SV + F    ++   ++ I  E+ PK+ ++R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---TNDDKANSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
           G  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 329 SKYKQLIEK 337
             ++   EK
Sbjct: 172 KMFEDRREK 180

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 98.2 bits (243), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 102/188 (54%), Gaps = 11/188 (5%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            DLI+K  +   +T  SV + F    D+ +     SE  PK+ ++R+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF-DNTDKSNTPIGFSEY-PKISVTRQIVLGGTSKYLING 119

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
             +    V +L +   +++++  FLI+QG++  I  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGTK 172

Query: 330 KYKQLIEK 337
            ++   EK
Sbjct: 173 MFEDRKEK 180

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 64/135 (47%), Gaps = 11/135 (8%)

Query: 703 TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RSFNTNTIQ-----TPKN 755
            A  RL +++V+  + G   ++  R  K      I LDK+  R  N N ++      P  
Sbjct: 547 CAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKLAKQLAPGK 604

Query: 756 VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR-RYRVVTLDGKLIDVSG 814
           V    +LI   D + V A   +  ++L+  D + A ++ +    R R +TL+G + D  G
Sbjct: 605 VELALNLIGYSD-EVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEG 663

Query: 815 TMSGGGNHVSKGLMM 829
           T+SGG  + +  L++
Sbjct: 664 TLSGGTRNNTNTLLV 678

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 103/192 (53%), Gaps = 19/192 (9%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS----ETKPKLVISRKAFKNNSSKY 265
            DLI+K  +   +T  SV + F      ++ DT  S    E+  K+ I+R+      SKY
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF------NNSDTSNSPIGFESHAKISITRQIILGGVSKY 115

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
            ING  +    V +L +   +++++  FLI+QG++  +  MKP+        +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEA 168

Query: 326 IGTSKYKQLIEK 337
            GT  ++   EK
Sbjct: 169 AGTRMFEDRREK 180

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1295
            ++ +++ +E+L + + E  +  +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1296 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1355
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1356 IKERTKNAQFIVISLRNNMF 1375
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 103/190 (54%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKISET-KPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D  ++ I  T  P++ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TKMFEDRREK 180

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 104/190 (54%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKISET-KPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D  ++ I  T  P++ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TKMFEDRREK 180

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 110/268 (41%), Gaps = 53/268 (19%)

Query: 684 HGRLGDLGTIDN---TYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILL 739
           HG +G L  IDN    Y  A+ T A  RL ++VV+  +   Q +E  R  K      I L
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 740 DKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANR 792
           DK+  R  ++  +       P  V    +LI+  D     A   +  ++L+ +D + A +
Sbjct: 582 DKIYTRPISSQVLDLAKKIAPGKVELAINLIRF-DESITKAMEFIFGNSLICEDPETAKK 640

Query: 793 VAYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM-------LQRKGQNYFDDYN-- 842
           + +  + R R +TL G + D  GT+SGG  + S+ L++       +Q++ +    D N  
Sbjct: 641 ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADLNHV 700

Query: 843 ----------PEDVEQIEKDLSDKEKNFELANNAF-------------------YEMENE 873
                      +  + I+ DL+      +LA                        E ENE
Sbjct: 701 TEELQTQYATSQKTKTIQSDLNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGECENE 760

Query: 874 LQKLNNRKPEIELEISKIIMEIDTYSAE 901
           ++       + + E+S I  ++  Y ++
Sbjct: 761 IKTKQMSLKKCQEEVSTIEKDMKEYDSD 788

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
            Ashbya gossypii AGR236W
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 227/977 (23%), Positives = 411/977 (42%), Gaps = 184/977 (18%)

Query: 151  INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
            + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3    VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 210  SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKIS----ETKPKLVISRKAFKNNSSKY 265
             DLI+K  +   +   SV + F       + D K S    E  PK+ ++R+     +SKY
Sbjct: 63   QDLIYKRGQ-AGVIKASVTIVF------DNSDIKSSPIGFERYPKISVTRQIALGGTSKY 115

Query: 266  YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
             ING  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116  LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEA 168

Query: 326  IGTSKY---KQLIEKDLIEIES-LNEI--CIEKENRFEIVDREKNSLESGKNLALEFXXX 379
             GT  +   ++  EK + + E+ L EI   +++E     ++ + +   S K   LEF   
Sbjct: 169  AGTRMFEDRREKAEKTMAKKETKLQEIRALLQEE-----IEPKLDKFRSEKRAFLEFQ-- 221

Query: 380  XXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNE 439
                             +  + L  TL+ ++    +Y+   +K  ++Q  +  ++Q + E
Sbjct: 222  -----------------ETQTDLEMTLRIVNT--HDYHNLVTKQNSIQETVQNSEQRVQE 262

Query: 440  SQSKIKVLEGEE----------KQQLKSKRILEGEHVSLDEKLKN-----LTQXXXXXXX 484
             +S IK  + E           K Q + + + +G    L EKL+N     L++       
Sbjct: 263  LESSIKKYQNELSSLNEDFTAIKNQKECELLKDGSLTKL-EKLENTLSTDLSRFSTALGI 321

Query: 485  XXXXXXXXXSSLTSEIQELEKSQKEY---SDELETLNQQLQSERESLEAMKLKLKEK--- 538
                      SL      LE S+K+    +  L+T+ QQ     +S+E +K + K+K   
Sbjct: 322  AKDDLKQEKKSLIDIQSSLESSEKDLFVKAKNLKTIEQQYNELNDSIEKLKSQHKDKEEL 381

Query: 539  ----TSGISEEILI---HEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVL 591
                T+GIS        +   L     K+ E +  I+    +I++LQ+         ++ 
Sbjct: 382  LSTLTTGISSTGATDGGYNSQLAAAKAKLGEAEISIKKANMRIAMLQK---------ELA 432

Query: 592  SQEVSNQTALKIKREEDLVNLKKQQSSITK-EISNGETECNDG-----RSKLKEMKNVLN 645
            S E   Q A K   EE ++ +K++   I K ++S  ++  N       R +  E+KN L 
Sbjct: 433  SSEPLLQRAKK-DNEEQIMQVKQRGQEIEKLKVSLNKSGFNPELMKTLRRRENELKNNLQ 491

Query: 646  MQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVS--- 702
                     R  +AN++      T  +  Q    + G   ++  LG  DN +D A +   
Sbjct: 492  KLSNDTEYLRRKVANLEFNYTSPTKDFNPQS---VKGVAAQVFTLGK-DN-FDSANALQV 546

Query: 703  TACPRLDDIVVETVECGQQCIE--YLRKNKLGYARFILLDKL--RSFNTNTIQ-----TP 753
             A  RL +I+V+  +   Q +E   LRK        I L+K+  R  +  ++       P
Sbjct: 547  CAGGRLFNIIVDNEKTASQLLEKGMLRKR----VTIIPLNKISTRVLSDESLALAKKIAP 602

Query: 754  KNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAY-GQRRYRVVTLDGKLIDV 812
              V    +LI  ++     A   +   +L+  D + A ++ +  Q R R +TLDG + D 
Sbjct: 603  GKVELALNLIGYEED-VSKAMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDP 661

Query: 813  SGTMSGGGNHVSKGLMM-------LQRKGQNYFDDYN--------PEDVEQIEKDLSDK- 856
             GT+SGG ++ +  L+          R+ +++  + +         E   Q+ K L ++ 
Sbjct: 662  EGTLSGGSSNNTNSLLKDIQKYNEASRRSKSFESELSLIQQQIMECERASQLTKSLQNEL 721

Query: 857  ---EKNFELANNAFY------------EMENE---------LQKLNNRKPEIELEISKII 892
               E  F+L+  A              EM NE         LQK++    E++ E+ +I 
Sbjct: 722  DLAEHKFQLSQKALVSNPAAQIIKKNDEMLNEIETCKTDIDLQKIST--AELQAEVVRIQ 779

Query: 893  MEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENL-QKLKEEHLALQDXXXXXX 951
             ++  ++ +  SK +QL ++ +    +++D E +     +L Q L+ E   LQ       
Sbjct: 780  KDMQEFNTDKGSKLKQLNKEVSTLAKQIKDKEVVTEQKYDLYQNLQMETEQLQ------- 832

Query: 952  XXXXXXXXXXXXIGGIELQVQNSKVTSIVQRIDILTAXXXXXXXXXXXXXXELEKAKKTL 1011
                        I  ++ ++   K       I +L                ELE  K  L
Sbjct: 833  ----------TDISAMKQEIVEKK-----SLIKVLEQKIITTDSEFSCKQSELENVKGNL 877

Query: 1012 LTSKNDITLITDDIKEI 1028
               +N +  I ++IKE+
Sbjct: 878  NEERNRLIGIDEEIKEL 894

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 103/188 (54%), Gaps = 11/188 (5%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYING 269
            DLI+K  +   +T  SV + F    D+ +     + + P++ ++R+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF-NNTDKLNSPIGFTNS-PQISVTRQVVLGGTSKYLING 119

Query: 270 KESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTS 329
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 330 KYKQLIEK 337
            ++   EK
Sbjct: 173 MFEDRREK 180

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 166/742 (22%), Positives = 312/742 (42%), Gaps = 141/742 (19%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPKL---VISRKAFKNNS 262
              LIH+      + S SV++ F      HD D +I   S   P+    V+ R+      
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF------HDPDHRIILPSGVAPRSNDEVLVRRTVGLKK 112

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y +N +     DV ++L+  G  +++   ++ QG +  +   K K         L+ L
Sbjct: 113 DDYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLL 165

Query: 323 EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXX 382
           ED++G   ++  +   L ++E        ++ R +IV +E   L    +   E       
Sbjct: 166 EDVVGAKSFEVKLRASLKKMEQT------EQKRAQIV-KEMEELNDKLSEMEEERKELEV 218

Query: 383 XXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNV----------EKSKNQTLQNEINR 432
                     +     + +L + + +I  +++ YNV          E  K + +  +IN+
Sbjct: 219 FNNLERNRKAFQFTLYDRELNDVINQIEKMDDVYNVTLHSSHDYITELDKREDMVEQINK 278

Query: 433 TKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXX 492
             Q L   +S IK+ E  E  Q +SK      H  L   + N                  
Sbjct: 279 NLQNL---ESSIKIKETAELSQARSK------HNELSNAIAN------------------ 311

Query: 493 XSSLTSEIQELEKSQKEYSDELETLNQQ-LQSERESLEAMKLKLKE---KTSGISEEILI 548
              L  +I++L++    Y DE   LN++ L    E++EA + +L +   +   +S+E + 
Sbjct: 312 ---LNVKIRDLQRQVVSY-DEQSDLNRKNLAIINEAIEAKQAQLAKISPRFESLSKEEVS 367

Query: 549 HEHDLEPWNIKVQEKKTEIQLVESQISLLQ---EGQVKLKNDIKVLSQEVSNQTALK--- 602
           ++ +L      +QEK+ ++ L++ + S  Q   E    ++ +++ L++ ++N T LK   
Sbjct: 368 YKLELAG----LQEKQRDLLLMKGKYSHFQTVEERNEWIEGELRSLNETLANTTHLKSQI 423

Query: 603 -----------------IKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKE------ 639
                            I+  ED V    +   +  EI + E + ND +++  E      
Sbjct: 424 DNERNELHEKLNATEEQIQELEDSV----RGPGVVAEIEDIEKKVNDLKAEYVEKINERK 479

Query: 640 ----------------MKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGF 683
                           +  V N +R  +     +LAN     + +T   +L + GR+   
Sbjct: 480 ELWRSEQKLQTISETLLDTVKNSERSVSETMAKSLANGIASVREITEKLRLPE-GRVF-- 536

Query: 684 HGRLGDLGTIDNTYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 742
            G LG+L  ++  Y +         L  IVV+T E     I+ L + + G   F+ L+++
Sbjct: 537 -GTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTFMPLNRI 595

Query: 743 RSFNTNTIQTPKNV-PRLFDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRR 799
             +N   I  P N       LIK    D++F     +V   T+V +DL   +++A   + 
Sbjct: 596 --YNDPNITYPPNAQSSCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAGSKIA---KH 650

Query: 800 YRV--VTLDGKLIDVSGTMSGG 819
           Y++  +TLDG   D SG ++GG
Sbjct: 651 YKLDAITLDGDRADKSGLLTGG 672

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  IK  + NAQFI  + R +M ++A +   + K EN+  +    +R+
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEVDRQ 1208

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 102/190 (53%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D  ++ I      K+ ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V +L +   +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TKMFENRREK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 91.7 bits (226), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 100/190 (52%), Gaps = 15/190 (7%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 209
           + +L ++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 210 SDLIHKSEKFPDLTSCSVDVEFLYAIDEHD-GDTKIS-ETKPKLVISRKAFKNNSSKYYI 267
            DLI+K  +   +T  SV + F    D  D     I  ET   + ++R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKSKAPIGFETSLTISVTRQIVLGGTSKYLI 117

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 327
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAG 170

Query: 328 TSKYKQLIEK 337
           T  ++   EK
Sbjct: 171 TKMFEDRREK 180

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1302 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1361 KNAQFIVISLRNNMFELAQQL 1381
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 159/726 (21%), Positives = 313/726 (43%), Gaps = 108/726 (14%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPK---LVISRKAFKNNS 262
              LIH+      + S SV++ F      HD + KI   S   P+    V  R+      
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVF------HDPNHKIILPSGVVPRENDEVYIRRTVGLKK 113

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y +N +     DV ++L+  G  +++   ++ QG++  +   K K         L  L
Sbjct: 114 DDYQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLL 166

Query: 323 EDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFXXXXXX 382
           ED++G   ++  ++  L +++       E E +   +D E N L S      +       
Sbjct: 167 EDVVGAKSFELKLKASLKKMD-------ETEQKRNQIDMEMNELNSKLKEMNQERKELEK 219

Query: 383 XXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS 442
                     +     + +L + + +I  L+ +YN     ++    E+++ + +++E   
Sbjct: 220 FNSLDKNRKVFQFTLYDRELNDIITQIENLDGDYNSTVDSSEKYIKELDKRENIISELTK 279

Query: 443 KIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQE 502
           K+  ++   K  +K+   L+    +  E L NLT                  +L  +I++
Sbjct: 280 KLTEIDSSLK--IKTTNDLQIAKANNSEILNNLT------------------NLDVQIKD 319

Query: 503 LEKSQKEYSDELETLNQQLQSERESLEAM-------KLKLKEKTSGISEEILIHEHDLEP 555
           L+        +LET N+Q  S++ +LE +       +LKL  K S   +++   E   + 
Sbjct: 320 LKL-------QLETQNEQTNSDKSNLELINKEIESRRLKL-SKISPRFQQLTNEESRFKL 371

Query: 556 WNIKVQEKKTEIQLVESQISLLQEGQVK---LKNDIKVLS--QEVSNQTALKIKREEDLV 610
            +  ++E++ ++ L + + S     Q +   ++N+IK L+  Q+  N T  K K E+D V
Sbjct: 372 QSNTLKERQRDLLLKKGRYSRFHTAQERNEWIENEIKELNQLQQSLNDTKTKNKIEKDEV 431

Query: 611 --------------NLKKQQSSITKEISNGETECNDGR----SKLKEMKNVLNMQRQRAS 652
                         N   Q  SI  E+ + E+  +D +    S + + K +   +++  +
Sbjct: 432 AERINTIDEEIQELNDSIQGPSINAELEDLESNIDDIKQQYNSSIDQRKELWRNEQKLET 491

Query: 653 EARLALANVQNRGKVLT-----ALYKLQKSGRIVG---------FHGRLGDLGTIDNTYD 698
             +  L NV++  + +      +L    KS + +            G LG+L ++++ Y 
Sbjct: 492 VLQTILDNVKDSERAVGETMDRSLANGLKSVKEIAEKLKLPEDSVFGTLGELVSVNSKYK 551

Query: 699 VAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVP 757
                     L  ++V+T E   + ++ L + K G   FI L+K+  F+ +    P++  
Sbjct: 552 TCAEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKVY-FDNSITFPPEDQS 610

Query: 758 RLFDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLIDVS 813
               LIK    D KF  A   V   T+V KDL    ++A   ++Y++  +TLDG   D  
Sbjct: 611 SYTPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA---KKYKLSAITLDGDRADKR 667

Query: 814 GTMSGG 819
           G ++GG
Sbjct: 668 GVLTGG 673

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 4/121 (3%)

Query: 1286 LDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1343
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1344 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT-IKNREIL 1402
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K EN+  +   I  +E +
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYENKISTVIEIDRQEAI 1217

Query: 1403 N 1403
            N
Sbjct: 1218 N 1218

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 94/194 (48%), Gaps = 28/194 (14%)

Query: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELEL------------- 1282
            +E++ K +E LKK + E     F  ++     +++ +   G   L +             
Sbjct: 1043 KESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQ 1102

Query: 1283 -----------VDSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKY 1329
                        D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+   
Sbjct: 1103 RSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMV 1162

Query: 1330 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCEN 1389
             P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A     + K EN
Sbjct: 1163 DPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV-KFEN 1221

Query: 1390 R-THSATIKNREIL 1402
            + +  AT+  +E +
Sbjct: 1222 KISEIATVSKQEAI 1235

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 84/183 (45%), Gaps = 9/183 (4%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I  + +  FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
              LIH+      + S  V++ F    D+    + I  T+  +V  R+       +Y +N
Sbjct: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
           GK  + +D++++ +  G    +   ++ QG +  +   K K         L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLLEDVVGA 195

Query: 329 SKY 331
             +
Sbjct: 196 RSF 198

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 85.5 bits (210), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 116/231 (50%), Gaps = 24/231 (10%)

Query: 1196 SDLEKYIESTDANIEVLEEYVKRLTE----FKTRKLDLNDAV----DKRETVRKQLEELK 1247
            SDL + + S +  +  L    KR +E    F  +K++LN+      D + +++  +E+LK
Sbjct: 971  SDLFQELNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKVSIQNLIEKLK 1030

Query: 1248 KTRYEEFMHGFGIISMTLKEMYQMITMGGNAELEL------------VDSLDPFSEGVTF 1295
            + +       F  +S     +++ +   G A+L +             +S +    G++ 
Sbjct: 1031 QQKVTAVDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNSTESIYSGISI 1090

Query: 1296 SVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1353
            SV     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA
Sbjct: 1091 SVSFNSKKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRAAVA 1150

Query: 1354 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSAT-IKNREILN 1403
            + IK  + NAQFI  + R +M ++A +   + K EN+  +   ++ +E +N
Sbjct: 1151 DVIKSLSGNAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEVERQEAIN 1200

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 85/183 (46%), Gaps = 9/183 (4%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I+++ +  FK+Y  + V+  F  +++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
              LIH+      + S SV++ F          + +   +   +  R+        Y +N
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVN 118

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
            +    +DV ++L+  G  + +   ++ QG +  +   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLEDVVGA 171

Query: 329 SKY 331
             +
Sbjct: 172 KSF 174

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1288 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1346 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394
             +  + VAN +KE +KNAQFI  + R +M ++A +   + K EN+  S 
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 117/259 (45%), Gaps = 54/259 (20%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHK-SEKFPDLTSCSVDVEFLYAIDEHDGDTKI-----SETKPKL---VISRKAFK 259
              LIH+ +     + SCSV++ F      HD D ++     +   P+    V  R+   
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVF------HDPDNRMILASNASIVPRPNNEVFIRRTVG 114

Query: 260 NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLL 319
                Y IN +    +D+ ++L+  G  + +   ++ QG++  +   K K         L
Sbjct: 115 LKKDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------L 167

Query: 320 EYLEDIIGTSKY-----------------KQLIEKDLIEIES-LNEICIEK--------- 352
           + LED++G   +                 K  I+K+L E+++ LNE+  EK         
Sbjct: 168 QLLEDVVGAKSFEIKLNDSLKKIKETEFKKSTIDKELSELKNKLNEMEWEKLELEKFNKF 227

Query: 353 -ENR----FEIVDREKNSL 366
            +NR    F + DRE N L
Sbjct: 228 DKNRKVLQFTLYDRELNDL 246

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 1285 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1342
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1343 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENR 1390
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +   + K EN+
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRV-KYENK 1202

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 84/189 (44%), Gaps = 21/189 (11%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPK---LVISRKAFKNNS 262
              LIH+      + S SV++ F      HD   +I   S   P+    V  R+      
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF------HDPSHRIILPSGIPPRENDEVFVRRTVGLKK 112

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y +N +    +DV ++L+  G  + +   ++ QG +  +   K       D   L  L
Sbjct: 113 DDYQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLL 165

Query: 323 EDIIGTSKY 331
           E+++G   +
Sbjct: 166 EEVVGAKSF 174

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1290 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMF 1375
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 107/228 (46%), Gaps = 34/228 (14%)

Query: 680 IVGFHGRLGDLGTIDNTYDVAVS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARF 736
           + G   +L  L   ++ YD A +    A  RL ++VV+      Q +E  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 737 ILLDKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQ 789
           I L+++  R+ N+ T+Q      P  V    +L+  ++ +   A   +  ++L+ KD + 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEE-EVSRAMEFIFGNSLICKDAET 637

Query: 790 ANRVAYG-QRRYRVVTLDGKLIDVSGTMSGGG-NHVSKGLMMLQRKGQNYFDDYN--PED 845
           A ++ +  Q R R +TL G + D  GT+SGG  N+ S  L+ +Q+        YN   + 
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLIDVQK--------YNKTAKR 689

Query: 846 VEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIM 893
           +E++E  L    ++ E       E E++LQK  + + ++ L   K+ +
Sbjct: 690 IEELELKLKSITRDLE-------EQESKLQKTRSVRNDLNLATHKLTL 730

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 69/115 (60%), Gaps = 4/115 (3%)

Query: 1292 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYR 1162

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHS-ATIKNREILN 1403
            + VAN IKE + NAQFI  + R++M  +A     + K EN+  + A +  R+ +N
Sbjct: 1163 TSVANTIKELSANAQFICTTFRSDMLRVADVFYRV-KYENKISTVAEVSQRDAIN 1216

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 95/201 (47%), Gaps = 16/201 (7%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++T+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG---DTKISETKPKLVISRKAFKNNSSKY 265
              LIH+      + S  V++ F    D  DG   +   S + P  V+ R+       +Y
Sbjct: 61  RQGLIHQGS--GSVMSAYVEIVF----DNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325
            +N K  +  ++  LL+  G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 326 IGTSKYKQLIEKDLIEIESLN 346
            G + +++ +   L ++++ N
Sbjct: 168 TGANSFEKKLRDSLNKMDATN 188

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1174

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 20/154 (12%)

Query: 1229 LNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDP 1288
            LND   KRET+ K  E++ K    +F + FG              +  N+  +LV S   
Sbjct: 1025 LNDY--KRETLLKTWEKVTK----DFGNIFG-------------DLLPNSSAKLVPSEGK 1065

Query: 1289 -FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
              +EG+   V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  
Sbjct: 1066 DITEGLEVKVKLGNIWKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLS 1125

Query: 1348 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1381
            +   + + IK R K AQFIV+SL+  MF  A ++
Sbjct: 1126 HTQNIGHLIKTRFKGAQFIVVSLKEGMFTNANRV 1159

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 685 GRLGDLGTI-DNTYDVAVS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 740
           G    L TI DN  + A +    A  RL ++VV+      Q +E  R  K      I L+
Sbjct: 529 GVAATLFTINDNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTIIPLN 586

Query: 741 KL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRV 793
           K+  R  N NT+       P  V    +LI   D +   A   +   +L+ KD + A +V
Sbjct: 587 KIASRRLNENTVNFAKQLAPGKVDLALNLIGYSD-ELSRAMEFIFGTSLICKDSETAKKV 645

Query: 794 AYGQR-RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM 829
            + Q  R R +TL+G + D  GT+SGG  +    L++
Sbjct: 646 TFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLLL 682

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 66/116 (56%), Gaps = 3/116 (2%)

Query: 1287 DPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1344
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1345 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            D +  + VA  IKE +KNAQFI  + R +M ++A +   + K EN+  +    NRE
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNRE 1214

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 87/191 (45%), Gaps = 24/191 (12%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVIS--------RKAFKN 260
              LIH+      + S SV++ F      HD D   S   P  V+S        R+    
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPDH--SMILPSGVLSRGDDEVTIRRTVGL 111

Query: 261 NSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 320
               Y +N +     D+ ++L+  G  +++   ++ QG++  +   K K         L+
Sbjct: 112 KKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQ 164

Query: 321 YLEDIIGTSKY 331
            LED++G   +
Sbjct: 165 LLEDVVGAKSF 175

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
            YFR031C
          Length = 1171

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1363 AQFIVISLRNNMFELAQQL 1381
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
            (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 75/161 (46%), Gaps = 16/161 (9%)

Query: 680 IVGFHGRLGDLGTIDNTYDVAVS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARF 736
           + G   RL  L   +N Y  A +    A  RL ++VV+  +   Q ++  R  K      
Sbjct: 523 VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTI 578

Query: 737 ILLDKL--RSFNTNTIQ-----TPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQ 789
           I L+K+  R  N  T+      +P NV    +LI  ++     A   +   +L+ KD + 
Sbjct: 579 IPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAET 637

Query: 790 ANRVAYG-QRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM 829
           A +V +  Q R R +TL G + D  GT+SGG  +++  L++
Sbjct: 638 AKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLLV 678

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1304 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1362
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1363 AQFIVISLRNNMF 1375
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 115/255 (45%), Gaps = 34/255 (13%)

Query: 685 GRLGDLGTID--NTYDVAVSTACP--RLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 740
           G    L ++D  N Y       C   RL ++VV+      Q +E  R  K   A  I L+
Sbjct: 525 GIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLN 582

Query: 741 KL--RSFNTNTIQTPKNV-PRLFDL---IKPKDSKFVPAFYSVLRDTLVAKDLKQANRVA 794
           K+  R+ N N +   K+V P   +L   +   + +   A   +   +LV KD + A  V 
Sbjct: 583 KIAARTLNDNIVNMAKSVAPGRVELALNLIGYEEEVRRAMEFIFGSSLVCKDAEAAKMVT 642

Query: 795 YGQR-RYRVVTLDGKLIDVSGTMSGGG-NHVSKGLMMLQRKGQNY---------FDDYNP 843
           +  + R R +TLDG + D  GT+SGG  N+ S  L+ +QR   N           +D   
Sbjct: 643 FNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQRYNNNCNLVKELETKLNDIAK 702

Query: 844 EDVEQIEKDLSDKEKN----FELANNAFYEMENELQ-----KLNNRKPEIELEISKIIME 894
           +   Q E  +S+K KN     ELA +     E  LQ     +L  +  E+E EI++   E
Sbjct: 703 KIAIQFE--ISNKTKNLQKELELAQHKLKLSERNLQSNTAAQLIRKNEELESEIAQCKEE 760

Query: 895 IDTYSAEIKSKERQL 909
           I   +++IK  ++Q+
Sbjct: 761 IKDKTSQIKQLKKQI 775

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 1281 ELVDSLDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1338
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1339 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   + K EN+  + 
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYENKISTV 1206

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  Q V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPK----LVISRKAFKNN 261
              LIH+      + S SV++ F      HD + K+   S   P+     +  R+     
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPEHKMILPSGVVPRENNDEICIRRTVGLK 113

Query: 262 SSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 321
              Y +N +     DV ++L+  G  + +   ++ QG++ ++   K K         L+ 
Sbjct: 114 KDDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQL 166

Query: 322 LEDIIGTSKY 331
           LED++G   +
Sbjct: 167 LEDVVGAKSF 176

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 2/97 (2%)

Query: 1284 DSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1342 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1378
            AALD +  + VAN IKE + +AQFI  + R++M ++A
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVA 1188

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 108/238 (45%), Gaps = 30/238 (12%)

Query: 684 HGRLGDLGTIDNTYD-VAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 742
           HG LG+L  ++  Y   A +     L  +VV+T E     +E L   K G   FI L+++
Sbjct: 536 HGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPLNRI 595

Query: 743 RSFNTNTIQTPKN-----VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQ 797
              ++N +  P N      P ++ +   K  +F  A   V   T+V +D+   +++A   
Sbjct: 596 --ADSNPVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGTGSKLAKS- 650

Query: 798 RRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKE 857
                VTLDG   D  G ++GG +   K         +N  D    +++   ++ L +  
Sbjct: 651 FNLDAVTLDGDRTDKRGLITGGYHDYHK---------RNRLDCL--KEMSAAKRQLLEAT 699

Query: 858 KNFELANNAFYEMENELQKLNNRKPEIELEISK---IIMEIDTYSAEI--KSKERQLQ 910
           KN + A      ++ E+ ++N+   EI+ + S+   I+  I+   A++  K+ ER L+
Sbjct: 700 KNLDAARGQITAIDTEIDQIND---EIKTQSSRKEAILSNIENMRAKLNKKTAERALK 754

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  +KE +KNAQFI  + R +M ++A +   + K EN+  +    NRE
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNRE 1215

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 64/141 (45%), Gaps = 9/141 (6%)

Query: 685 GRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743
           G LG+L  +++ Y           L  IVV+T E     +  L + K G   FI L++L 
Sbjct: 538 GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597

Query: 744 -----SFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR 798
                 F +NT    +  P L   IK  + +F  A   V   T+V KDL Q  ++A  + 
Sbjct: 598 LDSDVKFPSNTTTQIQFTP-LIKKIKY-EPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 799 RYRVVTLDGKLIDVSGTMSGG 819
           +   +TLDG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGVLTGG 675

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  IKE + NAQFI  + R +M ++A +   + K EN+  +    NRE
Sbjct: 1166 TAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNRE 1215

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 87/191 (45%), Gaps = 24/191 (12%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVIS--------RKAFKN 260
              LIH+      + S SV++ F      HD D   S   P  V+S        R+    
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPDH--SMILPSGVLSRGDDEVTIRRTVGL 111

Query: 261 NSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 320
               Y +N +     D+ ++L+  G  +++   ++ QG++  +   K K         L+
Sbjct: 112 KKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQ 164

Query: 321 YLEDIIGTSKY 331
            LED++G   +
Sbjct: 165 LLEDVVGAKSF 175

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 88/213 (41%), Gaps = 34/213 (15%)

Query: 685 GRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743
           G LG+L  +++ Y           L  IVV+T E     +  L + K G   FI L+KL 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKLS 597

Query: 744 -----SFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR 798
                 F +N+    +  P L   IK +  +F  A   V   T+V KDL Q  ++A  + 
Sbjct: 598 LDADVKFPSNSTTQIQFTP-LIKKIKYQ-PRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 799 RYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEK 858
           +   +TLDG   D  G ++GG                 Y D +    ++ +        K
Sbjct: 655 KLNAITLDGDRADKRGVLTGG-----------------YLDQHKRTRLDSL--------K 689

Query: 859 NFELANNAFYEMENELQKLNNRKPEIELEISKI 891
           N   + N    + +ELQ + N   +I+ +I ++
Sbjct: 690 NLNESRNQHKSIGDELQVVRNELNDIDAQIDQL 722

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA+ IK  + NAQFI  + R +M ++A +   + K EN+  +    NR+
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEINRD 1201

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 91/195 (46%), Gaps = 9/195 (4%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I K+ +  FK+Y  + ++  F   ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
              LIH+      + S SV+++F    +     + ++      V  R+        Y IN
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFYDPGNSMILPSGVAVNPDSTVSIRRTVGLKKDDYQIN 118

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
            +    +D+ ++++  G  + +   ++ QG +  +   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILEDVVGA 171

Query: 329 SKYKQLIEKDLIEIE 343
             ++  +   L ++E
Sbjct: 172 KSFEAKLTASLKKME 186

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 192/842 (22%), Positives = 339/842 (40%), Gaps = 160/842 (19%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           + I  + ++ FK+Y  + VV  F    + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 209 LSDLIHKSEKFPDLTSCSVDVEF-------LYAIDEHDGDTKISETKPKLVISRKAFKNN 261
               I++      + S  V++ F       L  +    G+ +I          R+     
Sbjct: 62  RKGFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRI----------RRTVGLK 109

Query: 262 SSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 321
             +Y IN K S   DV ++L+  G    +   ++ QG + ++   K       D   L  
Sbjct: 110 KDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHL 162

Query: 322 LEDIIGTSKYKQLIEKDLIEIES-----------LNEICIEKENRFEIVDREKNSLESGK 370
           LED++G   ++  +++ L ++E+           LNE+    + R   +  EK  LE   
Sbjct: 163 LEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNEL----DKRLSELSDEKEELEKYN 218

Query: 371 NLALEFXXXXXXXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYN--VEKS------- 421
           NL                    + L+  + +L +   +I  L  EYN  +E S       
Sbjct: 219 NL------------NRDRKVLQFCLY--DRELNDITNQIEQLEGEYNSIIENSSEYVNEL 264

Query: 422 -KNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRI-LEGEHVSLDEKLKNLTQXX 479
            K + L  E+N+    +N  +S+IK+ +  +  QLK+ ++ + GE   LD +L ++    
Sbjct: 265 EKREVLAVELNKR---MNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQL 321

Query: 480 XXXXXXXXXXXXXXSSL-------TSEIQELEKSQKEYSDELETLN---QQLQSERESLE 529
                           +        S I E++   ++ S+E E L    ++L   +  L 
Sbjct: 322 DASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELL 381

Query: 530 AMKLK------LKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVK 583
           + K K      + E+   I E+I +    L   NI ++++ T      SQ+S LQ     
Sbjct: 382 SKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNI-LKDQLT------SQLSTLQHDLEN 434

Query: 584 LKNDIKVLSQEVSNQTALKIKREEDLVN---------LKK--QQSSITKEISNGETECND 632
           L  +I+ L+  V+   +  + ++EDL N         L K  Q+  + +     +T    
Sbjct: 435 LNAEIEDLADSVNGMGS--VAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTS 492

Query: 633 GRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGT 692
             + +K  ++ +N    R+    LAL  +QN   ++    +L     + G    +G+L  
Sbjct: 493 LDNDVKRFESDMNETIDRS----LALG-LQNVNDIVN---RLNLHEHVFG---PVGELIK 541

Query: 693 IDNTYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQ 751
           + + Y +         L ++VV+  E     I+ L   K G   FI L+KL   +TN   
Sbjct: 542 VSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH-VDTN-FT 599

Query: 752 TPKNVPR--LFDLIK--PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDG 807
            P N+ +     LIK    D KF      V   TLV K L     +A  + +   +TLDG
Sbjct: 600 YPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAITLDG 658

Query: 808 KLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAF 867
              D  G +SGG                 Y D Y    ++ +        ++F+ +   +
Sbjct: 659 DRADSKGVLSGG-----------------YLDQYKSNRLDTL--------RDFKQSKREY 693

Query: 868 YEMENELQKLNNRKPEIELEISKI-------IMEIDTYSAEIKSKERQLQ----EKTNID 916
            +++ ELQ++      IE EI  +         E D Y A I+    QL+    +K  ID
Sbjct: 694 KKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITID 753

Query: 917 NS 918
           +S
Sbjct: 754 DS 755

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1307 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1366
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1367 VISLRNNMFELAQQLVGIYKCENRTHSAT 1395
              + R +M  +A     + K EN+  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 84/162 (51%), Gaps = 5/162 (3%)

Query: 1243 LEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1302
            ++ LK+ +       F  +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1303 S--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1360
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1361 KNA-QFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREI 1401
            +N  QFI+ + R++M E+A  ++ + K  N+  S    N+ I
Sbjct: 1071 QNGTQFILTTFRSDMIEIA-DMIYMVKYHNKVSSVYETNKTI 1111

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 682 GFHGRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 740
             +G LG+L  +   Y   V   A   L +I+V+T E   Q +  L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 741 KLRSFNTNTIQTPKN----VPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYG 796
           ++   N   I  P N       L   IK  D KF     +V   T+V KDL+  NR+   
Sbjct: 520 RIE--NGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC-K 575

Query: 797 QRRYRVVTLDGKLIDVSGTMSGGGNHVSK 825
           + + + +TLDG  ID  G +SGG  ++++
Sbjct: 576 EFKLQAITLDGDRIDSKGVVSGGYFNINR 604

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1288 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1346 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394
             +    VA  I + + NAQFI  + R++M + A +   + K EN+  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 8/140 (5%)

Query: 685 GRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743
           G +G+L  ++  Y V         L  +VV+T E     +  L + K G   F+ L+KL+
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 744 SFNTNTIQTPK--NVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRR 799
           + N N I  P   N+P    LIK    D +F      V    LV KDL     ++  Q +
Sbjct: 599 NGNQN-IDYPSDPNIP-CTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSIS-KQYK 655

Query: 800 YRVVTLDGKLIDVSGTMSGG 819
              +TLDG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 75.9 bits (185), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 62/109 (56%), Gaps = 3/109 (2%)

Query: 1284 DSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1342 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENR 1390
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   + K EN+
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV-KYENK 1200

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 94/195 (48%), Gaps = 20/195 (10%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I K+ ++ FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTK----ISETKPKLVISRKAFKNNSSK 264
              LI++      + S  V++ F      HD + +    I ++   + I R+       +
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVF------HDAENRTLLGIPDSNGAIRI-RRTVGLKKDE 111

Query: 265 YYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 324
           Y IN K S+ +DV +LL+  G    +   ++ QG + ++   K       D   L+ LE+
Sbjct: 112 YMINNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEE 164

Query: 325 IIGTSKYKQLIEKDL 339
           ++G   +++ +++ L
Sbjct: 165 VVGAKSFERKLKESL 179

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 3/111 (2%)

Query: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNRE 1400
            + VA  IKE + +AQFI  + R +M ++A +   + K EN+  +    N+E
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVNKE 1215

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 93/203 (45%), Gaps = 24/203 (11%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVIS--------RKAFKN 260
              LIH+      + S SV++ F      HD D   S   P  V+S        R+    
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPDH--SMILPSGVLSRGDDEVTIRRTVGL 111

Query: 261 NSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 320
               Y +N +     D+ ++L+  G  + +   ++ QG++  +   K K         L+
Sbjct: 112 KKDDYQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQ 164

Query: 321 YLEDIIGTSKYKQLIEKDLIEIE 343
            LED++G   ++  ++  L ++E
Sbjct: 165 LLEDVVGAKSFEVKLKASLKKME 187

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 9/141 (6%)

Query: 685 GRLGDLGTIDNTYDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743
           G LG+L  +++ Y           L  IVV+T E     +  L + K G   FI L++L 
Sbjct: 538 GTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL- 596

Query: 744 SFNTNTIQTPKNVP---RLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQR 798
            F  + ++ P N     +   LIK      +F  A   V   T+V K+L Q  ++A  + 
Sbjct: 597 -FLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KKH 654

Query: 799 RYRVVTLDGKLIDVSGTMSGG 819
           +   +TLDG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGLLTGG 675

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1225

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 85/189 (44%), Gaps = 21/189 (11%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I ++ +  FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPKL---VISRKAFKNNS 262
              LIH+      + S SV++ F      HD D +I   S   P+    V  R+      
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF------HDPDHRIILSSGVIPRPNDEVFVRRTVGLKK 112

Query: 263 SKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 322
             Y IN +    +D+ ++L+  G  +     ++ QG +  +   K K         L  L
Sbjct: 113 DDYQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLL 165

Query: 323 EDIIGTSKY 331
           ED+IG   +
Sbjct: 166 EDVIGAKSF 174

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
           (REAL)
          Length = 1230

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 14/131 (10%)

Query: 697 YDVAVSTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKN 755
           Y +AVST   R  D ++VE +   Q+CI +L+K + G A FI LD + + +  T+  P +
Sbjct: 549 YGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLPDS 607

Query: 756 VPRLFDL-IKPKDSKFVPAFYSVLRDTL------VAKDLKQANRVAYGQRRYRVVTLDGK 808
              +  +     DS++  A   V  D++      +AKDLK    V     R ++VT++G 
Sbjct: 608 QDYILSINAIDYDSEYEKAMQYVCGDSIICNTLNIAKDLKWKKSV-----RAKLVTIEGA 662

Query: 809 LIDVSGTMSGG 819
           LI  +G M+GG
Sbjct: 663 LIHKAGLMTGG 673

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 148/326 (45%), Gaps = 27/326 (8%)

Query: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208
           ++I K+ +  FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
              LI++      + S  V++ F  A    +  T +      ++  R+       +Y IN
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVFHGA----ENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328
            K ++ +DV +LL+  G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 329 SKYKQLIEKDLIEIESL----NEICI---EKENRFEIVDREKNSLESGKNLALEFXXXXX 381
             +++ +++ L ++E+      +I I   E E +   +D E+  LE   +L  +      
Sbjct: 168 KSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQF 227

Query: 382 XXXXXXXXXXXYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQ 441
                        + + + + TNTL     L+E+Y  E  K ++L   + ++   LN+  
Sbjct: 228 ALYDRELNEVTSMVEKLDGEYTNTL----VLSEQYIQELEKRESLIETLTKS---LNQLG 280

Query: 442 SKIKVLEGEEKQQLKSKRILEGEHVS 467
           S++K+ E  + QQ K   +   +H++
Sbjct: 281 SELKMKESTDLQQAKDSELELAKHLA 306

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 20/161 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 210
           + +L L+NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 211 DLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNN--SSKYYIN 268
           D   K+       S  +DV   +   E  G T        L +SR   +N+  +S YY++
Sbjct: 115 DSFIKN----GADSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 269 GKESNYTDVTKLLK-EEGIDLDHKRFLILQGEVENIAQMKP 308
           G E++   V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 46/175 (26%)

Query: 1200 KYIESTDANIEVLEEYVKRLTEFKTR------KLDLNDAVDKRETVRKQLEELKKTRYEE 1253
            + I   +++I +L+E  ++L + K R      KLD   A     T++ +LE    T  E+
Sbjct: 894  RMINHDESSIAILQEVERKLADVKARLPAMVRKLDA--ATASMSTMQAELEPRLDTIVEK 951

Query: 1254 FMHGF----------GIISMTLKEMYQ------MITMGGNAELELVDSLDPFSEGVTFSV 1297
                F          G I ++   +YQ      M+    NA L+ +DS            
Sbjct: 952  ISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS------------ 999

Query: 1298 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1352
                         SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 ----------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 16/161 (9%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTSFS--AVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I  L L NF +YA    +  FH S S   ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 208 RLSDLIHKSEKFPDL-TSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYY 266
           ++ D I   E    +  +   D E        DG TK++     L  +RKA     S+Y+
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVASDGTTKVTRV---LHRNRKA-----SEYF 154

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           +NG+    + V +L+ E  I LD+    + Q  VE  A++K
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1368 IS 1369
            ++
Sbjct: 1049 VT 1050

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 80/188 (42%), Gaps = 41/188 (21%)

Query: 151 INKLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I KL L NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 208 RLSDLIHKSE----------KFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKA 257
           R+   I   E          + P  T   V V         DG TK+S     L + +K 
Sbjct: 125 RVDSFIKNGENRGLIEVTLKRDPGRTGSFVAV---------DGTTKVSRV---LWVGKK- 171

Query: 258 FKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDG 317
                S+YY+N +  +   V  L+ E  I LD+    + Q  VE  A++K      SD  
Sbjct: 172 -----SEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKL 220

Query: 318 LLEYLEDI 325
           L+E +  +
Sbjct: 221 LMETVRSV 228

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1368 IS 1369
            ++
Sbjct: 1072 VT 1073

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1288 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1347
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1348 NVSIVANYIKERTKN---AQFIVIS 1369
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 103/241 (42%), Gaps = 41/241 (17%)

Query: 151 INKLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I K+ L NF +YA    +  FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 208 RLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNN-SSKYY 266
           R+ D I   E       C +++  L    +  G   +  +   + I+R   ++   S Y+
Sbjct: 104 RVEDFIKNGE-----DECEIEIT-LKNNSKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 267 INGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 326
           IN + ++   V  ++ +  I LD+    + Q  VE  A++K      SD  L E +    
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK------SDKLLFETIRS-- 209

Query: 327 GTSKYKQLIEKDLIEI-ESLNEICIE----------KENRFEIVDREKNSLESGKNLALE 375
                   I+ DLI + E L E+  E          K+ R + +  EK  LE+   +  E
Sbjct: 210 --------IDTDLITVLEELKELQGEELAEEKEVSFKQQRLQELTAEKERLETSVRVLEE 261

Query: 376 F 376
           F
Sbjct: 262 F 262

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1368 IS 1369
            I+
Sbjct: 1054 IT 1055

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 112/242 (46%), Gaps = 30/242 (12%)

Query: 123 LSPVKNNRIKLREL-YDAHNSQSKKERLFINKLTLNNFKSYAGQQV-VGPFHTSFSAVVG 180
           L+P +  R+K++ + YD     S      I K+ L NF +Y   +  + P   S + ++G
Sbjct: 16  LTPSRK-RLKIKPVDYDVFKPGS------IVKIRLENFVTYNYTEFNLSP---SLNMIIG 65

Query: 181 PNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEKFPDLTSC-----SVDVEFL-- 232
           PNGSGKS  + ++      +   + R  ++ D I   +    +        ++D+EFL  
Sbjct: 66  PNGSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNGQDTSKIEIVLKDDPNIDIEFLGS 125

Query: 233 -YAIDEHDGDTK-----ISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGI 286
            +    ++G+ K         + +  I R   K  + +Y ING  +  ++V  L+ +  I
Sbjct: 126 SFHRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHI 185

Query: 287 DLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLN 346
            LD+    + Q  VE  A+++P  EK  D+ +     +++  S ++ L +  L EIE  N
Sbjct: 186 QLDNLCQFLSQERVEEFAKLRP--EKLLDETIRAIDSELL--SMFEVLKKLQLQEIEMSN 241

Query: 347 EI 348
           EI
Sbjct: 242 EI 243

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 92/201 (45%), Gaps = 29/201 (14%)

Query: 1186 LDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDA----VDKRETVRK 1241
             ++  VE  V+ LE  I+ ++ +       V  L + K +  DL D     V K  T+RK
Sbjct: 873  FNLIYVEQIVNKLESKIQLSNHD----RSAVALLEQTKAKIADLEDKLPTQVRKCNTIRK 928

Query: 1242 QLEELKKT---RYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1298
            ++ + +K    R E  + G G       E+++ +   G   L     L  FS+     +M
Sbjct: 929  EMSDKQKVLEPRLESIVSGIG---RKFSELFKDVGTAGGVTLNRKSKL--FSDW-KLEIM 982

Query: 1299 PPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD--FRNV-- 1349
               +    +S L     SGGE+ +S++  + AL K+   P  V+DEI+  +D  F  +  
Sbjct: 983  VQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVH 1042

Query: 1350 -SIVANYIKERTKNAQFIVIS 1369
             ++V N  +E T  +Q+ +I+
Sbjct: 1043 KAMVQNACEEGT--SQYFLIT 1061

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 35/218 (16%)

Query: 130 RIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSN 188
           R+K    YD    Q       I KL L N  +Y+  +  + P   S + +VGPNGSGKS 
Sbjct: 20  RMKPSPTYDYSKFQPGN----IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKST 72

Query: 189 VIDSMLFVFGFRANKM-RQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISET 247
            + ++      +   + R  ++ + I   E      +  +D  FL     H  +  I  T
Sbjct: 73  FVCAVCLGLAGKPEYIGRSKKIDNFIKNGE-----NTAQIDT-FLRG---HMPNEVIKIT 123

Query: 248 KPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           +   +++R   K   S+YYI+   S  T V KL  E  I LD+    + Q  VE+ A++K
Sbjct: 124 R---IMTRNKKK---SEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLK 177

Query: 308 P-----KAEKESDDGLLEYLEDIIGTSKYKQLIEKDLI 340
                 +  +  +  LLE LED+      KQL  K+++
Sbjct: 178 SDKLLIETIRSINPSLLETLEDL------KQLQTKEIV 209

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1368 IS 1369
            I+
Sbjct: 1035 IT 1036

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 23/184 (12%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 209 LSDLIHKSEKFPDLTSC---SVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNS-SK 264
           + D I   E    +      S  VE +  +D  + DT        + I+R+  K+ S S+
Sbjct: 93  VEDFIKNGEDRGSIEITLKNSPKVEGMPGVDS-EADT--------IKITRELIKSKSKSR 143

Query: 265 YYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK-----PKAEKESDDGLL 319
           Y IN +  +  DV  L+ +  I LD+    + Q  VE  A++K      +  +  D  LL
Sbjct: 144 YMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLL 203

Query: 320 EYLE 323
           + LE
Sbjct: 204 DVLE 207

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1365
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1366 IVIS 1369
             +I+
Sbjct: 1039 FLIT 1042

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 112/238 (47%), Gaps = 39/238 (16%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 209 LSDLIHKSEKFPDLTSCSV---------DVEFLYAIDEHDGDTKISETKPKLVISRKAFK 259
           + D I   +   D +   +         D+EF   I+ HD   K++      +I+R   +
Sbjct: 99  VEDFIKNGQ---DTSRIEITLKNSPKIHDIEF---INTHDETIKVTR-----IITRSKRR 147

Query: 260 NNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKES 314
              S Y IN ++ +   V  L+ +  I LD+    + Q  VE  A++K      +  +  
Sbjct: 148 ---SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSI 204

Query: 315 DDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNL 372
           D  LL+ L++++     +Q ++KDL +++ L  + + +E+     D+ + S+ES ++ 
Sbjct: 205 DASLLDVLDELMELQANEQSLQKDL-DVKKLKVVHLRQES-----DKLRKSVESLRDF 256

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 IS 1369
            I+
Sbjct: 1047 IT 1048

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 95/215 (44%), Gaps = 21/215 (9%)

Query: 123 LSPVKNNRIKL--RELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFH--TSFSAV 178
           ++P  NN   L  + L   H+  ++ +   + KL L NF +YA    +  FH   S + +
Sbjct: 30  INPCTNNSKNLSTKRLRIQHSELNEFQPGAVVKLKLTNFVTYA----LTEFHLSPSLNMI 85

Query: 179 VGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKS--EKFPDLTSCSVDVEFLYAI 235
           +GPNGSGKS  + ++      +   + R  ++ + I     E   ++T  +         
Sbjct: 86  IGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVEEYIKNGTDEGVIEITLKNSSALLHSDF 145

Query: 236 DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295
           +  + D  +   K  L + +K      SKYYIN K      V  +++   I LD+    +
Sbjct: 146 NMINTDDDVVHVKRVLSMEKK-----KSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFL 200

Query: 296 LQGEVENIAQMKP-----KAEKESDDGLLEYLEDI 325
            Q  VE  A++KP     +  +  + GLLE L ++
Sbjct: 201 SQERVEEFARLKPDTLLNETIRSIEAGLLEKLSEL 235

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1261 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL--------SG 1312
            IS     ++  +   G  EL+  DS + +        +  K  +R+ S L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1313 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1367
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1368 ISLRNNMF 1375
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1295 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1354
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1355 YIKERTKN---AQFIVIS 1369
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 27/154 (17%)

Query: 1243 LEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGN------------AELELVDSLD--P 1288
            L E  + +Y++    FG +   L+++   I +               A+L+   SL    
Sbjct: 922  LFEKSRDKYKDAEKKFGSVDRALRQLQHSIEVRSQNYTNIQNNTCLEADLDFRASLKVRK 981

Query: 1289 FSEGVTFSVMPPK----------KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1338
            F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A  K   + +  +D
Sbjct: 982  FTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLATWKPMRSRIIALD 1041

Query: 1339 EIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1369
            E D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1042 EFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

 Score = 36.2 bits (82), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 8/78 (10%)

Query: 141 NSQSKKERL---FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFV 196
           +S S+K+ L   +I K+ L NF  +   ++ +GP     + +VG NGSGKS V+ ++   
Sbjct: 63  DSNSRKDDLPCGYIKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIG 119

Query: 197 FGFRANKM-RQDRLSDLI 213
            G +A+   R + + DLI
Sbjct: 120 LGAKASDTNRGNAMKDLI 137

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1297 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1357 KERTK---NAQFIVIS 1369
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           +I KLTL+NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 208 RLSDLI 213
            L DLI
Sbjct: 136 SLKDLI 141

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 95/222 (42%), Gaps = 39/222 (17%)

Query: 1171 ISNGLPILSDDELSALDITLVETEVSD----LEKYIESTDANI-----EVLEEYVKRLTE 1221
            + N +   S D+L ++D+   + E+      + + I+  + ++     +VL+ Y K  T+
Sbjct: 854  VENAVEFCSKDQLESVDLPDSQEEIKHQLEVISRKIQRAEQSLGLPQEKVLDLYEKSRTK 913

Query: 1222 FKTRKLDLNDAVDKRETVRKQLEELK---KTRYEEFMHGFGIIS--------MTLKEMYQ 1270
            +K       D   K   V K LE LK   KTR        G IS        M  +   +
Sbjct: 914  YK-------DGQTKFVEVEKALESLKESIKTRE----LNLGTISKITCFEADMDFRASLK 962

Query: 1271 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1330
            +    GN  L   DS    +    F +    +  RN+  LSGGEK+ S LAL+ A  K  
Sbjct: 963  VRKFSGN--LVFDDSKRTLN---MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPM 1017

Query: 1331 PTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1369
             + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1018 RSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLARTQTIIIT 1059

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           +I K++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   R +
Sbjct: 63  YIKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGN 119

Query: 208 RLSDLI 213
            L +LI
Sbjct: 120 SLKELI 125

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 85/189 (44%), Gaps = 25/189 (13%)

Query: 121 IQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVG 180
           I+LSP++         YD + + S      I K+ + NF +Y    V      SF+ ++G
Sbjct: 36  IKLSPIQ---------YDDYQAGS------IIKIKMKNFMTYG--LVEYQLCPSFNMIIG 78

Query: 181 PNGSGKSNVIDSMLFVFGFRAN-KMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHD 239
           PNGSGKS V+ ++      + +   R D ++  I   +     TS  +++   Y+ D   
Sbjct: 79  PNGSGKSTVVCALGLGLASKLDITGRGDIVTQYIQNGK-----TSGKIEITLKYS-DRIK 132

Query: 240 GDTKISETKPKLVISRK-AFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQG 298
               ++  +  + I R+ +     S Y IN    N  DV  ++ +  I LD+    + Q 
Sbjct: 133 NVKGVNPNRETVTIKREISIDAKKSNYKINNTVVNEKDVRDIVSKLNIQLDNLCQYLPQE 192

Query: 299 EVENIAQMK 307
            +++ A++K
Sbjct: 193 RLKDFARLK 201

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1368 IS 1369
            ++
Sbjct: 1055 VT 1056

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 103/204 (50%), Gaps = 25/204 (12%)

Query: 1180 DDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETV 1239
            +DE S    T++ET ++ LE  I+  + +   ++   + L++ K  +  L   V +  ++
Sbjct: 861  EDESSFTLTTVLET-IAKLETEIQIINHDESAIKILKQTLSDIKYLQEKLPGQVKRLSSI 919

Query: 1240 RKQLEELK---KTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1296
            R+++  ++   + R +E +     IS   ++++  + +G   E+ LV   D +SE     
Sbjct: 920  RRKMWSIRSELEPRLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK--- 970

Query: 1297 VMPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1348
             +  K  +R+++ L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN
Sbjct: 971  -IEIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARN 1029

Query: 1349 VSIVANYIKER--TKN-AQFIVIS 1369
              IV   + E    KN +Q+ +I+
Sbjct: 1030 ERIVHKAMVENACAKNTSQYFLIT 1053

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 73/162 (45%), Gaps = 16/162 (9%)

Query: 151 INKLTLNNFKSYAGQQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I KL L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 208 RLSDLIHKS--EKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
           ++ D I     E   +LT  +      Y++    G  ++   K  ++ ++K        Y
Sbjct: 102 KVEDFIKNGTEESVIELTVKNSKAVSGYSM--IGGSDEVINIKTVIMKAKK-----KCIY 154

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           YING+      V  L+    I LD+    + Q  VE  A++K
Sbjct: 155 YINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 79/175 (45%), Gaps = 17/175 (9%)

Query: 174 SFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEKFPDLTSC---SVDV 229
           S + ++GPNGSGKS  + ++      +   + R  R+ D I   +    +      S  V
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFIKNGQDVSRIEITLKNSPKV 122

Query: 230 EFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLD 289
             +  ++ HD   KI+      +I+R   +   S Y IN  E + + V  L+ +  I LD
Sbjct: 123 NDIENVNAHDETIKITR-----IITRSKRR---SDYLINDCEVSESVVKALVAQLNIQLD 174

Query: 290 HKRFLILQGEVENIAQMKP-----KAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339
           +    + Q  VE  A++K      +  +  D  LL+ L+++      +Q ++KDL
Sbjct: 175 NLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLDVLDELRELQGNEQCLQKDL 229

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 IS 1369
            I+
Sbjct: 1047 IT 1048

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 12/88 (13%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 ISLRNNMFELAQQLVGIYKCEN-RTHSA 1394
            I+         + L G+Y  E  R H  
Sbjct: 1047 IT--------PKLLTGLYYHEKMRVHCV 1066

 Score = 40.4 bits (93), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 16/162 (9%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 209 LSDLIHKSEKFPDLTSC---SVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
           + D I   +    +      S  V  +  I+ HD   KI+      +I+R   +   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
            IN  + +   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 36.6 bits (83), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   R + 
Sbjct: 84  YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 209 LSDLI 213
           L DLI
Sbjct: 142 LKDLI 146

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 209 LSDLIH 214
           L DLI 
Sbjct: 145 LKDLIR 150

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 209 LSDLIH 214
           L DLI 
Sbjct: 139 LKDLIR 144

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 209 LSDLI 213
           L DLI
Sbjct: 140 LKDLI 144

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 209 LSDLIH 214
           L DLI 
Sbjct: 139 LKDLIR 144

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1368 IS 1369
            I+
Sbjct: 1074 IT 1075

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 96/231 (41%), Gaps = 41/231 (17%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDG------------------DTKISE---T 247
           + D I   E   D +   +   FL  ++  D                   D K  +    
Sbjct: 109 VDDYIKNGE---DRSKIEI---FLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLI 162

Query: 248 KPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           K   +I R   K   S YYIN K  +   V  L+K   I LD+    + Q  VE  A++K
Sbjct: 163 KFTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLK 219

Query: 308 P-----KAEKESDDGLLEYLEDIIGTSKYKQLIEKDL-IEIESLNEICIEK 352
                 +  +  D  LL+ LE++      +Q +E +L I+ +   E+C E+
Sbjct: 220 SDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDELEIKQKRYTELCNER 270

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 104/245 (42%), Gaps = 41/245 (16%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 38  IVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKR 94

Query: 209 LSDLIHKSEKF------------PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRK 256
           + D I   E              P     S++++F  A     G   +  T+   +I R 
Sbjct: 95  VDDFIKNGEDTSRIEIFLKNYEDPTELQSSLNLKFNLA-----GKDLLKVTR---LIQRD 146

Query: 257 AFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAE 311
             K  S  Y+IN K      +  L+K   I LD+    + Q  VE  A++K      +  
Sbjct: 147 GNKCKSD-YFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETV 205

Query: 312 KESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKN 371
           +  D  LL+ L+D+  +   +  +E         NE+ I K+ RF  ++ ++N LE+   
Sbjct: 206 RSIDAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEASVR 255

Query: 372 LALEF 376
              EF
Sbjct: 256 SLKEF 260

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 103/245 (42%), Gaps = 58/245 (23%)

Query: 1145 DQTGHELTNTA--VQDDDSMDIDNGAEVIS---NGLPILSDDELSALDITLVETEVSDLE 1199
            D T  +L + A   + D + ++ +  E+I    + + +++ D  S   +  VE E+S LE
Sbjct: 845  DSTREKLNDYAEGYEKDGTFNVTHITEIIDKLESEISMINHDASSITILKQVEKEISQLE 904

Query: 1200 KYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK---TRYEEFMH 1256
            + +      ++ ++E +K+                 R T+  +L+E+ +   TR+     
Sbjct: 905  ETLPKQQVELKSIKEKIKQ----------------GRSTLEPKLDEIIEKISTRFSRLFK 948

Query: 1257 GFGII-SMTLKEMYQ--------MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1307
              G   ++ L + +Q        M+    NA L+ +DS                      
Sbjct: 949  NVGSAGAVNLVKPHQFSEWKIEIMVKFRDNATLKRLDS---------------------- 986

Query: 1308 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQ 1364
               SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q
Sbjct: 987  HTQSGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQ 1046

Query: 1365 FIVIS 1369
            + +I+
Sbjct: 1047 YFLIT 1051

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 92/206 (44%), Gaps = 35/206 (16%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 209 LSDLIHKSEKF----------PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAF 258
           + D I   +            P++T    D+E+   ID  D   KI+      +I+R   
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVT----DIEY---IDARDETIKITR-----IITR--- 143

Query: 259 KNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKE 313
               S Y IN  + + + V  L+ +  I LD+    + Q  VE  A++K      +  + 
Sbjct: 144 SKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRS 203

Query: 314 SDDGLLEYLEDIIGTSKYKQLIEKDL 339
            D  LL+ L+++      +Q ++KDL
Sbjct: 204 IDASLLDVLDELRELQGNEQSLQKDL 229

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1368 IS 1369
            I+
Sbjct: 1047 IT 1048

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 96/211 (45%), Gaps = 33/211 (15%)

Query: 1191 VETEVSDLEKYI---ESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELK 1247
            +ET++ +  ++    EST  N+   ++ +++  E  +RK+  N++ D   +  K LE  +
Sbjct: 856  IETQIENASEFCSEEESTSENLPDNQDDIRKELEDISRKIKRNES-DIGVSYEKALELYE 914

Query: 1248 KT---------RYEEFMHGFGIISMTLKEM-----YQMITMGGNAELELVDSLD--PFSE 1291
            +T         +Y E  +   I++ ++K       YQ  +   +A+ +  +SL    F  
Sbjct: 915  QTMSKFLSAKEKYIEMDNALSILNHSIKSRTVNFGYQKTSTFADADFDFRNSLRIRKFKG 974

Query: 1292 GVTFS--------VMPPK--KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341
             + F            P+  K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D
Sbjct: 975  KLDFGKTKETLNVYTGPQTDKEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYD 1034

Query: 1342 AALDFRNVSIVANYIKERTKN---AQFIVIS 1369
              +D  N       I ++ K+    Q I+I+
Sbjct: 1035 VFMDQVNRKTSTQLIVQKLKDDSRTQTIIIT 1065

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 10/94 (10%)

Query: 127 KNNRIKLRELYDAHNSQ--SKKERL---FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVG 180
           ++N + + +  D   SQ  S KE L   +I K+ L NF  +   ++ +GP     + +VG
Sbjct: 42  RHNFVVMSQHPDLRESQVLSNKETLLPGYIKKIKLVNFMCHEHFELTLGP---RLNFIVG 98

Query: 181 PNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 213
            NGSGKS ++ ++    G +AN   R + L DLI
Sbjct: 99  NNGSGKSAILTAITIGLGAKANSTNRGNSLKDLI 132

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 16/159 (10%)

Query: 151 INKLTLNNFKSYA-GQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           I K+ L NF +Y+  +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 44  IIKIKLWNFVTYSLAEFTLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268
           L D I   E   D +   V    L  + E D +T     K  +   +K       +Y IN
Sbjct: 101 LEDYIKNGE---DQSVVEVT---LKNVPESDFNTDTILIKTTINRGKK-----KPEYAIN 149

Query: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           G     T +   +K+  I LD+    + Q  VE  A++K
Sbjct: 150 GSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK 188

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1368 IS 1369
            I+
Sbjct: 1044 IT 1045

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 202
           +I ++TL NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMI 1052

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1367
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1368 IS 1369
            I+
Sbjct: 1072 IT 1073

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (47%), Gaps = 12/160 (7%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR- 208
           I K+ L+NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R 
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDE-HDGDTKISETKPKLVISRKAFKNNSSKYYI 267
           + D I   E+  ++     + E ++ ++   +G   I+ T+   +++R   K   S+Y I
Sbjct: 123 VDDYIKNDEEHGEIEITLKNSEAIHDVEGVLEGSDTITITR---ILTRSKKK---SEYKI 176

Query: 268 NGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMK 307
           N        V +L+    I LD+    + Q  VE  A++K
Sbjct: 177 NDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 77/186 (41%), Gaps = 23/186 (12%)

Query: 151 INKLTLNNFKSYAGQQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           I  + L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 46  IVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAK 101

Query: 208 RLSDLIHKSEKFPDL---TSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSK 264
           R+ D I        +      S +V  L  I   D    +   +  L+ +R+        
Sbjct: 102 RVEDFIKNGTAESTIEIQLRNSRNVSGLPMISAEDEAINV---RTVLMKARR-----KCA 153

Query: 265 YYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLL 319
           YYING+  +   +  L+    I LD+    + Q  VE  A++K      +  +  D  LL
Sbjct: 154 YYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLL 213

Query: 320 EYLEDI 325
             LE +
Sbjct: 214 GLLEQL 219

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1365
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1366 IVISLRNNM 1374
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1359
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1360 TKNAQFIVISLRN--NMFELAQQLVGIYKCEN 1389
              + Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

 Score = 36.2 bits (82), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           FI ++ L NF  ++   + +GP     + +VG NGSGKS ++ ++    G +A    R  
Sbjct: 63  FIKEIKLTNFMCHSNFSLRLGP---RLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGT 119

Query: 208 RLSDLI 213
            L DLI
Sbjct: 120 SLKDLI 125

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 15/80 (18%)

Query: 1311 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1365
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1366 IVISLRNNMFELAQQLVGIY 1385
             +I+         + L G+Y
Sbjct: 1056 FLIT--------PKLLTGLY 1067

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 68/163 (41%), Gaps = 20/163 (12%)

Query: 153 KLTLNNFKSYAGQQVVGPF--HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 209
           KL + NF +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 210 SDLIHKSEKFPDLTSCSV----DVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKY 265
            D I   E+   L   ++    +VE    +  HD   KI+       +SR       S Y
Sbjct: 104 EDFIKNGEE-KGLVEVTLKKPAEVEHSPIVKSHDQVIKITRH-----LSR---SKRDSDY 154

Query: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKP 308
            IN  E   + V  ++ +  I LD+    + Q  V + A   P
Sbjct: 155 QINDIEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP 197

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 202
           ++ ++TL NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1356
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 28/142 (19%)

Query: 1219 LTEFKTRKLDLNDAVDKRETVRK---QLEELKKTRYEEFMHGFGIISMTLKEMYQMITMG 1275
            ++ F++ KL   DA  K   V K   QL E  K R++         S+T  +    +T  
Sbjct: 914  MSLFESAKLKYKDAEQKFANVDKAVFQLNESLKRRWQ---------SLTYAKTDTCVT-- 962

Query: 1276 GNAELELVDSLD--PFSEGVTFSV----------MPPKKSWRNISNLSGGEKTLSSLALV 1323
              A+ +  +SL    FS G+ F+            P  +  RN+   SGGEK+ S ++L+
Sbjct: 963  --ADTDFKESLRFRNFSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLL 1020

Query: 1324 FALHKYKPTPLYVMDEIDAALD 1345
             A  +   + +  +DE D  +D
Sbjct: 1021 LATWRPMRSRIIALDEFDVFMD 1042

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1308 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1367
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1368 ISL 1370
            IS+
Sbjct: 655  ISI 657

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 95/207 (45%), Gaps = 31/207 (14%)

Query: 500 IQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIK 559
           ++ELE ++ E  +E +   Q+L + +E+ E  K  L EK S I           E  +  
Sbjct: 792 MKELESNKNEILEESKPCFQRLDATKEAFEITKQTLSEKRSRI-----------EKGSSA 840

Query: 560 VQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQT--ALKIKREEDLV--NLKKQ 615
           +   + EI+ ++ ++   Q    K+K++IKVL + +SNQ   AL    EE+ V  NL + 
Sbjct: 841 ISSYEEEIKDIDKRMYNYQSKIEKIKDNIKVLEEGISNQIDKALTFCTEEESVNSNLPED 900

Query: 616 QSSITKEISNGETECNDG--RSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYK 673
           Q+ I K++ N  T   +   RS L   + + N ++    E +   A  Q   +V  AL K
Sbjct: 901 QTEIKKQLLNISTMIQESEKRSGLTHEEIISNFEK---CEEKYTKA-YQKYNEVEDALIK 956

Query: 674 LQKS----------GRIVGFHGRLGDL 690
           L+ S           R V F   LGD 
Sbjct: 957 LEASINERIQTYTETRSVTFTEALGDF 983

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1351
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 150 FINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           +I K+ L NF  +    V    + +F  +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 209 LSDLIHK 215
           L +LI K
Sbjct: 130 LKELIRK 136

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1351
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1289 FSEG-VTFSVMPPKKSW-RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1347 RNVSI----VANYIKERTKNAQFIV 1367
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 36.6 bits (83), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 150 FINKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 207
           FI K+ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    R  
Sbjct: 69  FIKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 125

Query: 208 RLSDLI 213
            L DLI
Sbjct: 126 SLKDLI 131

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1305 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1362
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1363 -AQFIVIS 1369
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 151 INKLTLNNFKSYAGQQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 208
           + K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 209 LSDLIH 214
           L DLI 
Sbjct: 129 LKDLIR 134

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1289 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1348
            F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1349 VSIVANYIKERT 1360
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 1333 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1383
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1384 IYK 1386
              K
Sbjct: 999  FIK 1001

>NDAI0F02090 Chr6 complement(509708..512962) [3255 bp, 1084 aa] {ON}
            Anc_6.161
          Length = 1084

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 1185 ALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLE 1244
            A+D+   +T V ++ +Y ++  AN+E+LE+Y K L   +T +  +N    ++E +R++L 
Sbjct: 867  AMDLEQTKT-VEEVREYAKAFWANLEMLEDYEKYLKIIETEEEKVNKLKYQQEALRRKLA 925

Query: 1245 ELKKTRYE-EFMH 1256
            + +   +E EF+H
Sbjct: 926  QYQNPMFELEFLH 938

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 120/270 (44%), Gaps = 14/270 (5%)

Query: 395 LWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQ 454
           L Q  ++L N   ++S+L ++      K    Q E+ R  QL    +SK+  L     Q+
Sbjct: 567 LSQATTELANLSNQVSSLTKQATEVNDKKARAQQELQRVTQLKTSIESKLATLRASYDQE 626

Query: 455 LKSKRILEGEHVSLDEKLKNLTQXXXXXXXXXXXXXXXXSSLTSEIQELEKSQKEYSDEL 514
           ++    +E   +   +  + L Q                + L  E+Q+ E+S  +  +++
Sbjct: 627 VQQTEKVESLLLQSRKDTETLQQELSVAEANYHAVEGKLTELQKELQDSEQSNSQLKEQI 686

Query: 515 ETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQI 574
             LN    S +  L   + K+K++ S +     ++   LE   I V   K EIQ +  Q+
Sbjct: 687 GNLNAMAASLQTELNEKQQKVKQERSMVD----VNSKQLELNQITVDNLKAEIQGLGEQL 742

Query: 575 SLLQEGQVKLKN---DIKVLSQEVSNQTALKIKREEDL----VNLKKQQSSI---TKEIS 624
           ++  + + +L +   +I+    E+ N+    + +  DL    + L +++  +   TK+I 
Sbjct: 743 AVFFDKRKELDDYSANIEKQHTELQNRHGEFVSKSHDLEAKKLELDQREQDVQQRTKQIE 802

Query: 625 NGETECNDGRSKLKEMKNVLNMQRQRASEA 654
             E   +   +KL+EM + LN QR+  ++A
Sbjct: 803 EQEQIYHQQIAKLQEMFDDLNNQRESFTKA 832

>KLTH0G05632g Chr7 complement(447986..450211) [2226 bp, 741 aa] {ON}
           some similarities with uniprot|Q99248 Saccharomyces
           cerevisiae YOR019W
          Length = 741

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 11/78 (14%)

Query: 234 AIDEHDGDTKIS--ETKPKLVISRKAFKNNSSK---YYINGKESNYTDVTKLLKEEGIDL 288
           A+   DG T +S  E +  LVIS+K    NS +    +I+G++  +T +  LLK+   D+
Sbjct: 205 ALSASDGYTPLSKEEKRKALVISKKVGFPNSPRTLLCHISGRKHTWTPLDWLLKKFSHDV 264

Query: 289 DHKRFLILQGEVENIAQM 306
           DH   L++   + NI +M
Sbjct: 265 DH---LVI---IANIPKM 276

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] {ON}
            some similarities with uniprot|P38853 Saccharomyces
            cerevisiae YHR158c KEL1 involved in cell fusion and
            morphology
          Length = 1136

 Score = 33.5 bits (75), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 1028 ISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKV 1067
            + E    I++++N   + IE+++AH E L++E D LK KV
Sbjct: 1045 VKETASDIANAMNESKRKIEDYKAHTEKLQNEIDGLKGKV 1084

>SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa]
           {ON} similar to uniprot|P24384 Saccharomyces cerevisiae
           YER013W PRP22 RNA-dependent ATPase/ATP-dependent RNA
           helicase in the DEAH-box family associates with the
           lariat intermediate before the second catalytic step of
           splicing
          Length = 1139

 Score = 33.1 bits (74), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 175 FSAVVGPNGSGKSNVIDSMLFVFGFRANKM---RQDRLSDLIHKSEKFPDLTSCSVDVEF 231
           F  +VG  GSGK+  I   L+  GF  N +    Q R    I  +++  +   C+V  E 
Sbjct: 495 FLVIVGETGSGKTTQITQYLYEEGFGRNGIIGCTQPRRVAAISVAKRVAEEVGCTVGEEV 554

Query: 232 LYAI---DEHDGDTKISETKPKLVISRKAFKNNSSKYYI 267
            Y I   DE    TKI      ++       +  SKY I
Sbjct: 555 GYTIRFEDETSPMTKIKYMTDGMLQREALLDSKMSKYSI 593

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1308 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1363
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +  
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG 639

>SAKL0G08316g Chr7 complement(709133..709687) [555 bp, 184 aa] {ON}
            similar to uniprot|P38801 Saccharomyces cerevisiae
            YHR081W LRP1 Substrate-specific nuclear cofactor for
            exosome activity in the processing of stable RNAs homolog
            of mammalian nuclear matrix protein C1D which is involved
            in regulation of DNA repair and recombination
          Length = 184

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 1097 HIKNQIKTLEDSLSKLTLRKMHQVLMALDEESE 1129
            H+ NQI+TLE  + KLT + + + L++L +E E
Sbjct: 13   HLNNQIRTLEPEIKKLTAKSLDEQLLSLKDEKE 45

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 141,383,906
Number of extensions: 6479533
Number of successful extensions: 45637
Number of sequences better than 10.0: 1320
Number of HSP's gapped: 43067
Number of HSP's successfully gapped: 3068
Length of query: 1409
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1287
Effective length of database: 39,492,147
Effective search space: 50826393189
Effective search space used: 50826393189
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)