Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B049908.258ON42042022540.0
NDAI0B019608.258ON43943916910.0
Smik_12.1448.258ON43843816460.0
ZYRO0C01738g8.258ON41442116320.0
Skud_12.1538.258ON43843816280.0
YLR085C (ARP6)8.258ON43843916260.0
Suva_10.1698.258ON43843816210.0
KAFR0B027008.258ON42042316150.0
TDEL0F038508.258ON41942216130.0
Kpol_543.368.258ON42742715920.0
TBLA0H014608.258ON44244215630.0
KLTH0G13772g8.258ON42042115510.0
KNAG0G020108.258ON42442514970.0
CAGL0L12166g8.258ON42141714940.0
Kwal_56.238328.258ON41942114930.0
SAKL0H17138g8.258ON41942414890.0
Ecym_43128.258ON41141714210.0
AGR091W8.258ON41041614210.0
TPHA0A018308.258ON42142414060.0
KLLA0F19063g8.258ON41542513510.0
NCAS0C037008.23ON3754212674e-25
TBLA0C004408.23ON3754212665e-25
TPHA0D002508.23ON3754212658e-25
TDEL0C004708.23ON3754212649e-25
CAGL0K12694g8.23ON3754212649e-25
Suva_6.188.23ON3754212649e-25
Smik_6.398.23ON3754212649e-25
YFL039C (ACT1)8.23ON3754212649e-25
KNAG0L002508.23ON3754212641e-24
KAFR0D009408.23ON3754212641e-24
ABR222W8.23ON3764212641e-24
ZYRO0F02772g8.23ON3754212641e-24
SAKL0B00968g8.23ON3754212631e-24
NDAI0G030408.23ON3754212631e-24
Kpol_1058.158.23ON3754212612e-24
Ecym_15208.23ON3764212604e-24
KLTH0G18832g8.23ON3754212586e-24
KLLA0D05357g8.23ON3754212586e-24
Skud_6.318.23ON3603732524e-23
Kwal_14.11098.23ON3603732462e-22
KLLA0E22925g2.117ON3804132313e-20
Ecym_63852.117ON3774132233e-19
NDAI0G029003.161ON3914392181e-18
ZYRO0B04928g3.161ON3914352181e-18
AFR051W2.117ON4054142111e-17
SAKL0E11814g2.117ON3794282064e-17
NCAS0B071302.117ON3814212057e-17
TBLA0F008703.161ON3913712057e-17
KNAG0K01130na 1ON3933812031e-16
CAGL0K01595g3.161ON3913712022e-16
NCAS0C035503.161ON3923702012e-16
KLTH0F06490g3.161ON3913791994e-16
Smik_4.2063.161ON3913821977e-16
TPHA0I013002.117ON3794211969e-16
KLLA0C03850g3.161ON3913721969e-16
SAKL0C07370g3.161ON3913711969e-16
YDL029W (ARP2)3.161ON3913821961e-15
Kwal_33.141773.161ON3373121941e-15
Skud_4.2223.161ON3913731942e-15
Suva_4.2203.161ON3913821914e-15
Kpol_1023.188.23ON3193361895e-15
Ecym_52373.161ON3913691889e-15
TDEL0D046103.161ON3913691889e-15
ADR316W3.161ON3913691862e-14
Kpol_479.253.161ON3913721844e-14
KAFR0C01040na 1ON3373031799e-14
ZYRO0G05676g2.117ON3814151801e-13
KLTH0B05940g2.117ON3834231773e-13
TDEL0B048102.117ON3734151711e-12
Kwal_33.146422.117ON3834131692e-12
NDAI0B044602.117ON3814181693e-12
TBLA0B010702.117ON3834291693e-12
TPHA0A009203.161ON3913721675e-12
ZYRO0G01936g1.514ON4613851676e-12
KNAG0B001701.514ON4533821651e-11
KAFR0F005902.117ON3864181641e-11
Suva_15.3262.117ON3843681622e-11
Kpol_1056.161.514ON4603851632e-11
KNAG0I018602.248ON7531521606e-11
KLLA0B13904g1.514ON4563911596e-11
Skud_8.1902.117ON3843681586e-11
KNAG0H036502.117ON3874241577e-11
AFR419C1.514ON4553851587e-11
Kwal_23.48482.248ON7451551598e-11
SAKL0D12804g1.514ON4563851579e-11
TBLA0D036801.514ON4583601561e-10
Smik_8.2102.117ON3843691551e-10
TDEL0F004701.514ON4613811561e-10
TPHA0O010401.514ON4582561552e-10
YHR129C (ARP1)2.117ON3843661542e-10
NDAI0A039701.514ON4623851543e-10
NCAS0A122701.514ON4543631533e-10
Ecym_31531.514ON4583861516e-10
Suva_12.1541.514ON4493631507e-10
KAFR0D037001.514ON4493851507e-10
TDEL0C041402.248ON7491371518e-10
YJR065C (ARP3)1.514ON4493631508e-10
Smik_10.3551.514ON4493631499e-10
NDAI0D010602.248ON7531411501e-09
TPHA0C031602.248ON7551291501e-09
YNL059C (ARP5)2.248ON7551521501e-09
Kwal_27.99581.514ON4453261481e-09
Skud_10.2891.514ON4493851481e-09
CAGL0F00517g1.514ON4543821462e-09
Kpol_1003.162.248ON7491321472e-09
ADL253C2.248ON7511351463e-09
KLTH0C02508g1.514ON4513811453e-09
Kpol_282.41.287ON5011061445e-09
SAKL0E08602g2.248ON7471331446e-09
Suva_14.2812.248ON7551551438e-09
AFR105C1.287ON4791051401e-08
TBLA0E038602.248ON7591561411e-08
Skud_14.2722.248ON7551521402e-08
KLLA0F03421g2.248ON7471511392e-08
Smik_14.2672.248ON7551521383e-08
CAGL0H09042g2.117ON3873681354e-08
KLTH0G09482g2.248ON7451521365e-08
Ecym_32852.248ON7461421331e-07
KLLA0D02288g1.287ON5201051321e-07
Ecym_63301.287ON4801051302e-07
CAGL0J10054g2.248ON7541321276e-07
KLTH0H09702g1.287ON4811051267e-07
ZYRO0A01584g2.248ON7481381277e-07
TPHA0I010301.287ON5031061241e-06
TDEL0D015501.287ON480891232e-06
TBLA0D053601.287ON5961251222e-06
Suva_6.1541.287ON4891051204e-06
SAKL0D05874g1.287ON4971051204e-06
Kwal_14.23771.287ON481891186e-06
ZYRO0G21428g1.287ON4831051161e-05
KAFR0A015601.287ON4851051151e-05
KAFR0J011602.248ON7511521152e-05
NCAS0B060601.287ON4971051115e-05
KNAG0B019201.287ON5051051081e-04
CAGL0M03201g1.287ON4931381081e-04
YJL081C (ARP4)1.287ON4891051071e-04
NDAI0G055801.287ON5152281072e-04
Skud_10.1321.287ON4881051052e-04
Smik_10.1611.287ON4891051034e-04
SAKL0F13772g7.448ON422288970.002
NCAS0G030502.248ON743141960.004
Kwal_27.105527.448ON351212860.041
Kwal_27.113078.348ON47987780.45
KLLA0D13354g5.275ON707105770.62
NDAI0A002001.11ON33028750.97
KLLA0E09373g5.604ON629103751.1
NDAI0A046903.443ON2495145751.4
NDAI0A013007.448ON565155713.0
Kpol_520.117.448ON48877713.5
SAKL0F14762gsingletonON73060713.9
SAKL0B06226g8.799ON155749713.9
TDEL0C031207.448ON43854704.5
SAKL0F14784gsingletonON70963704.7
Smik_4.6875.519ON84857705.1
Ecym_10991.94ON2184129696.5
KLTH0C05324g7.448ON399219687.1
ACR184C7.448ON40185687.5
KLTH0F14960g5.477ON775139679.4
Kpol_543.105.477ON876143679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B04990
         (420 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   872   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   655   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   638   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   633   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   631   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   630   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   629   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   626   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   625   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   617   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   606   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   602   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   581   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   580   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   579   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   578   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   551   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   551   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   546   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   525   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   107   4e-25
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   107   5e-25
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   106   8e-25
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   106   9e-25
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   106   9e-25
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   106   9e-25
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   106   9e-25
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   106   9e-25
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   106   1e-24
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   106   1e-24
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   106   1e-24
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   106   1e-24
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   105   1e-24
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   105   1e-24
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   105   2e-24
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   104   4e-24
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   103   6e-24
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   103   6e-24
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   101   4e-23
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    99   2e-22
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    94   3e-20
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    91   3e-19
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    89   1e-18
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    89   1e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    86   1e-17
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    84   4e-17
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    84   7e-17
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    84   7e-17
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    83   1e-16
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    82   2e-16
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    82   2e-16
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    81   4e-16
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    80   7e-16
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    80   9e-16
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    80   9e-16
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    80   9e-16
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    80   1e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    79   1e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    79   2e-15
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    78   4e-15
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    77   5e-15
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    77   9e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    77   9e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    76   2e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    75   4e-14
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    74   9e-14
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    74   1e-13
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    73   3e-13
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    70   1e-12
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    70   2e-12
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    70   3e-12
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    70   3e-12
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    69   5e-12
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    69   6e-12
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    68   1e-11
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    68   1e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    67   2e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    67   2e-11
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    66   6e-11
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    66   6e-11
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    65   6e-11
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    65   7e-11
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    65   7e-11
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    66   8e-11
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    65   9e-11
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    65   1e-10
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    64   1e-10
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    65   1e-10
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    64   2e-10
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    64   2e-10
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     64   3e-10
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    64   3e-10
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    63   6e-10
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    62   7e-10
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    62   7e-10
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    63   8e-10
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    62   8e-10
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    62   9e-10
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    62   1e-09
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    62   1e-09
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    62   1e-09
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    62   1e-09
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    62   1e-09
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    61   2e-09
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    61   2e-09
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    61   3e-09
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    60   3e-09
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    60   5e-09
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    60   6e-09
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    60   8e-09
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    59   1e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    59   1e-08
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    59   2e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    58   2e-08
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    58   3e-08
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    57   4e-08
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    57   5e-08
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    56   1e-07
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    55   1e-07
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    55   2e-07
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    54   6e-07
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    53   7e-07
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    54   7e-07
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    52   1e-06
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    52   2e-06
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    52   2e-06
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    51   4e-06
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    51   4e-06
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    50   6e-06
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    49   1e-05
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    49   1e-05
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    49   2e-05
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    47   5e-05
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    46   1e-04
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    46   1e-04
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    46   1e-04
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    46   2e-04
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    45   2e-04
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    44   4e-04
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    42   0.002
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    42   0.004
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    38   0.041
Kwal_27.11307 s27 (741350..742789) [1440 bp, 479 aa] {ON} YLR142...    35   0.45 
KLLA0D13354g Chr4 (1148444..1150567) [2124 bp, 707 aa] {ON} weak...    34   0.62 
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         33   0.97 
KLLA0E09373g Chr5 complement(832187..834076) [1890 bp, 629 aa] {...    33   1.1  
NDAI0A04690 Chr1 complement(1065525..1073012) [7488 bp, 2495 aa]...    33   1.4  
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    32   3.0  
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    32   3.5  
SAKL0F14762g Chr6 (1186204..1188396) [2193 bp, 730 aa] {ON} weak...    32   3.9  
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    32   3.9  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    32   4.5  
SAKL0F14784g Chr6 (1193821..1195950) [2130 bp, 709 aa] {ON} weak...    32   4.7  
Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416...    32   5.1  
Ecym_1099 Chr1 (206405..212959) [6555 bp, 2184 aa] {ON} similar ...    31   6.5  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    31   7.1  
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    31   7.5  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...    30   9.4  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    30   9.7  

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180
           EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180

Query: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240
           NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV
Sbjct: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240

Query: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFF 300
           SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFF
Sbjct: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFF 300

Query: 301 HPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLP 360
           HPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLP
Sbjct: 301 HPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLP 360

Query: 361 TDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420
           TDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI
Sbjct: 361 TDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/439 (69%), Positives = 367/439 (83%), Gaps = 19/439 (4%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           M+S+P+ +DNGSYEIKFG ++   PYRA+N FA+DKY + YLSNQ+K I++++ VT RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLTSWELES IWDY L+NPDEF GF+L     KHLI SE CMTLPELSKNMDQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSYYKSSIAGFIQF---ADDKNTKI--ISGKTEED----------ISLDSVNQVR 165
           EEYEFDS +K+  AG+I F   ADD+   +  ISGK  +D          IS D++   +
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 166 EK---EYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYD 222
           +K   +Y DY+LVIDSGFNCTWIIP+IKGVPYYKA+KKLDIGGRFL GLLKETLSFRHYD
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 223 VMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD-KTKPLPE 281
           +MDET+LVNNIKE CLFVSPTSYFDSFK K ET+VEY+LP+  +++LG+ R+ K+KPLPE
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 282 NTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGN 341
            +Q +KLYDELFSVPETFFHPEI+RILKPG+VETILESLSM+PE+LRPLLV N+VCTGGN
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 342 FNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEY 401
           FNLPHFA RL +ELQRQLPTDW CR SVP KECELF WK+M QFA+T+SY+KTR+++EEY
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420

Query: 402 YEHGTDWLTKNRFGYQNWI 420
           YEHG DWLTK++FGYQNW+
Sbjct: 421 YEHGPDWLTKHKFGYQNWL 439

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/438 (68%), Positives = 358/438 (81%), Gaps = 18/438 (4%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME++PI IDNGSYEIKFG +    P+RA+NA A DK+ T+YLSN IKNIKDI+SVTFRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLT WELES IWDY  FNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKI--ISGKTEE-DISLDSVNQVR------------ 165
           EEYEFDS +KS +A F+ F     +K+  ISGK E+ DI +   N+              
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 166 EKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD 225
           + +Y+D+QLVIDSGFNCTWIIPV+KG+PYYKAVKKLD+GGRFL GLLKETLSFRHY++MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK---PLPEN 282
           ETILVNNIKE CLFVSP SYFDSFK K++ A+EYVLP+FQT+FLG+VR++ K   PL E+
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342
            QTI L DELF++PETFFHPEIA+I KPG+VE ILESLSM+PE++RPL+VGN+VCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402
           NLP+FA RL +ELQRQLPTDW C  SVP  +C LFGW+ M+QF+ST SYR  RVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 403 EHGTDWLTKNRFGYQNWI 420
           EHG+DW TK+RFGYQNWI
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/421 (70%), Positives = 352/421 (83%), Gaps = 8/421 (1%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           MES PI +DNGSYEIKFGT DL +P+RA NA A DK+ + YLSNQIK IKDI+SV FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HE GQLTSWELES+IWDY  FNPDEF GFDL D KG+HL+ SETCMT+PELSKNMDQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKE-YNDYQLVIDSG 179
           EEYEF S +KS IAGF  F   + +  ISGK +     D  N+  E + Y  +QLVID G
Sbjct: 121 EEYEFASMFKSPIAGFAPFG--RPSIAISGKGD-----DQPNRKAEPDAYEPFQLVIDVG 173

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239
           FNCTW++PVIKG+PYYKAVKKLDIGGRFL+GLLKETLSFRHY+VMDETILVNNIKENCLF
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLF 233

Query: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299
           VSP SYF+SFK+K +TAVEYVLP+FQT+FLG+V+D  KPLP+++QT++L DELFSVPETF
Sbjct: 234 VSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETF 293

Query: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359
           FHPEI ++LKPG++ETILESLS++PE LRPL++GN+VCTGGNFNLP+FATRL +ELQRQL
Sbjct: 294 FHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQL 353

Query: 360 PTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNW 419
           PTDW C   +P+   EL+GW +MA F ++  Y   RVTREEY+EHG DW T++RFGYQNW
Sbjct: 354 PTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNW 413

Query: 420 I 420
           +
Sbjct: 414 M 414

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/438 (68%), Positives = 353/438 (80%), Gaps = 18/438 (4%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME SPI IDNGSYEIKF  +    P+RA+NA A DK+ T+YLSN IKNIKDI+S+TFRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLT WELES IWDY  FNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKI--ISGKTEEDISLDSVN-------------QVR 165
           EEYEFDS +KS +A F+ F      K+  ISGK EE   + S +             Q  
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 166 EKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD 225
           + +Y+D+QLVIDSGFNCTWIIPV+KG+PYYKAVKKLDIGGRFL GLLKETLSFRHY++MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVR---DKTKPLPEN 282
           ETILVNN+KE CLFVSP SYFDSFK K++ A+EYVLP+FQT+F+G+VR   ++  PLPE+
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342
            QTI L DELF++PETFFHPEI++I KPG+VE ILESLSM+PE++RPL+VGN+VCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402
           NLP+FA RL +ELQRQLPTDW C  SVP  +C LFGW+ M+QFA TESYR+ RVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 403 EHGTDWLTKNRFGYQNWI 420
           EHG DW TK RFGYQNWI
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/439 (68%), Positives = 353/439 (80%), Gaps = 20/439 (4%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME+ PI IDNGSYEIKFG +    P+RA+NA A DK+ T+YLSN IKNIKDI+S+TFRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLT WELES IWDY LFNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADD--KNTKIISGKTEEDISL--------------DSVNQV 164
           EEYEFDS +KS +A F+ F        + ISGK +EDI +                  Q 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGK-DEDIDIVRGNSDSTNSTSSESKNAQD 179

Query: 165 REKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVM 224
              +Y+D+QLVIDSGFNCTWIIPV+KG+PYYKAVKKLDIGGRFL GLLKETLSFRHY++M
Sbjct: 180 SGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMM 239

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK---PLPE 281
           DETILVNNIKE CLFVSP SYFDSFK K++ A+EYVLP+FQT+FLG+VR+  K   PLPE
Sbjct: 240 DETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPE 299

Query: 282 NTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGN 341
           + Q I L DELF++PETFFHPEI++I KPG+VE ILESLSM+PE++RPL+VGN+VCTGGN
Sbjct: 300 DAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGN 359

Query: 342 FNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEY 401
           FNLP+FA RL +ELQRQLPTDW C  SVP  +C LFGW+ M+QFA T+SYRK RVTREEY
Sbjct: 360 FNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEY 419

Query: 402 YEHGTDWLTKNRFGYQNWI 420
           YEHG DW TK+RFGYQNWI
Sbjct: 420 YEHGPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/438 (68%), Positives = 356/438 (81%), Gaps = 18/438 (4%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME+ PI IDNGSYEIKFG +    P+RA+NA A DK+ T+YLSN IKNIKDI+SVTFRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLT WELES IWDY LFNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKI--ISGKTEE---------DISLDSVNQVRE--- 166
           EEYEFDS +KS +A F+ F      K+  ISGK E+         D +  S   V E   
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 167 -KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD 225
             +Y+D+QLVIDSGF+CTWIIPV+KG+PYYKAVKKLDIGGRFL GLLKETLSFRHY++MD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVR---DKTKPLPEN 282
           ETILVNNIKE CLFVSPTSYFDSFK+KN+  +EYVLP+FQT+F+G+VR   ++  PLP +
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342
            Q+I L DELF++PETFFHPEI++I+KPG+VE ILESLSM+PE++RPL++GN+VCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402
           NLP+FA RL  ELQRQLPTDW C  SVP  +C LFGW+ M+QFA TESY++ RVTREEYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 403 EHGTDWLTKNRFGYQNWI 420
           EHG DW TK+RFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/423 (68%), Positives = 353/423 (83%), Gaps = 6/423 (1%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME +P+ IDNGSY +KFG   L +PY A+NA A DKY  +YLSNQIK+IKDI+SV+ +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           H LGQLTSWE+++ IWDY L+NPDEF GF++ D K KHLI SETCMTLPEL KNMDQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180
           EEYEF S  KS +AG++ F  +   +II G+ + +  +++ +    +EY D+QLV+DSGF
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST---EEYRDFQLVVDSGF 177

Query: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240
           NCTWIIPVIKG+PYYKAVKKLDIGGRFL+GLLKETLSFRHY+VMDETILVNNIKE CLFV
Sbjct: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFV 237

Query: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVR---DKTKPLPENTQTIKLYDELFSVPE 297
           SP SYFDSFKNK+ T+ EYVLP+FQT+FLG+VR   ++ KPLPE++Q+I L DELF+VPE
Sbjct: 238 SPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPE 297

Query: 298 TFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQR 357
           TFFHPEI++ILKPGLVETILESLSM+PE++RPL+V N++C GGNFNLPHFA+R+  ELQR
Sbjct: 298 TFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQR 357

Query: 358 QLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQ 417
           QLPTDW CR ++     EL GWKAM+ FAST+ Y+ TRVTREEYYEHG DW TK+RFGYQ
Sbjct: 358 QLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417

Query: 418 NWI 420
           NW+
Sbjct: 418 NWV 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/422 (68%), Positives = 350/422 (82%), Gaps = 5/422 (1%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           MES P+ +DNGSYE+KFG +  S P+RA+NA A DK+  TYLSNQI  IKDI+SV+F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HE GQLTSWEL+S +WDY  FNP+EF GFDL D KG+HLIASETCMTLPELSKNMDQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADD-KNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179
           EEYEFDS  K+ I+GF+ F+   +NTK+ISGK + +      +    K+Y  +Q+VIDSG
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSE---SGTSTSETKDYEPFQMVIDSG 177

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239
           FNCTW++P+IKGVP+YKAVKKLD+GGRF++GLLKETLSFRHY+VMDETILVNNIKE CLF
Sbjct: 178 FNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLF 237

Query: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299
           +SP SYFDSF  K++TAVEYVLP+FQTTFLG+V D+  P  ++ QT+ L DELFSVPETF
Sbjct: 238 MSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETF 297

Query: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359
           FHPEIA++LKPG++ETILESLS+VPE LRPL+V N++CTGGNFNLPHF  RL +ELQRQL
Sbjct: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357

Query: 360 PTDWICRTSVPT-KECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQN 418
           PTDW  +  +P  K CEL GW +M+ FAST+ Y+  RV+R+EYYEHG +W TKNRFGYQN
Sbjct: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417

Query: 419 WI 420
           WI
Sbjct: 418 WI 419

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/427 (67%), Positives = 351/427 (82%), Gaps = 7/427 (1%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME +PI IDNGSYE+KFG +D   P RA+NA A DKY   YLSNQ+ NIKDI+SVT RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQL SWELE ++WDY  FNPDEFP F+L + KG HL+ SETCMTLPELS NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSYYKSSIAGFIQFAD-DKNTKIISGKTEE---DISLDSVNQVREKEYNDYQLVI 176
           EEYEF+S +KS +AGF+ F +   N K+I GK ++   D+  +  +Q  +  Y+D+ LVI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 177 DSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKEN 236
           DSGFNCTWIIP+IKGVPYYKAVKK+++GGRFL+GL KET+S+RHYDV DETILVNNIKE 
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 237 CLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDK--TKPLPENTQTIKLYDELFS 294
           CLF+SPTSY DSFKNK+  +V+YVLP+FQT+F+G+V+DK     LPEN+Q I L DELFS
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 295 VPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSE 354
           VPET FHPE+A++LKPG+VETILESLS+VPE +RPLLV N+VC GGNFN+P+F +RL +E
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 355 LQRQLPTDWICRTSVPTKECELFGWKAMAQFA-STESYRKTRVTREEYYEHGTDWLTKNR 413
           LQRQLPTDW+C   +P K+CEL GWK+M+QFA +T+ Y+K R++REEYYEHGTDW TK R
Sbjct: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420

Query: 414 FGYQNWI 420
           FGYQNWI
Sbjct: 421 FGYQNWI 427

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/442 (65%), Positives = 347/442 (78%), Gaps = 22/442 (4%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           M+  PI IDNGSYEIKFG ++   P+RAINA A DKY+T YLSNQIK IKDI+SV FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           +ELGQLTSWELES+IWDY  +NP+EF GF L D   KHL+ SETC++LPE S+N+D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSYYKSSIAGFIQFAD-DKNTKIISGKT-----------EEDISLDSVNQ----- 163
           EEY + S YKS +AGFI FAD  K+   ISGK            +E +  + +N      
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 164 ----VREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFR 219
                +  EY D+QL+IDSGFNCTWIIPVIKG+PYYKA+KK+DIGGRFL GLLKETLSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 220 HYDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK-P 278
           HY+V DETILVNNIKE CLFV+P SY +SFK KN+TAVEYVLP+F TTF+G+++D +K  
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 279 LPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCT 338
           LP+N Q I L DELFSV ET FHPEI+RILKPG++ETI+ESLSM+PE++RPL+V N+VC 
Sbjct: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360

Query: 339 GGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTR 398
           GGNFNLP+F+ RLTSELQRQLPTDW     +P  + ELFGWKAMAQF+ T+SYRK R+TR
Sbjct: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420

Query: 399 EEYYEHGTDWLTKNRFGYQNWI 420
           EEY EHG +W TK+RFGYQNWI
Sbjct: 421 EEYMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 344/421 (81%), Gaps = 2/421 (0%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME +PI IDNGSYEIKFGT   + P+ A+N+ A DKY   +LSNQ+++IKDI+SVTF RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           H+LGQL SWELES IWDY LFNPDEF G+ L+  K KHLIASE+CMTLPELSKNMDQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSYYKSSIAGFIQF-ADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179
           EEYE+DS +K+ +  F+ F A+   T I+  K + D+ + S +    K+Y DY+LVIDSG
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV-VASDHPSDNKDYRDYELVIDSG 179

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239
           FNCTW++PVIKGVPYYKAVKKLDIGGRFL+G L+E LSFRHY+VMDETILVN+IKE CLF
Sbjct: 180 FNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLF 239

Query: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299
           +SP SYFDSF+++ +TA EYVLP+F T+F G++R   + LPE++QTI L DELF+VPETF
Sbjct: 240 MSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETF 299

Query: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359
           FHPEIA +L PG++E ILES+SM+PE LRPLLVGN+V TGGNFN+P+FA+RL +ELQRQ 
Sbjct: 300 FHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQC 359

Query: 360 PTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNW 419
           PTDW CR SVPT +  L+GWK M +F+ T++YR++RV+REEYYEHG DW T  RFGYQ W
Sbjct: 360 PTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAW 419

Query: 420 I 420
           +
Sbjct: 420 L 420

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/425 (65%), Positives = 339/425 (79%), Gaps = 12/425 (2%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELG 64
           P  IDNGSYEIKFG  +L +P+RA N  A DKY  +YLSN +K I+DI+S T RRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTSWELESSIWDYALFNPDEFPGFDLND-LKGKHLIASETCMTLPELSKNMDQVVFEEY 123
           QL SWELE  IWDY L+NPDEF GF L D  + + LI +ETC TLPELSKN DQVVFEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFDSYYKSSIAGFIQFAD---DKNTKIISGKTEEDISLDS-VNQVREKEYNDYQLVIDSG 179
           EF + +KS  +GF+ FA+   +KN + + GK   D ++++       KEY D+QLVIDSG
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGK---DTAVNTDYTTATTKEYRDFQLVIDSG 179

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239
           FNCTW++P+IKGVP+YKA+KK+DIGGRFL+GLLKETLSFRHY++MDETIL+NNIKE CLF
Sbjct: 180 FNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLF 239

Query: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKT--KPLPENT-QTIKLYDELFSVP 296
           VSP SYFDSFK K + AVEYVLP+FQT+FLG++ D++  K +   + QTI L DE F+VP
Sbjct: 240 VSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVP 299

Query: 297 ETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQ 356
           ETFFHPE+A ILKPGLVETILE++SMVPE LRP+LV N+VC GGNF LPH ++RLTSELQ
Sbjct: 300 ETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQ 359

Query: 357 RQLPTDWICRTSVP-TKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFG 415
           RQLPTDW CR +VP + +CEL  W AMAQF+ST+ Y+ TRVTREEY EHGTDW +K+RF 
Sbjct: 360 RQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFT 419

Query: 416 YQNWI 420
           YQNWI
Sbjct: 420 YQNWI 424

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/417 (64%), Positives = 331/417 (79%), Gaps = 4/417 (0%)

Query: 6   IAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELGQ 65
           I IDNGSY++KFG      P  A+NA A DKY  T+LSNQ++NIKDI+SV FRRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYEF 125
           LTSWELES IWDY L+NPDEF G D   L+ +H++ SETCMTLPELSKN DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSYYKSSIAGFIQF-ADDKNTKIISGKTEEDISLDSVNQVRE-KEYNDYQLVIDSGFNCT 183
           DS YK+  A +I F   ++N K ISGK++    LD   ++   KEYND+ LVIDSGFNCT
Sbjct: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHG-ELDIEEKIEAGKEYNDFSLVIDSGFNCT 184

Query: 184 WIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFVSPT 243
           W+IP++KGVPYYKAVKKLD+GGRFL+GLLKET+SFRHY+VMDE+ILVNNIKE CL+V P 
Sbjct: 185 WVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPV 244

Query: 244 SYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPE 303
           SYF++FK K +  +++VLP+FQT+F G+VRD    LP+N Q + L DE FSVPE FFHPE
Sbjct: 245 SYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPE 304

Query: 304 IARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDW 363
           I++ LKPG++ET+LES+ M+PELLRPL+  N+VC GGNFNLP F  RL SELQRQLPTDW
Sbjct: 305 ISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDW 364

Query: 364 ICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420
           +CR  + + +  L GW AMA+FA T++Y+K RVT+E+Y+EHG DW TK RFGYQNW+
Sbjct: 365 VCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/421 (63%), Positives = 337/421 (80%), Gaps = 3/421 (0%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           ME SP+ IDNGSYEIKFG+     P+RA+N+ A DKY   +LSNQ+++IKDI+SV F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQL SWELE+ IWDY LFNPD+F G+ ++  KGKHLI SE+CMT+PELSKNMDQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSYYKSSIAGFIQF-ADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179
           EEYEF++ +K+ +  F+ F    K+T ++  K +    ++       K YND+QLVIDSG
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDS--EVEESEVAPAKNYNDFQLVIDSG 178

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239
           FNC+WI+PVIKGVPYYKAVKKLDIGGRFL+G L+E LSFRHY+VMDETILVN+IKENCLF
Sbjct: 179 FNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLF 238

Query: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299
           +SP +YF+SF+++++TA EYVLP+F T+F G++R   + LP  +QTI L DELF+VPETF
Sbjct: 239 MSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETF 298

Query: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359
           FHPEIA +L  G+VETILES+SM+PE +RPL+VGN+V TGGNFN+P+FA+RL +ELQRQ 
Sbjct: 299 FHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQC 358

Query: 360 PTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNW 419
           PTDW CR S+P  +  L+GWK M +F+ TE Y ++RVTR+EYYEHG DW T  RFGYQ W
Sbjct: 359 PTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAW 418

Query: 420 I 420
           +
Sbjct: 419 L 419

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/424 (63%), Positives = 337/424 (79%), Gaps = 9/424 (2%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           M+ +PI IDNGSYE+KFG    S+P+RA+NA A DKY   +LSNQ+  +KDI++V FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           HELGQLTSWEL+S IWDY L+NPDEF  +++ + KGKHL+ SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSYYKSSIAGFIQF---ADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177
           EEYEF S +K  +AGF+ F   A + N  +I  K +     DS  +    EYND+QLVID
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHN--MIYAKEDSVYRKDSTGE--RNEYNDFQLVID 175

Query: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENC 237
           SGFNCTW++P++KG+PYYKA+KKLDIGGRFL+G LKETLSFRHY+VMDETILVNNIKE C
Sbjct: 176 SGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKC 235

Query: 238 LFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPE 297
           LF+SP SYF+SF+ K +T  EYVLP+FQT+F G+V+ + + +PE++QTIKLYDELFS+PE
Sbjct: 236 LFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPE 295

Query: 298 TFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQR 357
           TFFHPEIA +LKPG+VETILES+SM+PE +RPL+V N V TGGNFN+ +FA RL +ELQR
Sbjct: 296 TFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQR 355

Query: 358 QLPTDWICRTSVP-TKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGY 416
           Q PTDW    SVP   +  LFGW +M QF+ T +Y++TRVTREEYYEHG DW TK RFGY
Sbjct: 356 QCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGY 415

Query: 417 QNWI 420
           Q W+
Sbjct: 416 QKWL 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 323/417 (77%), Gaps = 10/417 (2%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELG 64
           PI IDNGSYEIKFG + L SPYRA+N  A DKY   +LSNQ+K I+++++   RRP ELG
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYE 124
           QL SWELE  IWDY LFN DEF  +DL D K   LI SETCM++PE+SK+MDQVVFEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKE-YNDYQLVIDSGFNCT 183
           F S  K  +A +I F +  + K+           D +  VR+K+ YND+QLV+DSGFNCT
Sbjct: 123 FGSLMKCPVAQYIPFDNMADYKVYGS--------DGLPVVRKKDDYNDFQLVVDSGFNCT 174

Query: 184 WIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFVSPT 243
           W+IPVIKGVPYYKAVKKLDIGGRFL GLLKET+SFRHY++MDETIL NNIKE C F+ P 
Sbjct: 175 WVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPV 234

Query: 244 SYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPE 303
           SYFDSF+ K ET ++YVLP+FQT+ +G+VR   + +PE++QT+ L DELF++PETFFHPE
Sbjct: 235 SYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPE 294

Query: 304 IARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDW 363
           IA ILKPGL+ET+LES+SM+PEL+RPL+V N+   GGNFN+ +FA+RL +ELQRQ PTDW
Sbjct: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDW 354

Query: 364 ICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420
             R  +P  + EL GWKAM +F++T+SY++ RVTR EY EHG DW TK RFGY+ WI
Sbjct: 355 SVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 318/416 (76%), Gaps = 9/416 (2%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELG 64
           P+ ++NGSYEIKFG  +L +PYRA N    D+Y   +LSNQ+  I+DI+    RRP ELG
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYE 124
           QL SWELE  IWDY LFNPDEF G++L D K   LIASETCMT+PE+SKNMDQVVFEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGFNCTW 184
           F S  K  +A F+ F   ++  I+ G  E       V + +   YN++QLV+DSGFNCTW
Sbjct: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGE-------VVEAKSG-YNNFQLVVDSGFNCTW 174

Query: 185 IIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFVSPTS 244
           ++PVIKGVPYYKA KKLDIGGRFL+GLLKET+SFRHY+VMDETIL+NNIKE C F+ P S
Sbjct: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVS 234

Query: 245 YFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPEI 304
           YFDSF+ K ET VEY+LP+FQT+ +G+VR   + +P+ +Q ++L DELF+VPETFFHPEI
Sbjct: 235 YFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEI 294

Query: 305 ARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWI 364
           + ILKPGLVETILE +SMVPE+LRPLLV N+V  GGNFN+ +FATRL +ELQRQ PTDW 
Sbjct: 295 SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWK 354

Query: 365 CRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420
            R   P  +  L GWK+M QF+ T+SY+ +RVTR EY EHG DW TK+RFGY+ WI
Sbjct: 355 VRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 324/424 (76%), Gaps = 7/424 (1%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           M  +P+ IDNGSYEIKFG ++  +P+ A+NA A DKY T YLSNQI NIKDI+SV+ +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120
           H+LGQL SWELE  IWDY  +N D+F GF++N+    HL+ +ET MTLPELS+N DQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180
           EEY FDS YK+  A FI F  + +   I    +    LD     +E  Y D+ LVIDSG+
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDG---SKENNYQDFNLVIDSGY 177

Query: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240
           NC+WIIP+IKGVPYYKAVKK+D+GGRFL+GLLKET+S+RHYDV DE++LVNNIKENC+F+
Sbjct: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFI 237

Query: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD--KTKPLPENTQTIKLYDELFSVPET 298
           SP SY +SFK K  T VEYVLP+FQT+F+G+VRD  K   LPE++Q+I L DELFSVPE 
Sbjct: 238 SPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEG 297

Query: 299 FFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQ 358
           FFHPE+A +LKPG++ETILESL ++PE LR L+V N+VCTGGNFN+P+F +R+ +ELQ+Q
Sbjct: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357

Query: 359 LPTDWICRTSVPTKECELFGWKAMAQFAST--ESYRKTRVTREEYYEHGTDWLTKNRFGY 416
           + T+W+C  S+P    EL  WKAM  F     E Y+ TRVT++EY EHG +W TK RFGY
Sbjct: 358 VQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417

Query: 417 QNWI 420
           QNW+
Sbjct: 418 QNWL 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/425 (59%), Positives = 313/425 (73%), Gaps = 15/425 (3%)

Query: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60
           M    + IDNGSYEIKFG +    P RA+N    DKY   +LSNQ K ++DI+    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDL---NDLKGKHLIASETCMTLPELSKNMDQ 117
           HELGQL SWELES +WDY  +N D+F  ++L   ND K  HL+ SET MT+PELSKNMDQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDF-HWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177
           V+FEEY+F S +K  +A +I F          G+ ++D ++ +    +   Y D+QLVID
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPF--------YQGQYQDD-AMTAAEDKKTSSYKDFQLVID 170

Query: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENC 237
           SGFNCTW +P+IKGVPYYKA+KKLDIGGRFL GLL+ET+SFRHY+VM+ETILVNNIKE C
Sbjct: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQC 230

Query: 238 LFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK-PLPENTQTIKLYDELFSVP 296
            FV P SYF SF NK  T VEYVLP+FQT+FLG+V+   K  L ++ QT+ L DE+FSVP
Sbjct: 231 TFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVP 290

Query: 297 ETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQ 356
           ETFFHPEIA+ILKPG+VETILE ++M PE++RPLLV N+VCTGGNFN+P+F  RL +ELQ
Sbjct: 291 ETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350

Query: 357 RQLPTDWICRTSVPT-KECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFG 415
           RQ P DW C+   P  K+  L GW++M  FA+++ +R  RVTREEY EHG DW TKNRFG
Sbjct: 351 RQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFG 410

Query: 416 YQNWI 420
           YQ W+
Sbjct: 411 YQQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  107 bits (267), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP I  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  107 bits (266), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMEVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 64

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 111

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 112 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 152

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR +   L + LS R Y     
Sbjct: 153 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTT 204

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 205 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSAI----EKSYELPDG-Q 247

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 248 VITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 307

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 308 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 366

Query: 405 G 405
           G
Sbjct: 367 G 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSV----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/421 (23%), Positives = 176/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR +   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSAI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 177/421 (42%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAS-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG+   
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  105 bits (261), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 99/421 (23%), Positives = 175/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G      + ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  104 bits (260), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 98/421 (23%), Positives = 169/421 (40%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H            Y+ ++ ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRG 64

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 111

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 112 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 152

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR +   L + LS R Y     
Sbjct: 153 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTT 204

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V               A++Y     QT       +K+  LP+  Q
Sbjct: 205 AEREIVRDIKEKLCYV---------------ALDYD-QEMQTAAQSSAIEKSYELPDG-Q 247

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 248 VITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 307

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 308 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 366

Query: 405 G 405
           G
Sbjct: 367 G 367

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  103 bits (258), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 98/421 (23%), Positives = 175/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G      + ++D+ GR +   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSAI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  103 bits (258), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 97/421 (23%), Positives = 173/421 (41%), Gaps = 75/421 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKNNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G     A+ ++D+ GR +   L + L+ R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+     D F+ + +TA +               +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVA----LD-FEQEMQTASQ-----------SSAVEKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
            I + +E F  PE  FHP +  +   G+ +T   S+      +R  L GN+V +GG    
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           P  A R+  E+    P+    +   P  E +   W   +  AS  ++++  ++++EY E 
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 405 G 405
           G
Sbjct: 366 G 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 162/373 (43%), Gaps = 65/373 (17%)

Query: 40  TYLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDL 94
           +Y+ ++ ++ + I  +T R P E G +T+W+    IW +  +N     P+E P       
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP------- 87

Query: 95  KGKHLIASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEE 154
               ++ +E  M      + M Q++FE +   ++Y S  A    ++  + T I       
Sbjct: 88  ----VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------- 136

Query: 155 DISLDSVNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKE 214
                               V+DSG   T ++P+  G     A+ ++D+ GR L   L +
Sbjct: 137 --------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 176

Query: 215 TLSFRHY--DVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHV 272
            LS R Y      E  +V +IKE   +V+     D F+ + +TA        Q++ +   
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSSI--- 221

Query: 273 RDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLV 332
            +K+  LP+  Q I + +E F  PE  FHP +  +   G+ +T   S+      +R  L 
Sbjct: 222 -EKSYELPDG-QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELY 279

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYR 392
           GN+V +GG    P  A R+  E+    P+    +   P  E +   W   +  AS  +++
Sbjct: 280 GNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQ 338

Query: 393 KTRVTREEYYEHG 405
           +  ++++EY E G
Sbjct: 339 QMWISKQEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 161/373 (43%), Gaps = 65/373 (17%)

Query: 40  TYLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDL 94
           +Y+ ++ ++ + I  +T R P E G +T+W+    IW +  +N     P+E P       
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP------- 87

Query: 95  KGKHLIASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEE 154
               ++ +E  M      + M Q++FE +   ++Y S  A    ++  + T I       
Sbjct: 88  ----VLLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGI------- 136

Query: 155 DISLDSVNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKE 214
                               V+DSG   T ++P+  G      + ++D+ GR +   L +
Sbjct: 137 --------------------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 176

Query: 215 TLSFRHY--DVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHV 272
            LS R Y      E  +V +IKE   +V+     D F+ + +TA        Q++ +   
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVA----LD-FEQEMQTAA-------QSSAI--- 221

Query: 273 RDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLV 332
            +K+  LP+  Q I + +E F  PE  FHP +  +   G+ +T   S+      +R  L 
Sbjct: 222 -EKSYELPDG-QVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELY 279

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYR 392
           GN+V +GG    P  A R+  E+    P+    +   P  E +   W   +  AS  +++
Sbjct: 280 GNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTFQ 338

Query: 393 KTRVTREEYYEHG 405
           +  ++++EY E G
Sbjct: 339 QMWISKQEYDESG 351

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 99/413 (23%), Positives = 170/413 (41%), Gaps = 62/413 (15%)

Query: 3   SSPIAIDNGSYEIK--FGTTDLSSPYRAINAFAIDKYH---------TTYLSNQIKNIKD 51
           + PI +DNGS  IK  FG  D    Y   +   I KY           T++ NQ + I+ 
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEH-SLVGIPKYSKVMAGRFDGNTFVGNQAQEIRG 68

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPEL 111
           +  +  R P E G +T W     +W +         G  L+ L+   ++ +E  +   + 
Sbjct: 69  L--LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKN 121

Query: 112 SKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYND 171
            + M +++FE +   + Y S  A    +A  + T                          
Sbjct: 122 REQMCELLFETFSVPAVYVSIQAVLSLYASGRTTGC------------------------ 157

Query: 172 YQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVN 231
              V+DSG  C+  +PV  G     A++++DI GR +  LL + L  +   V   ++L +
Sbjct: 158 ---VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELL-QVLIRKSTGV---SLLSS 210

Query: 232 NIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDE 291
           + +E    +   + + +   K E    Y +   QT F          LP+  Q I+L +E
Sbjct: 211 SEREIVRIIKEKACYIALDPKEEEK-NYTMHGKQTMFR---------LPDGKQ-IELDNE 259

Query: 292 LFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRL 351
            F  PE  F+P++       L E + ES+  V   LR  L  N+V +GG   +P F  R+
Sbjct: 260 KFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRV 319

Query: 352 TSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
             EL+         +   P  E +   W   +  +   +++K  VT++E+ E+
Sbjct: 320 LKELKLSCEPQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN 371

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 101/413 (24%), Positives = 167/413 (40%), Gaps = 68/413 (16%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDITS 54
           PI +DNGS  IK G +    P    Y  I     +K         T++ NQ + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +  R P E G + +W     IW Y +FN        L +++   ++ +E  +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSY-VFNKS----LQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           M +++FE +   + Y S  A    +A  + T                             
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYASGRTTGC--------------------------- 154

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILV 230
           V+D G  C   +PV  G     +++++DI GR    FL  LL++T         +  + V
Sbjct: 155 VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-V 213

Query: 231 NNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYD 290
             IKE   +V+   + +    +N +    + PN+ T F          LP+  +TI L  
Sbjct: 214 RIIKEKACYVAKDPHIE---EQNFS----INPNY-TKF---------KLPDG-KTIDLGQ 255

Query: 291 ELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATR 350
           E F  PE  F PE+       L +   +S+  V   LR LL  N++ +GG   LP F  R
Sbjct: 256 EKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDR 315

Query: 351 LTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYE 403
           L SEL+    +    +   P  E +   W   +  +   +++K  VTR E+ E
Sbjct: 316 LLSELKSLSDSQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTRAEWEE 367

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/439 (22%), Positives = 175/439 (39%), Gaps = 87/439 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAIDK----------YHTTYLSNQIKNIK 50
           SPI +D G+  +K G    + P   + +I    I +               + ++  +++
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA FN        LN+  G  ++ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+    +  T VE Y LP                   + +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRT 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQ-----RQLPTD------WICRTSVPTKECEL--FGWKAMAQFASTESYR 392
              +RL  EL+     R L  D      +  R   P +   +   G   +A   + + + 
Sbjct: 311 GLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDH- 369

Query: 393 KTRVTREEYYEHGTDWLTK 411
              ++++E+YE G   + K
Sbjct: 370 -MWLSKQEWYEGGAAAMAK 387

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 105/435 (24%), Positives = 180/435 (41%), Gaps = 79/435 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAIDKYH-TTYLSNQIKNI------KDIT 53
           SPI +D G+  +K G    + P   + +I    I +      +S  +K+I       D+ 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVR 64

Query: 54  S-VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
           S +    P E G + +W+    +WDYA +N  +FP        G  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFP-----STSGGKILLTEPPMNPLKNR 119

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           + M +V+FE+Y+F   Y +  A    +A   ++ +                         
Sbjct: 120 ELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV------------------------- 154

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL--V 230
             V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y          V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 231 NNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYD 290
             IKE   +VS     D+ K   ET V  ++ N++             LP+  + IK+  
Sbjct: 213 RQIKEKLSYVSYDLNLDT-KLARETTV--LVENYE-------------LPDG-RVIKVGQ 255

Query: 291 ELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATR 350
           E F  PE  F P++  + +PG+ E +  ++      +R  L   +V +GG+   P   +R
Sbjct: 256 ERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSR 315

Query: 351 LTSELQRQLPTDWICRTSV-------------PTKECELF-GWKAMAQFASTESYRKTRV 396
           L  EL +QL    I R                P ++  +F G   +A   + + +    +
Sbjct: 316 LEKEL-KQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVLASIMAEKDH--MWL 372

Query: 397 TREEYYEHGTDWLTK 411
           T+EE++E G   + K
Sbjct: 373 TKEEWHESGPAAMAK 387

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 94/414 (22%), Positives = 162/414 (39%), Gaps = 70/414 (16%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDITS 54
           P+ +DNGS  IK G +    P    Y  I     +K         T++ NQ + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +  R P + G +T+W     +W Y +FN        L +++    + +E  +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGY-VFNKS----LQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           M +++FE +   + Y S  A    +A  + T                             
Sbjct: 150 MCELLFESFNVPALYVSVQAVLSLYASGRTTGC--------------------------- 182

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILV 230
           V+D G  C   +PV  G     +++++DI GR    FL  LL++T         +  I V
Sbjct: 183 VVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-V 241

Query: 231 NNIKENCLFVSPTSYFDSFK-NKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLY 289
             IKE   FV+     +      N +  ++ LP+                    +TI+L 
Sbjct: 242 RTIKEKACFVTKDPKLEEQNFPMNPSFSKFKLPD-------------------GKTIELG 282

Query: 290 DELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFAT 349
            E +  PE  F PE+       L +   +S+  V   LR LL  N++ +GG   LP F  
Sbjct: 283 QERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGD 342

Query: 350 RLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYE 403
           RL  EL+    +    +   P  E +   W   +  +   +++K  VT+ E+ E
Sbjct: 343 RLLKELKSLSGSRTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTKSEWEE 395

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 95/428 (22%), Positives = 170/428 (39%), Gaps = 92/428 (21%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSP------------YRAINAFAIDKYHTTYLSNQIKNIK 50
           + PI +DNGS  IK G +    P            Y  + A  ++     ++ NQ + ++
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQ--FIGNQAQELR 66

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
            +  +  R P E G + +W     IW++            LN+++   ++A+E  +   +
Sbjct: 67  GL--LKLRYPLEHGIVKNWSDMELIWNHVFHK-----SLQLNNIEEHPVLATEAPLNPLK 119

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +++FE +   + Y S  A    +A  + T                         
Sbjct: 120 NREAMCEMLFETFNVPAVYVSIQAVLSLYASGRTTGC----------------------- 156

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDE 226
               V+D G  C   +PV  G     +++++D+ GR    FL  LL++T         + 
Sbjct: 157 ----VLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSER 212

Query: 227 TILVNNIKENCLFVS--PTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            I V  IKE   +V+  P +   ++ +   T+  + LP+      G V D          
Sbjct: 213 EI-VRIIKEKACYVARDPLTEEQTY-HLTPTSTIFKLPD------GKVLD---------- 254

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
              L +E F  PE  F P++       + E   +S+S V   LRP L+ N+V +GG    
Sbjct: 255 ---LKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMF 311

Query: 345 PHFATRLTSELQRQLPTDWICRTSVPTKECELFG--------WKAMAQFASTESYRKTRV 396
           P F  RL +EL+           S P  + ++F         W   +  +   +++K  V
Sbjct: 312 PGFGDRLLTELR---------NLSEPQTKIKIFAPPERKYSTWIGGSILSGLSTFKKIWV 362

Query: 397 TREEYYEH 404
           T+ E+ E+
Sbjct: 363 TKSEWQEN 370

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 91/421 (21%), Positives = 162/421 (38%), Gaps = 75/421 (17%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSPYR-AINAFAIDKYHTTYLSNQIKNIKDITSV------ 55
           + P+ +DNGS  IK G +  + P     N     KY    L+N I N  D+T +      
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISN-NDLTYIGNRAQK 66

Query: 56  -----TFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
                  R P   G + +W+   ++W +  FN        +ND     L+ +E  +   +
Sbjct: 67  SRGLLRLRHPMNRGIVENWDDMETLWSHT-FNDI----LKINDFDEHPLLITEAPLNPEK 121

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
               M +V FE+++F + Y ++ +    +A  + T                         
Sbjct: 122 NRDKMCEVFFEKFDFAAVYIANPSTLSLYASGRTTGC----------------------- 158

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD----- 225
               V+D G      +P+ +G     +++++D+GGR +   L+     R Y  +      
Sbjct: 159 ----VLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYSSS 212

Query: 226 ETILVNNIKENCLFVSPTSYFD---SFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPEN 282
           E  +V N+KE   +VS     D   S  N  +   ++ LP+ +   L   R         
Sbjct: 213 EHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPDGKDLILDKAR--------- 263

Query: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342
                     F  PE  F P+I  +    + +   ES+S V   LRP L  +++  GG+ 
Sbjct: 264 ----------FRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGST 313

Query: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402
               F  RL  ELQ +     + +   P  E +   W   +      ++++  +T+ E+ 
Sbjct: 314 MFRGFGDRLLKELQIRTGNKNLIKIIAPP-ERKYTSWIGGSILTGLSTFKQLWMTKAEWQ 372

Query: 403 E 403
           E
Sbjct: 373 E 373

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 143/371 (38%), Gaps = 70/371 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP------------YRAINAFAIDK-YHTTYLSNQIKNIK 50
           SPI +D G+  +K G    + P             RA     I        + ++   ++
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA FN  + P        G  ++ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFNQMKLP-----TTSGGKVLLTEPPMNPVK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL- 229
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y         
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFE 210

Query: 230 -VNNIKENCLFVSPTSYFDSFKNKNETAV--EYVLPNFQTTFLGHVRDKTKPLPENTQTI 286
            V  IKE   +VS     D+   +  T +  EY LP                   + + I
Sbjct: 211 TVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELP-------------------DGRII 251

Query: 287 KLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPH 346
           K+  E F  PE  F P++  +  PG+ E +  ++      +R  L   +V +GG+   P 
Sbjct: 252 KVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311

Query: 347 FATRLTSELQR 357
             +RL  EL++
Sbjct: 312 LPSRLERELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 147/381 (38%), Gaps = 72/381 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAIDKYHTTYLSNQIKNIKDI-------- 52
           SPI +D G+  +K G    + P   + +I    I +       +    IKDI        
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASD 64

Query: 53  --TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
             + +    P E G +  W     +WD+A F   + P        G  ++ +E  M   +
Sbjct: 65  VRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLP-----STSGGKILLTEPPMNPLK 119

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M QV+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 156

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL- 229
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y         
Sbjct: 157 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 212

Query: 230 -VNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTI 286
            V  IKE   +VS    FD+    +  T VE Y LP                   + + I
Sbjct: 213 TVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELP-------------------DGRII 253

Query: 287 KLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPH 346
           K+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P 
Sbjct: 254 KVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPG 313

Query: 347 FATRLTSELQRQLPTDWICRT 367
             +RL  EL +QL   W  R 
Sbjct: 314 LPSRLEKEL-KQL---WFTRV 330

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 146/371 (39%), Gaps = 70/371 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP------------YRAINAFAIDK-YHTTYLSNQIKNIK 50
           +PI +D G+  +K G    + P             RA     I+K      + ++  +++
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA FN  + P        G  ++ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFNQMQLP-----TTSGGKILLTEPPMNPVK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL- 229
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y         
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 230 -VNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTI 286
            V  IKE   +VS     D+    +  T VE Y LP                   + + I
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRII 251

Query: 287 KLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPH 346
           K+  E F  PE  F P +  + + G+ E +  ++      +R  L   +V +GG+   P 
Sbjct: 252 KVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPG 311

Query: 347 FATRLTSELQR 357
             +RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 91/370 (24%), Positives = 147/370 (39%), Gaps = 68/370 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP-YRAINAFAIDKYHTTYLSNQIKNIKDI---------- 52
           SPI +D G+  +K G    + P Y   +            +N    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
           + +    P E G + +W     +WDYA F   + P        GK L+ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP----TTSNGKILL-TEPPMNPTKNR 119

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           + M +V+FE+Y+F   Y +  A    +A   ++ +                         
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV------------------------- 154

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI---L 229
             V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T     
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADFET 211

Query: 230 VNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIK 287
           V  IKE   +VS     D+    +  T VE Y LP                   + +TIK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIK 252

Query: 288 LYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHF 347
           +  E F  PE  F P +  + +PG+ E + +++      +R  L   +V +GG+   P  
Sbjct: 253 VGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGL 312

Query: 348 ATRLTSELQR 357
            +RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 89/379 (23%), Positives = 146/379 (38%), Gaps = 70/379 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP-YRAINAFAIDKYHTTYLSNQIKNIKDI---------- 52
           +PI +D G+  +K G    + P Y   +            +N +  +KDI          
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVR 64

Query: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
           + +    P E G + +W     +WDYA ++  + P        G  ++ +E  M      
Sbjct: 65  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLP-----STSGGKVMLTEPPMNPLRNR 119

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           + M +V+FE+Y+F   Y +  A    +A   ++ +                         
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV------------------------- 154

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL--V 230
             V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y          V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 231 NNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
             IKE   +VS     D+    +  T VE Y LP                   + + IK+
Sbjct: 213 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKV 253

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
             E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P   
Sbjct: 254 GSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313

Query: 349 TRLTSELQRQLPTDWICRT 367
           +RL  EL +QL   W  R 
Sbjct: 314 SRLEKEL-KQL---WFTRV 328

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 91/382 (23%), Positives = 151/382 (39%), Gaps = 76/382 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP--------YRAI-----NAFAIDKYHTTYLSNQIKNIK 50
           +PI +D G+  +K G    + P         R I      A          + ++  +++
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA F   + P        GK L+ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFEQMKLPSTS----NGKILL-TEPPMNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDSFKNKNETAV--EYVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+   +  TA+   Y LP                   + +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP-------------------DGRT 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQRQLPTDWICRT 367
              +RL  EL +QL   W  R 
Sbjct: 311 GLPSRLEKEL-KQL---WFSRV 328

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 83/421 (19%), Positives = 166/421 (39%), Gaps = 78/421 (18%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKY------HTTYLSNQIKNIKDI 52
           + P+ IDNG+  +K G      P    +  +     DK          Y+ N+ +  + +
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL 67

Query: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
             +  R P E G++  W+   ++W + L +       ++  ++   ++ +E  +   +  
Sbjct: 68  --LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNR 120

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           ++M +++FE +   + +  + A    ++  + T                           
Sbjct: 121 EHMCEILFESFNIPAIHVENPAVLALYSGGRTTG-------------------------- 154

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVM-------D 225
             VID G      +P+ +G     +++++DIGGR     + E L F+    +       +
Sbjct: 155 -CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGRE----ITEQLQFQIRKSVGMSLFSSN 209

Query: 226 ETILVNNIKENCLFVSPTSYFDSFK---NKNETAVEYVLPNFQTTFLGHVRDKTKPLPEN 282
           E  +V  IKE   +V+     +  K   +    + ++ LP+ ++  +G+VR         
Sbjct: 210 EKEIVRTIKERACYVADDISKEEHKYILDSESNSSKFKLPDGKSLSIGNVR--------- 260

Query: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342
                     F   E  F+P +       + E + ++LS V   LRP+L  +LV  GG  
Sbjct: 261 ----------FRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTT 310

Query: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402
            LP F  R+  ELQ     D   R  + + E +   W   +  A   +++K  VT+  + 
Sbjct: 311 VLPGFGNRILKELQILTKQDTKLRI-IASPERKYTTWIGGSILAGLSTFQKILVTKSNWN 369

Query: 403 E 403
           E
Sbjct: 370 E 370

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 150/372 (40%), Gaps = 72/372 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAI----DKYHTT------YLSNQIKNIK 50
           +PI +D G+  +K G    + P   + +I    I    ++ H +       + ++   ++
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA F   + P        G  ++ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIRNWADMELLWDYAFFEQMKLP-----TTSGGKVLLTEPPMNPIK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+    +  T VE Y LP                   + + 
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRV 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQR 357
              +RL  EL++
Sbjct: 311 GLPSRLEKELKQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 144/371 (38%), Gaps = 70/371 (18%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP------------YRAINAFAID-KYHTTYLSNQIKNIK 50
           +PI +D G+  +K G    + P             RA    +I        + ++  +++
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA +   + P        G  ++ +E  M    
Sbjct: 65  SYLQISY--PMENGIIKNWADMELLWDYAFYEQMKLP-----STSGGKVLLTEPPMNPLR 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL- 229
               V+DSG   T I+PV + V      K+LD+ GR +   L + LS R Y         
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 230 -VNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTI 286
            V  IKE   +VS     D+    +  T VE Y LP                   + + I
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVI 251

Query: 287 KLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPH 346
           K+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P 
Sbjct: 252 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPG 311

Query: 347 FATRLTSELQR 357
             +RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 91/382 (23%), Positives = 151/382 (39%), Gaps = 76/382 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP--------YRAI-----NAFAIDKYHTTYLSNQIKNIK 50
           +PI +D G+  +K G    + P         R I      A          + ++   ++
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA F   + P    +   GK L+ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFEQMKLP----STSNGKILL-TEPPMNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDSFKNKNETAV--EYVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+   +  TA+   Y LP                   + +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP-------------------DGRT 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQRQLPTDWICRT 367
              +RL  EL +QL   W  R 
Sbjct: 311 GLPSRLEKEL-KQL---WFSRV 328

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 124/312 (39%), Gaps = 59/312 (18%)

Query: 60  PHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVV 119
           P E G + +W     +WDYA ++  + P        G  ++ +E  M   +  + M +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFYDQMQLP-----STSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179
           FE+Y+F   Y +  A    +A   ++ +                           V+DSG
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQGLSSGV---------------------------VVDSG 105

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL--VNNIKENC 237
              T I+PV + V      ++LD+ GR +   L + LS R Y          V  IKE  
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 165

Query: 238 LFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSV 295
            +VS     D+    +  T VE Y LP                   + + IK+  E F  
Sbjct: 166 SYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKVGSERFEA 206

Query: 296 PETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSEL 355
           PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P   +RL  EL
Sbjct: 207 PECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 266

Query: 356 QRQLPTDWICRT 367
            +QL   W  R 
Sbjct: 267 -KQL---WFTRV 274

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 148/373 (39%), Gaps = 74/373 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP--------YRAI-----NAFAIDKYHTTYLSNQIKNIK 50
           +PI +D G+  +K G    + P         R I      A          + ++  +++
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA F   + P        GK L+ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFEQMKLPSTS----NGKILL-TEPPMNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDSFKNKNETAV---EYVLPNFQTTFLGHVRDKTKPLPENTQ 284
             V  IKE   +VS     D+ K   ET V    Y LP                   + +
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDT-KLARETTVLVESYELP-------------------DGR 249

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNL 344
           TIK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   
Sbjct: 250 TIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMY 309

Query: 345 PHFATRLTSELQR 357
           P   +RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 89/382 (23%), Positives = 148/382 (38%), Gaps = 76/382 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP--------YRAI-----NAFAIDKYHTTYLSNQIKNIK 50
           +PI +D G+  +K G    + P         R I      A          + ++  +++
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA F         L       ++ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFEQ-----MKLQSTSNGKILLTEPPMNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+    +  T VE Y LP                   + +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRT 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQRQLPTDWICRT 367
              +RL  EL +QL   W  R 
Sbjct: 311 GLPSRLEKEL-KQL---WFSRV 328

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 136/336 (40%), Gaps = 74/336 (22%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT----------TYLSNQIKNIKD 51
           E + + IDNGS   K G     +P     +      H           +Y+ ++ ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFN-----PDEFPGFDLNDLKGKHLIASETCM 106
           I  +T R P E G +T+W+    IW +  +N     P+E P           ++ +E  M
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP-----------VLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVRE 166
                 + M Q++FE +   ++Y S  A    ++  + T I                   
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGI------------------- 151

Query: 167 KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHY--DVM 224
                   V+DSG   T ++P+  G      + ++D+ GR L   L + LS R Y     
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQ 284
            E  +V +IKE   +V+       F+ + +TA        Q++ +    +K+  LP+  Q
Sbjct: 204 AEREIVRDIKEKLCYVAL-----DFEQEMQTAA-------QSSSI----EKSYELPDG-Q 246

Query: 285 TIKLYDELFSVPETFFHPEIARILKPGLVETILESL 320
            I + +E F  PE  FHP +  +   G+ +T   S+
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 84/369 (22%), Positives = 151/369 (40%), Gaps = 68/369 (18%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP---YRAINAFAIDK----------YHTTYLSNQIKNIKD 51
           PI +D G+  +K G    + P   + +I    I +               + ++  N++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 52  ITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPEL 111
              +++  P E G + +W     +WDYA ++  + P        G  ++ +E  M   + 
Sbjct: 66  YLQISY--PMENGIIKNWADMEQLWDYAFYDQMKIP-----STAGHKVLLTEPPMNPLKN 118

Query: 112 SKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYND 171
            + M +V+FE+Y+F   Y +  A    +A   ++ +                        
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV------------------------ 154

Query: 172 YQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI--- 228
              V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   ++T    
Sbjct: 155 ---VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGY-AFNKTADFE 210

Query: 229 LVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
            V  IKE   +VS     D+ K  +ET          TT +     +T  LP+  + IK+
Sbjct: 211 TVRQIKEKLCYVSYDLDLDT-KLAHET----------TTLV-----ETYELPDG-RVIKV 253

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
             E F  PE  F P +  + + G+ E +  ++      +   L   +V +GG+   P   
Sbjct: 254 GSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLP 313

Query: 349 TRLTSELQR 357
           +RL  EL++
Sbjct: 314 SRLEKELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 87/369 (23%), Positives = 145/369 (39%), Gaps = 66/369 (17%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSPYRAINAFA----IDKYHTTYLSNQIKNI------KDIT 53
           +PI +D G+  +K G    + P     +      +       +S  +K+I       D+ 
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVR 64

Query: 54  S-VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
           S +    P E G + +W     +WDYA F+  + P        GK L+ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLP----TTSNGKILL-TEPPMNPVKNR 119

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           + M +V+FE+Y+F   Y +  A    +A   ++ +                         
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV------------------------- 154

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL--V 230
             V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y          V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 231 NNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
             IKE   +VS     D+    +  T VE Y LP                   + + IK+
Sbjct: 213 RQIKEKVCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKV 253

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
             E F  PE  F P +  + + G+ E +  ++      +R  L   +V +GG+   P   
Sbjct: 254 GQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLP 313

Query: 349 TRLTSELQR 357
           +RL  EL++
Sbjct: 314 SRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/369 (23%), Positives = 140/369 (37%), Gaps = 68/369 (18%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP-YRAINAFAIDKYHTTYLSNQIKNIKDI----------T 53
           PI +D G+  +K G    + P Y   +            +N    +KDI          +
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 54  SVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSK 113
            +    P E G +  W     +WDYA +   + P        G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFYEQMKLP-----STSGGKVLLTEPPMNPLRNRE 120

Query: 114 NMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ 173
            M +V+FE+Y+F   Y    A    +A   ++ +                          
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGV-------------------------- 154

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI---LV 230
            V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   ++T     V
Sbjct: 155 -VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGY-AFNKTADFETV 212

Query: 231 NNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
             IKE   +VS     D+    +  T VE Y LP                   + + IK+
Sbjct: 213 RQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELP-------------------DGRVIKV 253

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
             E F  PE  F P +  + +PG+ E +  ++      +   L   +V +GG+   P   
Sbjct: 254 GSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLP 313

Query: 349 TRLTSELQR 357
           +RL  EL++
Sbjct: 314 SRLEKELKQ 322

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 82/372 (22%), Positives = 144/372 (38%), Gaps = 72/372 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP------------YRAINAFAIDK-YHTTYLSNQIKNIK 50
           SPI +D G+  +K G    + P             RA    +I        + ++   ++
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA +   + P        G  ++ +E  M   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFYEQMKLP-----STSGGKVLLTEPPMNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               V+DSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDSFKNKNETAV--EYVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+   +  T +  +Y LP                   + + 
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELP-------------------DGRI 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F  PE  F P +  +   G+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQR 357
              +RL  EL++
Sbjct: 311 GLPSRLEKELKQ 322

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 120/303 (39%), Gaps = 57/303 (18%)

Query: 60  PHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVV 119
           P E G + +W     +WDYA +   + P     D     ++ +E  M   +  + M +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFYEQMKLP-----DTSNGKILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179
           FE+Y F   Y +  A    +A   ++ +                           V+DSG
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQGLSSGV---------------------------VVDSG 105

Query: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI---LVNNIKEN 236
              T I+PV + V      ++LD+ GR +   L + LS R Y   + T     V  IKE 
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGY-AFNRTADFETVRQIKEK 164

Query: 237 CLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFS 294
             +VS     D+    +  T VE Y LP                   + + IK+  E F 
Sbjct: 165 LCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRVIKVGSERFE 205

Query: 295 VPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSE 354
            PE  F P +  + + G+ E +  ++      +R  L   +V +GG+   P   +RL  E
Sbjct: 206 APECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSRLEKE 265

Query: 355 LQR 357
           L++
Sbjct: 266 LKQ 268

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 93/415 (22%), Positives = 158/415 (38%), Gaps = 67/415 (16%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT---------TYLSNQIKNIKDIT 53
           S P+ +DNGS  +K G +    P    ++      H          T++ N  +  + I 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI- 68

Query: 54  SVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSK 113
            +  R P + G + +W     IWDY   +        L D+    ++ +E  +       
Sbjct: 69  -LQLRHPVDHGVVKNWNDMELIWDYMFKDK-----LKLKDVDEHPVLITEAPLNPVSNRD 122

Query: 114 NMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ 173
            M  ++FE +   + Y ++ A    +A  K    ISG                       
Sbjct: 123 EMCDLLFESFGVQALYVANPAVLSLYASGK----ISG----------------------- 155

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD-----ETI 228
            V+D G   +  +PV +G     A+K++D+GGR L   L+  L  R    +      E  
Sbjct: 156 CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQLRKSTGLSLTTSGEME 213

Query: 229 LVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
           LV  IKE   +V               AV+  +   +  + G        LP+  + I L
Sbjct: 214 LVRMIKEKSCYV---------------AVDLDIEEEKCNYEGDQVGLKFKLPDG-KFITL 257

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
             + F VPE  F P +       + E I +S+S +   LRP +  +++ +GG   L  F 
Sbjct: 258 SKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFG 317

Query: 349 TRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYE 403
            RL  EL +        +   P  E +   W   +  A   +++K  VT+ ++ E
Sbjct: 318 NRLVQELDKLNQAQSRVKIWAPP-ERKYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 93/423 (21%), Positives = 161/423 (38%), Gaps = 82/423 (19%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHTTYLS-------NQIKNIKDIT 53
           P+ +DNGS  IK G +    P    Y  I     +K     L+       N+ + ++ + 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRGLL 70

Query: 54  SVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSK 113
            + +  P E G +  W     +W +  +N        L +++   ++ +E  +   +   
Sbjct: 71  KLHY--PLEHGVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLNPMKNRN 123

Query: 114 NMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ 173
            M +++FE +   + Y S  A    +A  + T                            
Sbjct: 124 KMCEMLFETFGSPAVYVSIQAVLALYAGGRTTGC-------------------------- 157

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETIL 229
            VID G  C   +PV  G     A++++D+ GR    FL  LL+++         +  I 
Sbjct: 158 -VIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI- 215

Query: 230 VNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLY 289
           V  IKE   FV+             T V     N++      +  + K LP+  + + L 
Sbjct: 216 VRMIKEKACFVA-------------TDVGNEEQNYEGANSAELETRFK-LPDG-KILTLG 260

Query: 290 DELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFAT 349
            E F  PE  F P +       + E   +S+S V   LR  L  ++V +GG+     F  
Sbjct: 261 AEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGD 320

Query: 350 RLTSELQRQLPTDWICRTSVPTKECELFG--------WKAMAQFASTESYRKTRVTREEY 401
           RL SE++         +TS P  + ++F         W   +  A   ++ K  VTR E+
Sbjct: 321 RLLSEIR---------KTSEPNTKIKIFAPPERKYSTWIGGSILAGLSTFEKLWVTRAEW 371

Query: 402 YEH 404
            E+
Sbjct: 372 QEN 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 91/415 (21%), Positives = 151/415 (36%), Gaps = 68/415 (16%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDITS 54
           P+ IDNGS  +K G      P    Y  I     +K         +++ N+ + ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +  + P E G ++ W+    +W + LF+        L       L+ +E  +      + 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILFD-----SLQLTSGMEHPLLITEAPLNPESNKEK 123

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           M +V FE +   +    SI G +           SG+T                      
Sbjct: 124 MLEVFFETFNIPAIC-VSIPGVLSL-------YASGRTT-------------------GC 156

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVM-----DETIL 229
           V+D G      +PV +G     ++K++++GG  +D   +     R    +      E  L
Sbjct: 157 VVDCGEGYCSSVPVCEGYTLASSIKRINLGG--IDVTKQLQFQLRKESGVWLFSSGEREL 214

Query: 230 VNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLY 289
           V  +KE   +VS          K+E    +      T F          LP+    + L 
Sbjct: 215 VRTMKEKSCYVSLNQL------KDEEKFTFEPGKMNTNF---------KLPDGNM-LTLS 258

Query: 290 DELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFAT 349
              F  PE  F P+I    +P L E  L+S+  V   LRP L+  +  +GG      F  
Sbjct: 259 KSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGD 318

Query: 350 RLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
           R   ELQ         R   P  E +   W   +  A   ++RK   T+ ++ EH
Sbjct: 319 RFLQELQISTCKKSNIRILAP-PERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 93/413 (22%), Positives = 160/413 (38%), Gaps = 62/413 (15%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHTTYLSNQIKNI-----KDITSV 55
           P+ +DNGS  IK G +    P    Y  I     DK     LS++ + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNM 115
             + P E G +  W     +W +  ++        LN++    ++ +E  +   E    M
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYS-----SLKLNNIGDHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLV 175
            ++++E +   + Y S  A    +A  + T                             V
Sbjct: 126 CEMLYETFNVPAVYVSIQAVLALYAGGRTTGC---------------------------V 158

Query: 176 IDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILVN 231
           ID G  C   +PV  G     A++++D+ GR    FL  LL++++        +  I V 
Sbjct: 159 IDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VR 217

Query: 232 NIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDE 291
            IKE   +V+P    +  K  +    E +     T F          LP+  + + L  E
Sbjct: 218 MIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKF---------KLPDG-KILSLGAE 262

Query: 292 LFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRL 351
            F  PE  F P++       + +   +S+S V   LR  L  +LV +GG+     F  RL
Sbjct: 263 KFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDRL 322

Query: 352 TSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEH 404
            +EL+ +   +   +   P  E +   W   +  A   ++ K  VTR E+ E+
Sbjct: 323 LNELRSRCEPNVKIKIFAPP-ERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN 374

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 83/418 (19%), Positives = 162/418 (38%), Gaps = 70/418 (16%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSPYR-AINAFAIDKYHTTYLSNQIKNIKDITS------- 54
           + PI IDNGS  IK G +    P     N   + KY    ++ Q++N+            
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIR 68

Query: 55  --VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
             +  + P   G + +W+    +W + +FN       ++ +++   L+ +E  +T+ +  
Sbjct: 69  GLLRLQHPMNRGVVDNWDDMELLW-WHIFNDT----LNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
             M + +FE +   S Y ++ +    +A    T                           
Sbjct: 124 HIMCERLFETFNIPSLYVANPSVLSLYASGNTTGC------------------------- 158

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETI 228
             V+D G       P+ +G     +++K+++GGR     L   ++++     Y   +E  
Sbjct: 159 --VVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKE 215

Query: 229 LVNNIKENCLFVSP---TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQT 285
           +V  IKE   ++S     S    +  ++E + ++ LP                   + + 
Sbjct: 216 IVRTIKEKVCYISEDFNKSEESYYLRQDEMSCKFKLP-------------------DGKE 256

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           + L  E F  PE  F+P++  +    +     ES+S V   LRP L  N++ TGG+    
Sbjct: 257 LTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFK 316

Query: 346 HFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYE 403
            F +RL  +LQ         +   P  E +   W   +      +++   VT+ ++ E
Sbjct: 317 GFGSRLLGDLQELTNNRAKIKILAPP-ERKYTSWIGGSILTGLSTFKNLWVTKSDWEE 373

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 85/429 (19%), Positives = 170/429 (39%), Gaps = 74/429 (17%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDI 52
           + PI +DNGS  +K G      P    Y  I     DK          ++ N  +  + +
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL 70

Query: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
             +  R P + G + +WE   ++WD+   +        +++L    L+ +E  +      
Sbjct: 71  --LKLRYPMDHGIIENWEHMETVWDHIFKD-----CLKVSNLGEHPLVVTEAPLNPKPNR 123

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           + M + +FE +   + Y ++ A    +A  + T                           
Sbjct: 124 EKMCETLFESFNIPALYIANPAVLSLYASGRTTGC------------------------- 158

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETI 228
             V+++G      +P+ +G     +++++DIGGR     L   L+++     Y   ++ I
Sbjct: 159 --VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSSEQEI 216

Query: 229 LVNNIKENCLFVSPTSYFDSFK---NKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQT 285
            V  IKEN  ++      +  K   ++ + ++ + LP+ +   +G  R            
Sbjct: 217 -VRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGPGR------------ 263

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
                  F  PE  F+P +       L + I++S+S V   LR  L+ N+  +GG+    
Sbjct: 264 -------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQ 316

Query: 346 HFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHG 405
            F  RL +EL   +      R   P  E +   +   +  A+  ++R   VT++++   G
Sbjct: 317 GFCDRLITELDFSVDKTTKVRILAPP-ERKYSAFIGGSILANLSTFRNMWVTKDQW--EG 373

Query: 406 TDWLTKNRF 414
            + + +N+F
Sbjct: 374 DNRIIENKF 382

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 143/372 (38%), Gaps = 72/372 (19%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAIDKYHT----------TYLSNQIKNIK 50
           SPI +D G+  +K G    + P   + +I    I +               +  +   ++
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64

Query: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
               +++  P E G + +W     +WDYA +   + P        G  ++ +E  +   +
Sbjct: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFYEQMKLP-----STSGGKVLLTEPPLNPLK 117

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228
               VIDSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 155 ----VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209

Query: 229 -LVNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQT 285
             V  IKE   +VS     D+    +  T VE Y LP                   + + 
Sbjct: 210 ETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELP-------------------DGRV 250

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           IK+  E F   E  F P +  +   G+ E +  ++      +R  L   +V +GG+   P
Sbjct: 251 IKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310

Query: 346 HFATRLTSELQR 357
              +R+  EL++
Sbjct: 311 GLPSRIEKELKQ 322

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 88/385 (22%), Positives = 147/385 (38%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        + +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 161

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K++      D SL  
Sbjct: 162 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------DRSLTG 215

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 216 T-------------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRE-- 260

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                +V         IK+   +V P     F+ F    E   +YV+ N         +D
Sbjct: 261 ---RGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVEN---------QD 308

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 309 KTR-----QKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVLDQTIQACPIDVRKGLY 362

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ----------------RQLPTDWICRTSVPTKECEL 376
            N+V +GG+     F  RL  +L+                R    D    +    +    
Sbjct: 363 NNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVW 422

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ    + Y  T+   EEY
Sbjct: 423 FGGSLLAQTPEFKGYCHTKKDYEEY 447

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 87/382 (22%), Positives = 149/382 (39%), Gaps = 63/382 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 100 YIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 153

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K++      D SL  
Sbjct: 154 LTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------DRSLTG 207

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                         VIDSG   T +IPV +G     A+K + I GR +   ++  L  R 
Sbjct: 208 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RE 252

Query: 221 YDVMDETI-LVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK 277
               D ++     IK+   +V P     F+ F    E   +YV+ N         ++KT+
Sbjct: 253 RGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVEN---------QEKTQ 303

Query: 278 PLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLVGNL 335
                 + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L  N+
Sbjct: 304 -----KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNI 357

Query: 336 VCTGGNFNLPHFATRLTSELQ----------------RQLPTDWICRTSVPTKECELFGW 379
           V +GG+     F  RL  +L+                +    D    +    +    FG 
Sbjct: 358 VLSGGSTMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGG 417

Query: 380 KAMAQFASTESYRKTRVTREEY 401
             +AQ A  +SY  T+   EEY
Sbjct: 418 SLLAQTAEFKSYCHTKKDYEEY 439

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 93/418 (22%), Positives = 157/418 (37%), Gaps = 75/418 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHTT-------YLSNQIKNIKDIT 53
           PI IDNG+  IK G T  + P    Y  +     DK   +       ++ N+ +  + I 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 54  SVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSK 113
            +  R P   G + +W+   +IW Y +F+   +    L +L    ++ +E  +      +
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQY-VFDDTLY----LENLNEHPILITEPPLNNMANRQ 126

Query: 114 NMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ 173
            M + +FE + F + Y S       +A  + T                            
Sbjct: 127 KMCEALFEIFGFPAVYISVSPVLSLYASGQTTG--------------------------- 159

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGG-----RFLDGLLKETLSFRHYDVMDETI 228
             +D G      IPV  G     +VKK+DIGG     +    +LK T  F +     E  
Sbjct: 160 CAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SERE 217

Query: 229 LVNNIKENCLFVSPTSYFDSFK---NKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQT 285
           +V  IKE   +++     ++ K   N+ + A ++ LP+                    + 
Sbjct: 218 IVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD-------------------GKM 258

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345
           + +    ++  E  F PE+       L E   +S+  V   LR  L  N+V +GG    P
Sbjct: 259 LNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCP 318

Query: 346 HFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYE 403
            F +RL  ELQ     D   R   P  E +   W   +  +   ++ K  VT+  + E
Sbjct: 319 GFGSRLLKELQTLTGYDTKIRIIAP-PERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 149/368 (40%), Gaps = 69/368 (18%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDITS 54
           PI IDNGS  IK G +    P    Y  +     DK         T++ N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           + +  P E G +  W+    IW + L   +E     L +++   L+ +E  M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHIL---NEV--LQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           M QV+FE +   + Y S+ A    +A  + T                             
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYASGRTTGC--------------------------- 159

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILV 230
           VID G      +P+  G     ++ ++DIGGR     L   L+++     +   +  I V
Sbjct: 160 VIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-V 218

Query: 231 NNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK--PLPENTQTIKL 288
             IKE   +++     D  K +N             T++   +D T    LP+  + I++
Sbjct: 219 RTIKEKVCYLAT----DIKKEEN-------------TYMQESQDLTSVFKLPDG-KCIEI 260

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
            ++ +  PE  F P+I      GL +  ++S+  V   LR  L+ +++ +GG   L  F 
Sbjct: 261 GNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFG 320

Query: 349 TRLTSELQ 356
            R+  +L+
Sbjct: 321 DRMLHDLE 328

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/385 (23%), Positives = 151/385 (39%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 107 YIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRAEPEDHFFL 160

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++++       D SL  
Sbjct: 161 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVT------DRSLTG 214

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 215 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 260

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F  + E   ++++ N         +D
Sbjct: 261 --GEADTSLRT--AERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QD 307

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KTK      + + +  E F  PE FF+PEIA    L P L   +  ++   P  +R  L 
Sbjct: 308 KTK-----QKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLY 361

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSV----------------PTKECEL 376
            N+V +GG+     F+ RL  +++  + +  I   +V                  +    
Sbjct: 362 NNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVW 421

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ A  +SY  T+   EEY
Sbjct: 422 FGGSLLAQTAEFKSYCHTKKDYEEY 446

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 72/152 (47%), Gaps = 15/152 (9%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELL 327
           P P +++ +       L  E   VPE  F P IA   + G+ E     +L+     P  L
Sbjct: 594 PRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNL 653

Query: 328 RPL---LVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
                 +V N+  TGGN  +P    R+  E    LP        + +++  L  WK MA+
Sbjct: 654 SAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHM-SEDPSLDAWKGMAK 712

Query: 385 FASTES-YRKTRVTREEYYEHGTDWLTKNRFG 415
            A+ E+ Y+ T VTR+EY E+G D++ +++ G
Sbjct: 713 LANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 97/248 (39%), Gaps = 45/248 (18%)

Query: 6   IAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT-------TYLSNQIKNIKDITSVTFR 58
           IAID GSY I+ G T+ ++P   I    + K+         T++ N     + I S + +
Sbjct: 39  IAIDFGSYNIRAGYTNQNTP-SYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQTIRSQS-K 96

Query: 59  RPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQV 118
            P +   LT+W+    + +Y   +     G   N+     LI +E    L     +  Q+
Sbjct: 97  SPFDGTLLTNWDYVEDMLEYTFHHL----GVSGNNGVSNPLIINERLACLQSQRNSWYQL 152

Query: 119 VFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDS 178
           +FE ++            + F  D         T+ED                  LVI+ 
Sbjct: 153 LFETFDLPE---------VSFGIDSLFSFYGNSTKED-----------------GLVINC 186

Query: 179 GFNCTWIIPVIKGVPYYKAVKKLDIGG----RFLDGLLKETLSFRHYDVMDETILVNNIK 234
           G   T +IP++ G       K+++ GG     FL  LL  TL + ++     T+    + 
Sbjct: 187 GNEETDVIPIVGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLSTLQYTQMY 244

Query: 235 ENCLFVSP 242
           E+  + SP
Sbjct: 245 EDYCYTSP 252

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 149/391 (38%), Gaps = 72/391 (18%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 103 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 156

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 157 LTEPPLNPPENRQQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 210

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 211 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 256

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F   +E   ++++ N + T       
Sbjct: 257 --GEQDASLRT--AERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKERT------- 305

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
                    + + +  E F  PE FF+PEIA    L P L   + E++   P  +R  L 
Sbjct: 306 -------TKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLY 357

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ----------------RQLPTDWICRTSVPTKECEL 376
            N+V +GG+     F  RL  +L+                R    D    +    +    
Sbjct: 358 NNIVLSGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVW 417

Query: 377 FGWKAMAQFASTESYRKTRVTREEYYEHGTD 407
           FG   +AQ    +SY     T+++Y E+G D
Sbjct: 418 FGGSLLAQTGEFKSYCH---TKQDYEEYGPD 445

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 146/368 (39%), Gaps = 65/368 (17%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDI 52
           + PI IDNGS  IK G +    P    Y  +     +K         T++ N+ + ++ +
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
             +  R P   G +  W+    IW Y L   +E     L +++   L+ +E  M   +  
Sbjct: 72  --LRLRYPMTHGVVEDWDSMELIWSYML---NEV--LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           + M QV+FE +   + Y S+ A    +A  + T                           
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASGRTTGC------------------------- 159

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETI 228
             V+D G      +P+  G     ++ ++DIGGR     L   L+++     +    E  
Sbjct: 160 --VVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFSS-SELE 216

Query: 229 LVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
           +V  IKE   +++        KN  +    Y+  +       H       LP+  + I++
Sbjct: 217 VVRMIKEKVCYLA--------KNIKKEEDRYLQGH-------HDLGSVFKLPDG-KCIEI 260

Query: 289 YDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFA 348
            ++ +  PE  F P+I      GL +  ++S+  V   LR  L+ +++ +GG   L  F 
Sbjct: 261 GNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFG 320

Query: 349 TRLTSELQ 356
            R+  +L+
Sbjct: 321 ERMLHDLE 328

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 91/424 (21%), Positives = 169/424 (39%), Gaps = 84/424 (19%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP------------YRAINAFAIDKYHTTYLSNQIKNIKDI 52
           P+ +DNGS  +K G +   +P            Y+ +    ++    T++ N+ + ++ +
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLED--RTFVGNEAQRLRGL 70

Query: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKH-LIASETCMTLPEL 111
            ++   RP   G++T+W+    +W +  ++  +      N   G H L+ +E  +   + 
Sbjct: 71  LALR--RPISRGEVTNWDDMELLWSHIFYSKLQLG--QGNSQIGDHPLLITEAPLNSTKN 126

Query: 112 SKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYND 171
            + M ++++E + FD+ Y +  A    +A  + T                          
Sbjct: 127 RETMCEILYETFNFDALYVAHPAVLSLYATGQTTGC------------------------ 162

Query: 172 YQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDET 227
              V++ G   +   PV +G     +++++DIGGR     L   ++++     +   ++ 
Sbjct: 163 ---VLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQE 219

Query: 228 ILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIK 287
           I V  IKE   +V+    F+  K                 F  H R       ENT T+K
Sbjct: 220 I-VRTIKEKANYVALDYKFEEEK-----------------FFIHER-------ENTSTVK 254

Query: 288 LYD--EL------FSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTG 339
           L D  EL      +   E  F P++       + E +LES++ V   LR  L+ N+V +G
Sbjct: 255 LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSG 314

Query: 340 GNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTRE 399
           G   L  F  R  SE ++ LP     +      E     W   +  +    +R   +TRE
Sbjct: 315 GTTMLKGFDQRTMSETKKMLPKHTKVKIR-SLAERSYIAWIGGSILSGLYGFRNLWLTRE 373

Query: 400 EYYE 403
            Y E
Sbjct: 374 MYEE 377

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 88/385 (22%), Positives = 149/385 (38%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+  W      W+ ++F       +   + +    +
Sbjct: 102 YIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFK------YLRTEPEDHFFL 155

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 156 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 209

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 210 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRE-- 254

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                +V         IK+   +V P     F+ F        ++++ N         ++
Sbjct: 255 ---RGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVEN---------KE 302

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 303 KTQ-----KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLY 356

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ-----RQLPTDWICRTSVPTKECEL----------- 376
            N+V +GG+     F  RL  +L+     R   ++ +  T     E ++           
Sbjct: 357 NNIVLSGGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVW 416

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ A  +SY  T+   EEY
Sbjct: 417 FGGSLLAQTAEFKSYCHTKKDYEEY 441

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 74/155 (47%), Gaps = 21/155 (13%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPGLVETILES--------LSMV 323
           P P +++ I       L  E   VPE  F P +  + + G++E I E+            
Sbjct: 590 PRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSE 648

Query: 324 PELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLP--TDWICRTSVPTKECELFGWKA 381
              +   L  N+  TGGN  LP    R+  E +  LP  T+   R +    +C L  W+ 
Sbjct: 649 LSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA---NDCALDAWRG 705

Query: 382 MAQFASTES-YRKTRVTREEYYEHGTDWLTKNRFG 415
           MA+ + T+S +R T VTR+EY+E+G D++ ++  G
Sbjct: 706 MAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 95/249 (38%), Gaps = 42/249 (16%)

Query: 4   SPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTF------ 57
           + IAID GS E++ G  +   P   I    I ++    L+  +  I + T++        
Sbjct: 37  TAIAIDFGSSEVRAGYGNQERPSH-IFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQS 95

Query: 58  RRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQ 117
           R P++   +T+W+    I +Y   +     G    D     +I +E    L     N  Q
Sbjct: 96  RSPYDGALVTNWDYTEDIMEYTFHHL----GVKGTDGIPNPIIMTEKLGALHSQRDNWYQ 151

Query: 118 VVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177
           ++FE +          A  + F  D    + S     D S                LVI 
Sbjct: 152 LLFECFG---------APQVTFGLDS---LFSFYANNDASASG-------------LVIS 186

Query: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILVNNI 233
           SG   T IIPV+ G       K+++ GGR    +L  LL   L + ++ +   T     +
Sbjct: 187 SGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQFKAL 244

Query: 234 KENCLFVSP 242
            +   +VSP
Sbjct: 245 YDEFCYVSP 253

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 86/385 (22%), Positives = 149/385 (38%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 103 YIGNEALAASRGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 156

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 157 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 210

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 211 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-- 255

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                +V         IK+   +V P     F+ F        ++++ N ++T       
Sbjct: 256 ---RGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST------- 305

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
                    + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 306 -------KKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLY 357

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ-----RQLPTDWICRTSVPTKECEL----------- 376
            N+V +GG+     F  RL  +L+     R   ++ +  T     + ++           
Sbjct: 358 NNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVW 417

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ A  +SY  T+   EEY
Sbjct: 418 FGGSLLAQTAEFKSYCHTKQDYEEY 442

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/360 (23%), Positives = 147/360 (40%), Gaps = 54/360 (15%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +  + +
Sbjct: 105 YIGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFL 158

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+I      D SL  
Sbjct: 159 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVI------DRSLTG 212

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                         VIDSG   T +IPV +G     A+K + I GR +   ++  L  R 
Sbjct: 213 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RE 257

Query: 221 YDVMDETI-LVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK 277
               D ++     IK+   +V P     F+ F  + E   ++++ +         ++KTK
Sbjct: 258 RGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVES---------QEKTK 308

Query: 278 PLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLVGNL 335
                 + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L  N+
Sbjct: 309 -----QKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNI 362

Query: 336 VCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTR 395
           V +GG+     F+ R    LQR + +    R S   K   + G K+        S+RK R
Sbjct: 363 VLSGGSTMFKDFSRR----LQRDMKSIVNARISQNEK---MTGVKSSGVDVQVISHRKQR 415

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/369 (21%), Positives = 148/369 (40%), Gaps = 71/369 (19%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDITS 54
           PI IDNGS  IK G +    P    Y  +     DK         T++ N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +  R P + G +  W+    IW Y L   +E     L +++   L+ +E  M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVL---NEV--LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           + QV+FE +   + Y S  A    +A  + T                             
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYASGRTTGC--------------------------- 159

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI------ 228
           V+D G      +P+  G     ++ ++DIGG    G + E L F+       ++      
Sbjct: 160 VVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSER 215

Query: 229 -LVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIK 287
            +V  IKE   +++  +  +  ++K     + ++  F+             LP+  ++I+
Sbjct: 216 EIVRTIKEKVCYLAKDAKKE--EDKYLQGTQDLISAFK-------------LPDG-KSIE 259

Query: 288 LYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHF 347
           + ++ +  PE  F P+I      GL    ++S+  V   LR  L+ +++ +GG   L  F
Sbjct: 260 VGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGF 319

Query: 348 ATRLTSELQ 356
             R+  +L+
Sbjct: 320 GDRMLHDLE 328

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 155/381 (40%), Gaps = 63/381 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S     P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 108 YIGNEALIAAQGPSYGLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHCFL 161

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+I      D SL  
Sbjct: 162 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVI------DRSLTG 215

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                         VIDSG   T +IPV +G     A+K + I GR +   +++ L  R 
Sbjct: 216 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG 262

Query: 221 YDVMDETI-LVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK 277
            +  D ++     IK+   +V P     F+ F   +E   ++V+ +         ++KT+
Sbjct: 263 EE--DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVVES---------QEKTR 311

Query: 278 PLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLVGNL 335
                 + + +  E F  PE FF+PEIA    L P L   +  ++   P  +R  L  N+
Sbjct: 312 -----RKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNI 365

Query: 336 VCTGGNFNLPHFATRLTSELQ-----RQLPTDWICRTSVPTKECEL-----------FGW 379
           V +GG+     F  RL  +L+     R + ++++  T     + ++           FG 
Sbjct: 366 VLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWFGG 425

Query: 380 KAMAQFASTESYRKTRVTREE 400
             +AQ A  +SY  T+   EE
Sbjct: 426 SLLAQTAEFKSYCHTKKDYEE 446

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 108/256 (42%), Gaps = 49/256 (19%)

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILV 230
           VIDSG   T +IPV +G     A+K + I GR    F+  LL+E       +        
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLLRE-----RGEADSSLKTA 268

Query: 231 NNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKL 288
             IK+   +V P     F+ F  + E   ++++ N         +DKT       + I +
Sbjct: 269 ERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QDKT-----TKKVIDI 314

Query: 289 YDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPH 346
             E F  PE FF+PEIA    L P L   + +++   P  +R  L  N+V +GG+     
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 373

Query: 347 FATRLTSELQRQLPTDWICRTSVPT-----------------KECELFGWKAMAQFASTE 389
           F+ RL  ++ + + ++ I +    T                 +    FG   +AQ A  +
Sbjct: 374 FSRRLQRDV-KSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFK 432

Query: 390 SYRKTRVTREEYYEHG 405
            Y     T+++Y EHG
Sbjct: 433 GYCH---TKKDYEEHG 445

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/366 (21%), Positives = 148/366 (40%), Gaps = 65/366 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAINAFAIDKYHT------TYLSNQIKNIKDITS 54
           P+ IDNGS  IK G +    P    Y  +     DK         T++ N  + ++ +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +  R P + G +  W+    IW Y L   +E     L ++    L+ +E  M   +  + 
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVL---NEV--LQLQNIGEHPLLITEAPMNPLKNREQ 126

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           M QV+FE ++  + Y S+ A    +A  + T                             
Sbjct: 127 MAQVLFETFDVSALYVSNPAVLSLYASGRTTGC--------------------------- 159

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGG----RFLDGLLKETLSFRHYDVMDETILV 230
           V+D G      +P+  G     ++ ++DIGG      L   L+++     +   +  I V
Sbjct: 160 VVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI-V 218

Query: 231 NNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYD 290
             +KE   +++      + K + E  ++    +  +TF          LP+  + I++ +
Sbjct: 219 RTMKEKVCYLA-----KNIKKEEEKYLQGT-QDLISTF---------KLPDG-RCIEVGN 262

Query: 291 ELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATR 350
           + +  PE  F P+I  +   GL +  ++S+  V   LR  L+ +++ +GG   L  F  R
Sbjct: 263 DRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDR 322

Query: 351 LTSELQ 356
           +  +L+
Sbjct: 323 MLWDLE 328

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 86/385 (22%), Positives = 147/385 (38%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 109 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 162

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 163 LTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 216

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 217 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-- 261

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                +V         IK+   +V P     F+ F        ++++ N + T       
Sbjct: 262 ---RGEVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQEQT------- 311

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
                    + + +  E F  PE FF+PEIA    L P L   +  ++   P  +R  L 
Sbjct: 312 -------RKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLY 363

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ-----RQLPTDWICRTSVPTKECEL----------- 376
            N+V +GG+     F  RL  +L+     R   ++ +  T     + ++           
Sbjct: 364 NNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVW 423

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ A  +SY  T+   EEY
Sbjct: 424 FGGSLLAQTAEFKSYCHTKKDYEEY 448

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/363 (23%), Positives = 140/363 (38%), Gaps = 60/363 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 101 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 154

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 155 LTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 208

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 209 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 254

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F    E   ++V+ N ++T       
Sbjct: 255 --GEADTSLRT--AERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST------- 303

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
                    + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 304 -------RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLY 355

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYR 392
            N+V +GG+     F  RL  +L+       I    +   E  L G K+        S+R
Sbjct: 356 NNIVLSGGSTMFKDFGRRLQRDLK------GIVNNRIAQSEM-LSGTKSTGVNVQVISHR 408

Query: 393 KTR 395
           K R
Sbjct: 409 KQR 411

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 87/386 (22%), Positives = 149/386 (38%), Gaps = 71/386 (18%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        + +   P + GQ+ +W      W+ ++F       +   + +    +
Sbjct: 105 YIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFK------YLRTEPEDHFFL 158

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 159 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 212

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 213 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-- 257

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                +V         IK+   +V P     F+ F        ++++ N         + 
Sbjct: 258 ---RGEVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN---------QG 305

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   +  ++   P  +R  L 
Sbjct: 306 KTQ-----KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLY 359

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPT-----------------KECE 375
            N+V +GG+     F  RL  +L R +  D I ++ + +                 +   
Sbjct: 360 SNIVLSGGSTMFKDFGRRLQRDL-RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAV 418

Query: 376 LFGWKAMAQFASTESYRKTRVTREEY 401
            FG   +AQ A  +SY  T+   EEY
Sbjct: 419 WFGGSLLAQTAEFKSYCHTKRDYEEY 444

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 88/363 (24%), Positives = 143/363 (39%), Gaps = 60/363 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 149

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 203

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 204 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 249

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F        ++V+ N         ++
Sbjct: 250 --GEADTSLRT--AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN---------QE 296

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 297 KTR-----RKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLY 350

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYR 392
            N+V +GG+     F  R    LQR L +  I    +   E  L G K+     S  S+R
Sbjct: 351 NNIVLSGGSTMFKDFGRR----LQRDLKS--IVNNRIAQSEL-LSGTKSTGVDVSVISHR 403

Query: 393 KTR 395
           K R
Sbjct: 404 KQR 406

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 87/385 (22%), Positives = 147/385 (38%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 96  YIGNEALAAAQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRTEPEDHFFL 149

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 203

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 204 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 249

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F    +   ++++ N         ++
Sbjct: 250 --GETDTSLRT--AERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVEN---------QE 296

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   +  ++   P  +R  L 
Sbjct: 297 KTQ-----KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLY 350

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ----------------RQLPTDWICRTSVPTKECEL 376
            N+V +GG+     F  RL  +++                +    D    T    +    
Sbjct: 351 NNIVLSGGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVW 410

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ A  +SY  T+   EEY
Sbjct: 411 FGGSLLAQTAEFKSYCHTKKDYEEY 435

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 68/137 (49%), Gaps = 9/137 (6%)

Query: 291 ELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELLRPL---LVGNLVCTGGNFN 343
           E   VPE FF P +    + G+ E     +L      P  +  +   +  N+  TGGN  
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 344 LPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTES-YRKTRVTREEYY 402
           +P    R+  E    LP +     ++ + +  L  W+ MA++A  E+ Y+K+ ++++EY 
Sbjct: 672 IPGLRERIVKEFTGFLPVNTSFNVNI-SSDPSLDAWRGMAKYAQNETDYKKSFISKKEYE 730

Query: 403 EHGTDWLTKNRFGYQNW 419
           E+G D++ +++ G  N+
Sbjct: 731 EYGPDYIKEHKLGNMNY 747

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 142/363 (39%), Gaps = 60/363 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 149

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 203

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 204 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 249

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F        ++V+ N         ++
Sbjct: 250 --GEADTSLRT--AEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVEN---------QE 296

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 297 KTR-----RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLY 350

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYR 392
            N+V +GG+     F  RL  +L+       I    +   E  L G K+     S  S+R
Sbjct: 351 NNIVLSGGSTMFKDFGRRLQRDLKS------IVNNRIAQSEL-LSGTKSTGVDVSVISHR 403

Query: 393 KTR 395
           K R
Sbjct: 404 KQR 406

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 88/363 (24%), Positives = 143/363 (39%), Gaps = 60/363 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 149

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 203

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 204 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 249

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F        ++V+ N         ++
Sbjct: 250 --GEADTSLRT--AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN---------QE 296

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 297 KTR-----RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLY 350

Query: 333 GNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYR 392
            N+V +GG+     F  R    LQR L +  I    +   E  L G K+     S  S+R
Sbjct: 351 NNIVLSGGSTMFKDFGRR----LQRDLKS--IVNNRIAQSEL-LSGTKSTGVDVSVISHR 403

Query: 393 KTR 395
           K R
Sbjct: 404 KQR 406

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 15/141 (10%)

Query: 286 IKLYDELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELLRPL---LVGNLVCT 338
           I L  E   VPE  F P +  + + G+ E     +L      P+ L  L   +  N+  T
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 339 GGNFNLPHFATRLTSELQRQLPTDW---ICRTSVPTKECELFGWKAMAQFASTES-YRKT 394
           GGN  +P    R+  E +  LP +    +  TS PT +     W  MA+ A  E+ Y+KT
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNTQFNVNMTSDPTFDA----WNGMAKLAQNETDYKKT 726

Query: 395 RVTREEYYEHGTDWLTKNRFG 415
            ++++EY E+G +++ +++ G
Sbjct: 727 IISKKEYEEYGPEYIKEHKLG 747

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 295 VPETFFHPEIARILKPGLVE----TILESLSMVPELLR---PLLVGNLVCTGGNFNLPHF 347
           VPE  F P +    + G++E     +L+     P  L      +  N+  TGG+  LP  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 348 ATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTES-YRKTRVTREEYYEHGT 406
            TR+  E    LP D     ++ +K   L  WK MA+F+S ++ ++ + ++++EY E+G 
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNI-SKHPSLDAWKGMAKFSSDDADFKSSLISKKEYEEYGP 740

Query: 407 DWLTKNRFG 415
           +++ ++R G
Sbjct: 741 EYIKEHRLG 749

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 89/227 (39%), Gaps = 42/227 (18%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSPYRAIN-AFAIDKYHTTYLSNQIKNIKDITSVTF---- 57
           S PIAID G+  +K G  + + P  A N    + ++    +S  +  I + T++ +    
Sbjct: 37  SIPIAIDFGTCSVKAGYVNKADP--AFNFPTRLTRFRDRKMSRTMTFIGNDTNLDYAVRS 94

Query: 58  --RRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNM 115
             + P +   +T+WE    I +Y      +  G   N      LI +E   TL     N 
Sbjct: 95  QSKTPFDGPFVTNWEYAEDILEYTF----KHLGVTANHGISNPLIMTEKLATLQSQRANW 150

Query: 116 DQVVFEEYEFD--SYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ 173
            Q++FE +     S+   ++  F    D  ++ ++ G   +D                  
Sbjct: 151 YQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQD------------------ 192

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                    T +IP+I G P     K+++ GG    G L + ++ ++
Sbjct: 193 ---------TNVIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 15/152 (9%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELL 327
           P P +++ I       L  E   VPE  F P +    + G+ E     +L+     P  L
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKL 657

Query: 328 RPL---LVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
                 +V N++ TGGN  +P    R+  E    LPT      ++ + +  L  WK MA 
Sbjct: 658 SQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM-SSDPSLDAWKGMAA 716

Query: 385 FA-STESYRKTRVTREEYYEHGTDWLTKNRFG 415
            A + E YRKT ++++EY E+G +++ +++ G
Sbjct: 717 LARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 89/226 (39%), Gaps = 39/226 (17%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSPYR----AINAFAIDKYHT--TYLSNQIKNIKDITSVT 56
            SPIAID GS +++ G  + ++P      A+  F   K +   T++ N     + + S +
Sbjct: 37  QSPIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQS 96

Query: 57  FRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMD 116
            R P +   +T+W L   I DY   +    P   + +     ++ +E   T+     N  
Sbjct: 97  -RSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPN----PILLTERLATVQSQRTNWY 151

Query: 117 QVVFEEYEFD--SYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           Q++FE Y     ++   S+  F  +         SG                   N   L
Sbjct: 152 QILFETYNVPGVTFGIDSLFSFYNYNP-------SG-------------------NKTGL 185

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
           VI  G   T +IPV+ G       K+++ GG      L + ++ ++
Sbjct: 186 VISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 131/326 (40%), Gaps = 57/326 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ ++        S +   P   GQ+ +W+     W+ ++F       +   + +  + +
Sbjct: 92  YIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFL 145

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K++      D SL  
Sbjct: 146 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------DRSLTG 199

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 200 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG 246

Query: 217 SFRHYDVMDETIL--VNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHV 272
                   ++T L     IK+   +V       F+ F   +E   ++++ N + T     
Sbjct: 247 E-------EDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKT----- 294

Query: 273 RDKTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPL 330
                      + I +  E F  PE FF+PEIA    L P L   + +++   P  +R  
Sbjct: 295 ---------RRKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKG 344

Query: 331 LVGNLVCTGGNFNLPHFATRLTSELQ 356
           L  N+V +GG+     F  RL  +L+
Sbjct: 345 LYNNIVLSGGSTMFKDFGRRLQRDLK 370

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 87/385 (22%), Positives = 146/385 (37%), Gaps = 69/385 (17%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 149

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K+       D SL  
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------DRSLTG 203

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETL 216
                         VIDSG   T +IPV +G     A+K + I GR    F+  LL+E  
Sbjct: 204 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER- 249

Query: 217 SFRHYDVMDETILVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD 274
                D    T     IK+   +V P     F+ F        ++V+ N         ++
Sbjct: 250 --GEADTSLRT--AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN---------QE 296

Query: 275 KTKPLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLV 332
           KT+      + + +  E F  PE FF+PEIA    L P L   + +++   P  +R  L 
Sbjct: 297 KTR-----RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLY 350

Query: 333 GNLVCTGGNFNLPHFATRLTSELQ----------------RQLPTDWICRTSVPTKECEL 376
            N+V +GG+     F  RL  +L+                +    D    +    +    
Sbjct: 351 NNIVLSGGSTMFKDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVW 410

Query: 377 FGWKAMAQFASTESYRKTRVTREEY 401
           FG   +AQ A  + Y  T+   EEY
Sbjct: 411 FGGSLLAQTAEFKGYCHTKKDYEEY 435

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/382 (21%), Positives = 151/382 (39%), Gaps = 63/382 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 101 YIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 154

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   + K+       D SL  
Sbjct: 155 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVT------DRSLTG 208

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                         VIDSG   T +IPV +G     A+K + I GR +   +++ L  R 
Sbjct: 209 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RE 253

Query: 221 YDVMDETI-LVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK 277
               D ++     IK+   +V P     F+ F        ++V+ +         ++KT+
Sbjct: 254 RGEQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVES---------QEKTR 304

Query: 278 PLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLVGNL 335
                 + + +  E F  PE FF+PEIA    L P L   + E++   P  +R  L  N+
Sbjct: 305 -----KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNI 358

Query: 336 VCTGGNFNLPHFATRLTSELQ-----RQLPTDWICRTSVPTKECEL-----------FGW 379
           V +GG+     F  RL  +++     R   ++ +  T     + ++           FG 
Sbjct: 359 VLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGG 418

Query: 380 KAMAQFASTESYRKTRVTREEY 401
             +AQ A  +SY  T+   +EY
Sbjct: 419 SLLAQTAEFKSYCHTKKDYDEY 440

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 8/132 (6%)

Query: 291 ELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELLRPL---LVGNLVCTGGNFN 343
           E   VPE  F P +    + G+ E     +L+     P  L      +  N+  +GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 344 LPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYE 403
           +P    R+  E    LP       ++ +    L  WK MA++A +E Y K+ +T++EY E
Sbjct: 673 VPGLKNRIVKEFTSFLPVGTKLSVNMSSDPL-LDSWKGMAKWAKSEDYNKSFITKKEYEE 731

Query: 404 HGTDWLTKNRFG 415
           +G +++ +++ G
Sbjct: 732 YGPEYIKEHKMG 743

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 291 ELFSVPETFFHPEIARILKPGLVE---TILESLSMVPELLRPL------LVGNLVCTGGN 341
           E   VPE  F P I  + + G+VE   T+L  L       R L      +  N+  TGGN
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRRALSATCEKMAKNVFITGGN 671

Query: 342 FNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFAST-ESYRKTRVTREE 400
             LP    R+  E    LP     + ++  K+  L  WK MA+FAS   SY+ + +T+ E
Sbjct: 672 TKLPGIRERIVREFTGFLPVGTELKVTL-AKDPSLSAWKGMAKFASDPTSYKSSILTKRE 730

Query: 401 YYEHGTDWLTKNRFG 415
           Y E+G +++ ++  G
Sbjct: 731 YEEYGPEYIKEHNLG 745

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 151/381 (39%), Gaps = 63/381 (16%)

Query: 41  YLSNQIKNIKDITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLI 100
           Y+ N+        S +   P   GQ+ +W+     W+ ++F       +   + +    +
Sbjct: 98  YIGNEALAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 151

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDS 160
            +E  +  PE  + + ++ FE +     Y +  A     A   ++K++      D SL  
Sbjct: 152 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------DRSLTG 205

Query: 161 VNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                         VIDSG   T +IPV +G     A+K + I GR +   ++  L  R 
Sbjct: 206 T-------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG 252

Query: 221 YDVMDETI-LVNNIKENCLFVSP--TSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK 277
            +  D T+     IK+   +V       F+ F    +   ++++ N          +KTK
Sbjct: 253 EE--DTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVEN---------SEKTK 301

Query: 278 PLPENTQTIKLYDELFSVPETFFHPEIAR--ILKPGLVETILESLSMVPELLRPLLVGNL 335
                 + I +  E F  PE FF+PEIA    L P L   + +++   P  +R  L  N+
Sbjct: 302 -----RKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNI 355

Query: 336 VCTGGNFNLPHFATRLTSELQ-----RQLPTDWICRTSVPTKECEL-----------FGW 379
           V +GG+     F  RL  +L+     R   ++ +  T     + ++           FG 
Sbjct: 356 VLSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGG 415

Query: 380 KAMAQFASTESYRKTRVTREE 400
             +AQ A  +SY  T+   EE
Sbjct: 416 SLLAQTAEFKSYCHTKQDYEE 436

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 310 PGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTS 368
           PG+V+ I  S+      LR  L  N+V TGG   +P F+ RL  EL ++LP   +   T+
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 369 VPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             T+E +   W   +  +S  ++ +  V ++EY E G D L K+RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 100/279 (35%), Gaps = 69/279 (24%)

Query: 64  GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEY 123
           G++  W+     WD+AL N        L    G     +E      E  K   +V+ E  
Sbjct: 95  GEVIDWDGAQEQWDWALKN-----ALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLEGL 149

Query: 124 EFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGFNCT 183
           +F++ Y S     I FA        SG+                      LV+D G +  
Sbjct: 150 QFEACYLSPTPTCISFA--------SGRPN-------------------CLVVDIGHDVA 182

Query: 184 WIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH----------------------- 220
            + PVI G+   K+  +  I GRF++  +KE L  R                        
Sbjct: 183 SVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPREIIPLFEVKQRKPEFIKKTFDFPI 242

Query: 221 ----YDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKT 276
               YD  ++  +    KE    ++PT+  D    + E+  +    +++T +      K 
Sbjct: 243 HQSVYDYANDHGIFQECKETLCQIAPTAALDKMAPELESLAKR---SYETLW------KE 293

Query: 277 KPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVET 315
             + +N       + LF VP+    PE   + K G+VET
Sbjct: 294 DIVFDNVTRYSFAEHLF-VPKEESMPEGWPVSKDGIVET 331

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 9/133 (6%)

Query: 291 ELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELLRPL---LVGNLVCTGGNFN 343
           E   VPE  F P +  + + G++E     I+         L  +   +  N+  TGGN  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 344 LPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFA-STESYRKTRVTREEYY 402
           +P    R+  E    LP        V +    +  WK MA+FA S+  Y+ + VT++EY 
Sbjct: 670 VPGLRDRIVREFTEFLPVGTKYNIKVASDPA-IDAWKGMAKFAQSSTDYKGSYVTKKEYE 728

Query: 403 EHGTDWLTKNRFG 415
           E+G D++ +++ G
Sbjct: 729 EYGPDYIKEHKLG 741

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 70/155 (45%), Gaps = 21/155 (13%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELL 327
           P P +++ I       L  E   VPE  F P +    + G+ E     +L+     P  L
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKL 657

Query: 328 RPL---LVGNLVCTGGNFNLPHFATRLTSELQRQLPTDW---ICRTSVPTKECELFGWKA 381
                 +V N+  TGGN  +P    R+  E    LP      +  +S P+    L  WK 
Sbjct: 658 SSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS----LDAWKG 713

Query: 382 MAQFAST-ESYRKTRVTREEYYEHGTDWLTKNRFG 415
           MA  A   E Y+KT ++++EY E+G D++ +++ G
Sbjct: 714 MAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 92/224 (41%), Gaps = 39/224 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYR----AINAFAIDKYHT--TYLSNQIKNIKDITSVTFR 58
           PIAID GS +++ G  + ++P       +  F   K +   T++ N     + + S + R
Sbjct: 39  PIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS-R 97

Query: 59  RPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQV 118
            P +   +T+W     I DY   +     G   N+     ++ +E   T+     N  Q+
Sbjct: 98  SPFDGPFVTNWNFTEEIMDYTFHHL----GVSPNNGVRNPILLTERMATVQSQRANWYQI 153

Query: 119 VFEEYEFD--SYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVI 176
           +FE Y     ++   S+ GF     ++NT   SG                   N   LVI
Sbjct: 154 MFETYNVPGVTFGIDSLYGFY----NQNT---SG-------------------NKTGLVI 187

Query: 177 DSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
           D G   T +IPV+ G       K+++ GGR     L + ++ ++
Sbjct: 188 DCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + I  S+      LR  L  N+V TGG  +LP    R+++EL R LP   +   TS 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             +E +  GW   +  AS  ++ +  V ++EY E G D L K+RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 74/348 (21%), Positives = 131/348 (37%), Gaps = 82/348 (23%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTF-RRP 60
           E + + ID GS+    G +    P +AI    +   +  Y   +   +    S+   R+ 
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCP-QAI----LPSCYGKYTEGEKDELFSEQSIGLPRKD 67

Query: 61  HEL------GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +E+      G++  WE     WD+A+ +      F+ N   G   + +E      E  K 
Sbjct: 68  YEIHNIVQNGEVVDWEKAEKQWDWAIRSELR---FETN--SGMPALLTEPIWNSEENRKK 122

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
             +V+ E  +F + Y    A  + FA  + T                            L
Sbjct: 123 SLEVLLESMDFSACYLVPTATAVSFAMGRPTC---------------------------L 155

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH-------------- 220
           V+D G + T + PV+ G+   K+  +  I G  L+ L++  L+ R               
Sbjct: 156 VVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVF 215

Query: 221 ------YDV-------MDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTT 267
                 Y++       ++E       KE  L V+PTS    FK++ ET  +  +      
Sbjct: 216 MERKFDYEIHPSLQKFVNERQFFQEFKETMLQVAPTS-ISKFKSEIETTSKRSIEAPWGE 274

Query: 268 FLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVET 315
            L +         ++ Q ++  ++LF+ P+    PE   I K G+VET
Sbjct: 275 ELVY---------DSLQRLEFAEQLFT-PDLSQFPEDWPISKDGVVET 312

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 68/156 (43%), Gaps = 9/156 (5%)

Query: 268 FLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVET----ILESLSMV 323
           FL   R      P     I +  E   VPE  F P I    + G+ E      L   +  
Sbjct: 599 FLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSS 658

Query: 324 PELLRPL---LVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWK 380
           P  L  +   ++ N+  TGG+  LP    R+  E    LP       ++ + +  L  WK
Sbjct: 659 PRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-SNDPSLDTWK 717

Query: 381 AMAQFASTESY-RKTRVTREEYYEHGTDWLTKNRFG 415
            MA+ AS   Y +K +VT+++Y E+G +++ ++  G
Sbjct: 718 GMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 106/260 (40%), Gaps = 46/260 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITS------VTFR 58
           PIAID GSY +K G T+ S P        + +Y    L+  +  I + T+      +  +
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTN-KLTRYRDRKLAKTMTFIGNDTNLDQPLRIQAK 96

Query: 59  RPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQV 118
           RP++   + +WE    I+DY L +         N      +I +E    L     N  Q+
Sbjct: 97  RPYDGLFIANWEYAEEIFDYTLHH---LGVQTTNGSISNPIILTEKMACLQSQRANWYQL 153

Query: 119 VFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ---LV 175
           +FE ++  S      A F                     LDS+        N ++   LV
Sbjct: 154 LFETFDVPS------ATF--------------------GLDSLYAFYNNCANPFESDGLV 187

Query: 176 IDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILVN 231
           I+ G   T I+P+++G       K+++ GGR    +L  LL  TL + ++          
Sbjct: 188 INCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLSEFQYQ 245

Query: 232 NIKENCLFVSPTSYFDSFKN 251
            + E+  +VSP +Y +  KN
Sbjct: 246 TMYEDFCYVSP-NYNEDIKN 264

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 15/152 (9%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPG---LVETILESL--SMVPEL 326
           P P +++ I       L  E   VPE  F P +    + G   L ETIL     S   +L
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKL 657

Query: 327 LRPLL--VGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
               L  V N++ TGGN  +P    R+  E    LP       ++ +    L  W+ MA 
Sbjct: 658 SSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNISSNPS-LDAWRGMAA 716

Query: 385 FASTES-YRKTRVTREEYYEHGTDWLTKNRFG 415
            A  ++ Y+KT +++EEY E+G D++ +++ G
Sbjct: 717 LARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 68/151 (45%), Gaps = 14/151 (9%)

Query: 278 PLPENTQTIKLYDEL------FSVPETFFHPEIARILKPGLVETILESL-----SMVPEL 326
           P P N + +    +L         PE  F P +  + + G+ E     L     S   +L
Sbjct: 592 PRPHNGEDVHQQHQLHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKL 651

Query: 327 LRPLL--VGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
            +  L    N+  TGGN  +P+   R+ +E    LP +     +   +   L  WK MA+
Sbjct: 652 SQQCLDMASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNY-AQNVSLDAWKGMAK 710

Query: 385 FASTESYRKTRVTREEYYEHGTDWLTKNRFG 415
           FA +++Y  T VT+ EY E G +++ +++ G
Sbjct: 711 FARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 87/224 (38%), Gaps = 36/224 (16%)

Query: 3   SSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVT------ 56
           ++PIA+D GSYE++ G T   +P        I +Y    +   +  I +  S+       
Sbjct: 39  NTPIALDFGSYEVRAGFTSQDTPSHVF-PTKIVRYKERKIQKALTFIGNDCSLDNAVRSH 97

Query: 57  FRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMD 116
            R P++   +T+WE    +  Y   +     G   ND     +I +E   T+     N  
Sbjct: 98  SRSPYDGSLITNWEYMEDMLSYTFHH----LGVQPNDGISNPMILTEKMATVQAQRSNWY 153

Query: 117 QVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVI 176
           Q++FE Y         I G   F  +              S DS             L+I
Sbjct: 154 QLLFECYGI-PQVTFGIDGLFSFYANN-------------SPDSTG-----------LII 188

Query: 177 DSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
           +SG   T IIPVIKG       K++D GG      LK  LS ++
Sbjct: 189 NSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPG---LVETIL-ESLSMVPELL 327
           P P +++ I       L  E   VPE  F P +    + G   L ETIL +     P  L
Sbjct: 598 PRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKL 657

Query: 328 RPL---LVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
                 +  N+  TGGN  +P    R+  E    LP       ++ + +  L  WK MA 
Sbjct: 658 SQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININM-SSDPSLDAWKGMAA 716

Query: 385 FASTES-YRKTRVTREEYYEHGTDWLTKNRFG 415
            A  E  Y++T ++R+EY E+G D++ +++ G
Sbjct: 717 LAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 89/224 (39%), Gaps = 39/224 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYR----AINAFAIDKYHT--TYLSNQIKNIKDITSVTFR 58
           PIAID GS +++ G  + S+P       +  F   K +   T++ N     + + S + +
Sbjct: 39  PIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS-K 97

Query: 59  RPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQV 118
            P +   +T+W     I DY   +    P   +++     ++ +E   T+     N  Q+
Sbjct: 98  SPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISN----PILLTERMATVQSQRANWYQI 153

Query: 119 VFEEYEFD--SYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVI 176
           +FE Y     ++   S+ GF  +         SGK                      LVI
Sbjct: 154 LFETYNVPGVTFGIDSLYGFYNY-------YPSGKQ-------------------TGLVI 187

Query: 177 DSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
           D G   T +IP++ G       K+++ GG      L + ++ ++
Sbjct: 188 DCGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/368 (21%), Positives = 141/368 (38%), Gaps = 62/368 (16%)

Query: 5   PIAIDNGSYEIKFGTTDLSSP----YRAI-NAFAIDKYHT-----TYLSNQIKNIKDITS 54
           P+ +DNGS  IK G      P    Y  I N  A     T     TY+ N     +   +
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +    P+    + SW+    +WDY L N       ++  L+   ++ + +  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNK-----LEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
           M +V+FE++   + Y S       +   + T                             
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGC--------------------------- 157

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDV---MDETILVN 231
            +  G     I  VI G+    + +  + GG  +   + + L   H  +    +   L+ 
Sbjct: 158 SVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIR 217

Query: 232 NIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDE 291
           +IKE C  +S   Y       NE    Y L   +T+      +    LP+    I++  E
Sbjct: 218 SIKERCCVLSKDFY-------NEIRA-YELITSKTS------NNKYRLPDG-NIIEIGSE 262

Query: 292 LFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRL 351
            F  PE  F+P+     +  L + I+ S+S    L R  L+ ++V +GG+  +  F  RL
Sbjct: 263 RFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERL 322

Query: 352 TSELQRQL 359
           T E+++++
Sbjct: 323 TKEIRKEI 330

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 15/152 (9%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPGLVE----TILESLSMVPELL 327
           P P +++ I       L  E   VPE  F P +A + + G+ E      L+        L
Sbjct: 590 PRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQL 649

Query: 328 R---PLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
                 L  N+  TGGN  LP    R+  E    LP        + + +  +  W+ MA+
Sbjct: 650 SEGSKKLAANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMAS-DSAVDAWRGMAK 708

Query: 385 FASTES-YRKTRVTREEYYEHGTDWLTKNRFG 415
            +   S Y+ + +TR+EY E G D++ ++  G
Sbjct: 709 LSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 100/247 (40%), Gaps = 42/247 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTF------R 58
           PIAID GS E++ G  +   P   I    I ++     +  +  I + T++        +
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSH-IFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQAK 96

Query: 59  RPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQV 118
            P++   +++W+    I +Y   +     G + ND     ++ +E   TL    +N  Q+
Sbjct: 97  SPYDGAIVSNWDYTEEIMEYTFHHL----GVNGNDGVSNPILMTEKLATLQSQRENWYQL 152

Query: 119 VFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDS 178
           +FE +          + F  +A+  N    SG                       LVI+S
Sbjct: 153 LFECFGVPQVTFGIDSLFSFYAN--NDATASG-----------------------LVINS 187

Query: 179 GFNCTWIIPVIKGVPYYKAVKKLDIGGR----FLDGLLKETLSFRHYDVMDETILVNNIK 234
           G   T +IPV+ G       K+++ GGR    +L  LL   L + ++ +   T    ++ 
Sbjct: 188 GNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQFQSLY 245

Query: 235 ENCLFVS 241
           E+  +VS
Sbjct: 246 EDFCYVS 252

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 17/142 (11%)

Query: 291 ELFSVPETFFHPEIARILKPGLVETILESL------SMVPEL--LRPLLVGNLVCTGGNF 342
           E   VPE  F P I  + + G+VE + E+L      S   EL  +  ++  N+  TGGN 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRELSEISKMMAKNIFITGGNA 667

Query: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECE---LFGWKAMAQFASTES-YRKTRVTR 398
            LP    R+  E    LP      T++  K  E   +  W+ MA+FA+  S Y  + +T+
Sbjct: 668 KLPGIRERVVREFTGFLPVG----TNLNVKLAEDPSMSAWRGMAKFANNTSLYETSIMTK 723

Query: 399 EEYYEHGTDWLTKNRFGYQNWI 420
           +EY E G +++ ++  G   ++
Sbjct: 724 KEYEELGPEYIKEHNLGNAKFV 745

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           G+V+ I +S+      LR  L  N+V TGG   +P  + R+  EL + LP   +   +S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             +E +  GW   +  AS  ++ +  V REEY E G + L K+RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 66/322 (20%), Positives = 119/322 (36%), Gaps = 61/322 (18%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPH 61
           E + I ID GS+    G +    P     +     Y         K I +   + F R  
Sbjct: 13  EINAIVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAG 68

Query: 62  -------ELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
                  E   +  W+     W+YAL N D          KG  ++ +E         K 
Sbjct: 69  MEIKPIVENSTIVDWDRAQEQWEYAL-NTD----LKFESNKGTPVLLTEPIWNSEASRKK 123

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
             +++ E  EF++ Y ++ +  + FA  + T                            L
Sbjct: 124 SLEILLESMEFEACYLAANSSAVSFAMGRPT---------------------------CL 156

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH----YDVMDET--- 227
           V+D G + + + PVI G+   K+  +  + G++L+ L+ + L  R     + V+ +    
Sbjct: 157 VVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPDF 216

Query: 228 ---ILVNNIKENCL-FVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK---PLP 280
               L  ++ E+ + F +   +F  FK   ET + ++ P   ++F   +  +TK     P
Sbjct: 217 VKRTLSFDVNESVINFANERQFFQEFK---ETLL-HIAPKSLSSFKDELATQTKRSLEAP 272

Query: 281 ENTQTIKLYDELFSVPETFFHP 302
              + I   D  +S  E  F P
Sbjct: 273 WGEELIFDADTRYSFAEQLFRP 294

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + I  S+      LR  L  N+V TGG+ ++P    R+ +EL + LP   +   TS 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             +E +   W   +  AS  ++ +  V ++EY E G D L K+RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 137/349 (39%), Gaps = 83/349 (23%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIK-NIKDITSVTF-RR 59
           E + I ID GS+    G +    P +AI    +   +  Y++++ K ++ +  S+   R+
Sbjct: 13  EITAIIIDPGSFNTNIGYSGTDCP-QAI----LPSCYGQYINDEEKPSLFNEQSIGLPRK 67

Query: 60  PHEL------GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSK 113
            +E+      G++  W+     W++A+        F+ N  KG   + +E      +  K
Sbjct: 68  DYEIKEIVRSGEVVDWDKAQEQWEWAI---KSVLLFESN--KGLPALLTEPIWNSEDNRK 122

Query: 114 NMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ 173
              +V+ E  +F++ Y +  A  + FA  + T                            
Sbjct: 123 KSLEVLLEGMDFEACYLTPTATAVSFAMGRPT---------------------------C 155

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH------------- 220
           LV+D G + T + PVI G+   K+  +  I G  L+ L++ +L  R              
Sbjct: 156 LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPE 215

Query: 221 -----YDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTF---LGHV 272
                +D      L+N       FV+   +F  FK   ET ++ V P   T F   L  +
Sbjct: 216 FVKRSFDYEIHPSLLN-------FVNERQFFQEFK---ETMLQ-VAPTSLTKFKSELEQL 264

Query: 273 RDKTKPLPENTQTIKLYDELFSVPETFFHPEIAR------ILKPGLVET 315
             ++   P     +   +  F++ E  F PE A+      I K G+VET
Sbjct: 265 SKRSIEAPWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 60/132 (45%), Gaps = 9/132 (6%)

Query: 291 ELFSVPETFFHPEIARILKPGLVET----ILESLSMVPELLRPL---LVGNLVCTGGNFN 343
           E   VPE  F P +    + G+ E     I +     P  L      +  N+   GGN  
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 344 LPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTE-SYRKTRVTREEYY 402
           +P   +R+  E    LP+D     ++ ++   L  W  M + A+TE  Y++T VT EEY 
Sbjct: 677 VPGLKSRVVKEFTEFLPSDTKINVNI-SEAPTLDVWNGMYRLANTEEDYQRTIVTSEEYD 735

Query: 403 EHGTDWLTKNRF 414
           E G D+L +++ 
Sbjct: 736 ECGVDYLKEHKL 747

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 79/208 (37%), Gaps = 38/208 (18%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAI-NAFAIDKYHTTYLSNQIKNI------KDITSVTF 57
           PIAID GSYE++ G T++S P     N F+  KY     +  +  I         T    
Sbjct: 42  PIAIDFGSYELRAGYTNISRPSHIFPNRFS--KYRDRKTNKYLPCIGYDTWLDQTTRSQA 99

Query: 58  RRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQ 117
           R P +   + +W++   I  Y   +     G   ++     +I +E    L     N  Q
Sbjct: 100 RSPFDGPLVVNWDMVEDILQYTFHH----LGVQPDNGVTNPIIINEKLACLQSQRSNWYQ 155

Query: 118 VVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177
            +FE +        ++ G + F    N    +G                       +VID
Sbjct: 156 TLFESFGVPK-VSMAVEGMLAFY-GHNGGSSTG-----------------------IVID 190

Query: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGG 205
            G+  T +IP+++G       K+++ GG
Sbjct: 191 CGYEDTNVIPIVEGQGMMLDAKRINWGG 218

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + +  +++     LR  L  NLV TGG+ ++P    RL +EL ++LP   +   TS 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             +E +   W   +  +S  ++ +  V R+EY E G + L K+RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 82/225 (36%), Gaps = 40/225 (17%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFR--- 58
           E S + ID GSY    G +   SP   +N  +    +T       K+  D   +  R   
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQ--LNIPSCYGQYTAGGKEGQKSFNDQFMIMPRPDF 70

Query: 59  ---RPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNM 115
              R  E G +  WE     W +A+ +  +F  F     KG     +E      E  K  
Sbjct: 71  EIKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKS 125

Query: 116 DQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLV 175
            +V+ E  EF++ Y +  A    FA  + T                            LV
Sbjct: 126 LEVLLEGMEFEACYIAPTATCTSFAMGRPT---------------------------CLV 158

Query: 176 IDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
           +D G +   + PV+ G+   K+  +  + G+ L+ L++  L  R 
Sbjct: 159 LDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 19/138 (13%)

Query: 291 ELFSVPETFFHPEIA---RILKPGLVETILESLSMVPELLRPL------LVGNLVCTGGN 341
           E   VPE  F P +    +   P L ET+L  L       R L      +  N+  TGGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 342 FNLPHFATRLTSELQRQLPTDW---ICRTSVPTKECELFGWKAMAQFA-STESYRKTRVT 397
             LP    R+  E    LP+     I ++  P+    L  W+ MA+ A +TE ++   +T
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIRKSQDPS----LDAWRGMAKLAQNTEDFKHGYIT 724

Query: 398 REEYYEHGTDWLTKNRFG 415
           ++EY E+G +++ ++  G
Sbjct: 725 KQEYLEYGPEYIKEHNLG 742

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 310 PGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTS 368
           PG+V+ I  S++     LR  L  N+V TGG   +P  + R+  EL ++LP   +    +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 369 VPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             T+E +   W   +  +S  ++ +  V ++EY E G D L  +RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 63/157 (40%), Gaps = 32/157 (20%)

Query: 64  GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEY 123
           G++  W+     W +AL N        L   +G   + +E      E  K   +V+ E  
Sbjct: 101 GEVVDWDAAQEQWSWALENE-----LFLKSNEGVPALLTEPIWNTVENRKKSLEVLLEGM 155

Query: 124 EFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGFNCT 183
            F++ Y S+    + FA        +G++                     LV+D G +  
Sbjct: 156 GFEACYLSATPTCVSFA--------AGRSN-------------------CLVVDIGHDII 188

Query: 184 WIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
            + PV+ G+ + K+ ++  I G++L+ L+ + L  R 
Sbjct: 189 SVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 327 LRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSVPTKECELFGWKAMAQF 385
           LR  L  N+V TGG  ++P F+ RL SEL ++LP   +   T+   +E +   W   +  
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 386 ASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            S  S+ +  V ++EY E G D L  +RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 60/125 (48%), Gaps = 2/125 (1%)

Query: 291 ELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATR 350
           E   VP+     +I  I+ PG+ + +  +++     LR  L  N++ TGG   +P  A R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 351 LTSELQRQLPT-DWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWL 409
           L  EL ++LP   +   +S   +E +   W   +   S  ++ +  V + EY E G D L
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 410 TKNRF 414
            K+RF
Sbjct: 591 LKDRF 595

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 67/163 (41%), Gaps = 32/163 (19%)

Query: 58  RRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQ 117
           +R  E G +  W++    W +AL          ++  KG   + +E      +  K   +
Sbjct: 162 KRIIENGMVADWDIAEEQWSWALREK-----LYMDSFKGIPALLTEPVWNTVQNRKKSLE 216

Query: 118 VVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177
           V+ E+ EF++ Y ++I   + FA        +GK                      LV+D
Sbjct: 217 VLLEKMEFEACYLTTIPTNVSFA--------AGKPN-------------------CLVVD 249

Query: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
            G +   + PVI G+   K+V++    GR+L+ LL+  +  R 
Sbjct: 250 VGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + +  S+      LR  L  N+V TGG  ++P  + RL +EL + LP+  +   T+ 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            T+E +   W   +   S  ++ +  V ++EY E G D L  +RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 83/225 (36%), Gaps = 49/225 (21%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAF----AIDKYHTTYLSNQIKNIKDITSVTF 57
           E S + ID GSY    G +    P   + +       DK   T  S Q   I        
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIP------- 65

Query: 58  RRPHEL------GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPEL 111
           R+ +EL      G +  W+     W +AL N        L+   G   + +E      E 
Sbjct: 66  RKDYELKPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTEN 120

Query: 112 SKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYND 171
            K   +V+ E  +F++ Y +  +  + FA  +                            
Sbjct: 121 RKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPN-------------------------- 154

Query: 172 YQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETL 216
             LV+D G +   + P++ G+   K+ ++  I G+F++ L+K+ +
Sbjct: 155 -CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + I  S+      LR  L  N+V TGG  ++P    R+ +EL + LP   +   TS 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             KE +   W   +  +S  ++ +  V ++EY E G   L K+RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 327 LRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSVPTKECELFGWKAMAQF 385
           LR  L  NLV TGG+ ++   A RL +EL ++LP   +   TS   +E +   W   +  
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALKFRILTSGHLRERQSRAWLGGSIL 451

Query: 386 ASTESYRKTRVTREEYYEHGTDWLTKNRF 414
           +S  ++ +  V R+EY E G + L K+RF
Sbjct: 452 SSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 84/228 (36%), Gaps = 46/228 (20%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITS--VTFRR 59
           E S + ID GSY    G +   SP   IN   I   +  Y   + +  K      +   R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQ--IN---IPSSYGQYTGGEKEGKKSFNDQFMGMAR 67

Query: 60  PH-------ELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
           P        E G +  WE     W +A+ +  +F  F     KG     +E      E  
Sbjct: 68  PDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENR 122

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           K   +V+ E  EF++ Y +  A  + FA  + T                           
Sbjct: 123 KKSLEVLLEGMEFEACYIAPTATCVSFAMGRPT--------------------------- 155

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
            LV+D G +   + PV+ G+   K+  +  + G+ L+ L+++ L  R 
Sbjct: 156 CLVVDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           G+ + +  S++     LR  L  N+V TGG+ ++P F+ RL +EL ++LP   +   T+ 
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             +E +   W   +   S  S+ +  V + EY E G + L  +RF
Sbjct: 438 HLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 86/229 (37%), Gaps = 43/229 (18%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAI-NAFAIDKYHTTYLSNQIKNIKDI---TSVTF 57
           E + + ID GS+    G +    P   + + +   K +     +  K+   +    S+TF
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  RRPH-------ELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110
            RP        E G +  W+     WD+AL N        L   KG   + +E+     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170
                 +V+ E  +F++ Y SS    + FA  +                           
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSFATGRPN------------------------- 162

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFR 219
              LV+D G +     PV+ G+   ++ ++  I G+F+D L+ + L  R
Sbjct: 163 --CLVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           G+ + +  S+      LR  L  N+V TGG   +P  + RL +EL  +LP   +   T+ 
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTG 439

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            T+E +   W   +   S  ++ +  V +EEY + G D L  +RF
Sbjct: 440 HTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 68/152 (44%), Gaps = 15/152 (9%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPG---LVETILES-LSMVPELL 327
           P P +++ I       L  E   VPE  F P I    + G   L ETIL +     P  L
Sbjct: 595 PRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPREL 654

Query: 328 RPLLVG---NLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQ 384
               +G   N+  TGG+  LP    R+  E    LP        + +K   L  W  M +
Sbjct: 655 SETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKM-SKNPSLDAWYGMRK 713

Query: 385 FASTES-YRKTRVTREEYYEHGTDWLTKNRFG 415
            A  E+ Y+ + +++++Y E+G +++ +++ G
Sbjct: 714 LAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + +  ++      LR  L  N+V TGG+ ++P  + RL  EL R+LP   +   ++ 
Sbjct: 392 GLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTG 451

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            TKE +   W   +   S  ++ +  V + EY E G + L  +RF
Sbjct: 452 HTKERQYQAWLGGSILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + +  S+      LR  L  N+  TGG   +P  + RL  EL  +LP   +   T+ 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             KE E   W   +   S  ++ +  V R+EY E G D L  +RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/240 (19%), Positives = 87/240 (36%), Gaps = 58/240 (24%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITS--VTFRR 59
           E S + ID GSY    G +    P+  + +    +Y +   +N+    +D  S     +R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPHSILPS----RYGSFKKTNKDSGDEDTKSDESATKR 68

Query: 60  PH--------------------ELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHL 99
            H                    E G +T W+     W++AL N        L   KG   
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE-----LFLESTKGIPA 123

Query: 100 IASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLD 159
           + +E      +  K   + + E   F++ Y +  +  + FA        +G+        
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFA--------TGRAN------ 169

Query: 160 SVNQVREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFR 219
                         LV+D G +   + PV+ G+   K+ ++    G++++ L++  L  R
Sbjct: 170 -------------CLVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPR 216

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 8/138 (5%)

Query: 278 PLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVC 337
           PLPE++ T     +  +        +I R   PG+V+ I  S+S     +R  L  NLV 
Sbjct: 362 PLPESSSTTNENGKRTA-------EDIKREELPGIVDLISSSISSCDVDIRASLAHNLVI 414

Query: 338 TGGNFNLPHFATRLTSELQRQLPT-DWICRTSVPTKECELFGWKAMAQFASTESYRKTRV 396
           TGG+  +P  + R+ +EL  + P   +    +  + E +   W   +  +S  ++ +  +
Sbjct: 415 TGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWLGGSILSSLGTFHQLWI 474

Query: 397 TREEYYEHGTDWLTKNRF 414
            ++EY E G++ L  +R 
Sbjct: 475 GKKEYEEVGSERLLHDRL 492

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 84/235 (35%), Gaps = 49/235 (20%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYH---------TTYLSNQIKNIKDI 52
           E + + ID GSY    G      P ++I   +  + H          T  + + + +   
Sbjct: 13  EITAVIIDPGSYTTNIGYAGTDCP-QSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSE 71

Query: 53  TSVTFRRPH-------ELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETC 105
            S+   RP        E GQ+  W+     W +AL N        +   +G   + +E  
Sbjct: 72  QSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESNRGIPAMLTEPL 126

Query: 106 MTLPELSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVR 165
               E      +++ E  EF++ Y ++ +  + FA  +                      
Sbjct: 127 WNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPN-------------------- 166

Query: 166 EKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
                   L++D G +   + PVI G+   K+ +     GRFL+ LL + L  R 
Sbjct: 167 -------SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL + +  S+      LR  L  N+V TGG  ++P  + RL +EL + LP+  +   T+ 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            T E +   W   +   S  ++ +  V ++EY E G + L  +RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 83/225 (36%), Gaps = 49/225 (21%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAI----NAFAIDKYHTTYLSNQIKNIKDITSVTF 57
           E S + ID GSY    G +    P   +      +  D+ +    S Q   I        
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIGIP------- 65

Query: 58  RRPHEL------GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPEL 111
           R+ +EL      G +  W+     W +AL N        LN   G   + +E      E 
Sbjct: 66  RKDYELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTEN 120

Query: 112 SKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYND 171
            K   +V+ E  +F++ Y +  +  + FA  +                            
Sbjct: 121 RKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPN-------------------------- 154

Query: 172 YQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETL 216
             LV+D G +   + P++ G+   K+ ++  I G+F++ L+K+ L
Sbjct: 155 -CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 42/228 (18%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDIT--SVTFRR 59
           E + I ID GSY    G +    P   I + +  +Y  T      K  K  +  S+   R
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPESIIPS-SYGQYKDTAKEENQKKTKVFSEQSIGLAR 69

Query: 60  PH-------ELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112
           P        E G++  W+     WD+ L N        L    G  ++ +E      E  
Sbjct: 70  PDYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENR 124

Query: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172
           K   +V+ E  +F++ Y S ++  + FA  +                             
Sbjct: 125 KKSLEVLLEGMDFEACYLSPVSTCVSFAAGRPN--------------------------- 157

Query: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
            LV+D G + T + PVI G+   K+  +  I GR+++ L++  L  R 
Sbjct: 158 CLVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 327 LRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSVPTKECELFGWKAMAQF 385
           LR  L  N+V TGG   +P    RL  EL ++LP   +   T+   +E +   W   +  
Sbjct: 426 LRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTGHLREKQYQAWLGGSIL 485

Query: 386 ASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            S  ++ +  V +EEY E G D L  +RF
Sbjct: 486 TSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL   +  S+      LR  L  N+V TGG  ++P  + RL +EL + LP+  +   T+ 
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 442

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
             +E +   W   +   S  ++ +  V ++EY E G + L  +RF
Sbjct: 443 HIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/225 (20%), Positives = 81/225 (36%), Gaps = 49/225 (21%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAI----NAFAIDKYHTTYLSNQIKNIKDITSVTF 57
           E S + ID GSY    G +    P   +         D+      S Q   I        
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKLTADENSKKMFSEQSIGIP------- 65

Query: 58  RRPHEL------GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPEL 111
           R+ +EL      G +  W+     W +AL N        L+   G   + +E      E 
Sbjct: 66  RKDYELKPIIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPALLTEPVWNSMEN 120

Query: 112 SKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYND 171
            K   +V+ E  +F++ Y +  +  + FA  +                            
Sbjct: 121 RKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPN-------------------------- 154

Query: 172 YQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETL 216
             LV+D G +   + P++ G+   K+ ++  I G+F++ L+++ L
Sbjct: 155 -CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT-DWICRTSV 369
           GL   +  S+      LR  L  N+V TGG   +P  + RL +EL + LP+  +   T+ 
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 370 PTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRF 414
            T E +   W   +   S  ++ +  V ++EY E G + L  +RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 83/222 (37%), Gaps = 43/222 (19%)

Query: 2   ESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTF-RRP 60
           E S + ID GSY    G +    P   + +     Y         KNI    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKN 114
           +EL      G +  W+     W +AL N        LN   G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQL 174
             +V+ E  +F++ Y +  +  + FA  +                              L
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPN---------------------------CL 156

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETL 216
           V+D G +   + P++ G+   K+ ++  + G+F++ L+K+ L
Sbjct: 157 VVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 109/288 (37%), Gaps = 64/288 (22%)

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETL----------------- 216
           LV+D G +   + P+I G     AV +    G FLD  + E L                 
Sbjct: 141 LVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPE 200

Query: 217 SFRHYDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKT 276
           SF++++       +++ K   L VSP+   +    ++  A  +   + +  FL    +KT
Sbjct: 201 SFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFLYKKGNKT 258

Query: 277 KPLPENTQTIKLYDELFSVPETFFHPEIAR---ILKPGLVETILESL------------- 320
             L +         E + + E  F P++A      K GL E +++++             
Sbjct: 259 LTLEQR--------ECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSG 310

Query: 321 -------------------SMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPT 361
                              +  PE +   L+ N+V TG    +P    R+ +EL  Q P 
Sbjct: 311 PAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQ 370

Query: 362 DWICRTSVP-TKECELFGWKAMAQFASTESYRKTR-VTREEYYEHGTD 407
             +   + P   + +L  W+     ++  S+     +TR+EY  +G +
Sbjct: 371 YKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 59/141 (41%), Gaps = 25/141 (17%)

Query: 278 PLPENTQTIK------LYDELFSVPETFFHPEIARILKPGLVE---TIL------ESLSM 322
           P P +++ I       L  E   VPE  F P +    + G++E   TIL      E   +
Sbjct: 595 PRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKL 654

Query: 323 VPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKEC---ELFGW 379
            P  L   +  NL  TGGN  LP    R+  E    LP      T+   K+     L  W
Sbjct: 655 SPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVG----TAFNVKQSYNPSLDAW 708

Query: 380 KAMAQFA-STESYRKTRVTRE 399
             MA+   ++E Y+ T ++++
Sbjct: 709 NGMAKLTLNSEDYKNTIISKK 729

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 90/223 (40%), Gaps = 38/223 (17%)

Query: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHT-------TYLSNQIKNIKDITSVTF 57
           PIAID GS +I+ G T+ S+P   I    + +Y         T++ N + ++        
Sbjct: 38  PIAIDFGSSQIRAGYTNQSTPSH-IFPNRLTRYRDRKINKTFTFIGNDV-SLDQAIRTQS 95

Query: 58  RRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQ 117
           + P +   +T+W+    I  Y +FN     G   ++     ++ +E   TL     N  Q
Sbjct: 96  KSPFDGSIITNWDYVEDIMQY-IFN---HLGVVGHNGVSNPILLTEKLATLQSQRSNWYQ 151

Query: 118 VVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177
           ++FE ++         + F  +    N +  +G                       LVID
Sbjct: 152 LLFECFDIPEVTLGIDSMFAFYG--LNERSSTG-----------------------LVID 186

Query: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRH 220
            G   T +IPV++G       K+++ GGR     L + L+ ++
Sbjct: 187 CGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 85/212 (40%), Gaps = 31/212 (14%)

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDE------- 226
           L++D G     + PVI G     A+ +    G FLD  + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 227 -------TILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPL 279
                     + + K   L V+P+      ++ +  A++ +  ++   FL + R KT  L
Sbjct: 154 LELWRNSRTWIQDFKSYMLQVAPSK----LQDLDSAALDMMGLSYVKNFL-YRRQKTISL 208

Query: 280 PENTQTIKLYDELFS---VPETFFHPE-----IARILKPGLVETILESLSM---VPELLR 328
            +  +   L + LF    V + F   E     +A+ +K     T   S +     PE + 
Sbjct: 209 MQK-ECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIH 267

Query: 329 PLLVGNLVCTGGNFNLPHFATRLTSELQRQLP 360
             L+ N+V TG +  +P    R+ ++L  Q P
Sbjct: 268 AALLTNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>Kwal_27.11307 s27 (741350..742789) [1440 bp, 479 aa] {ON} YLR142W
           (PUT1) - proline oxidase [contig 28] FULL
          Length = 479

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 274 DKTKPLPENTQTIKLYDELFSVPETFFHPEI--ARILKPGLVETILESLSMVPELLRPLL 331
           D TKP+   T T + + E  S  E      I  A I KP +++ +L+    VP  L  LL
Sbjct: 48  DTTKPMAVRTPTSEAHLESLSAKELISLGVIGMATINKP-MLDLVLKMFPFVPVWLMKLL 106

Query: 332 VGNLVCTGGNFNLPHFATRLTSELQRQ 358
           V +L C G NF       R T E  RQ
Sbjct: 107 VSSLYCGGDNFK----EVRETGERLRQ 129

>KLLA0D13354g Chr4 (1148444..1150567) [2124 bp, 707 aa] {ON} weakly
           similar to uniprot|P38766 Saccharomyces cerevisiae
           YHR031C RRM3 DNA helicase involved in rDNA replication
           and Ty1 transposition structurally and functionally
           related to Pif1p
          Length = 707

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 256 AVEYVLPNFQTTFLGHV-RDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVE 314
           AV+++ PN  +  L +V  +K   L E+ Q + L +    + +T  +  + R+L      
Sbjct: 462 AVDFIPPNINSNILNNVMAEKEIKLKEDAQVMMLKN----IDDTLVNGSLGRVLFFCTSA 517

Query: 315 TILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359
             LE+  + P+L  P +V ++ C      +P   +  +S+LQR +
Sbjct: 518 LFLEASKIFPDLSDPEVVQDMRCVCRAIGVP--PSGRSSDLQRDI 560

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 101 ASETCMTLPELSKNMDQVVFEEYEFDSY 128
           + E C+ LP LSK++DQV   E EFD +
Sbjct: 171 SEEICLNLPNLSKDIDQVESNENEFDHH 198

>KLLA0E09373g Chr5 complement(832187..834076) [1890 bp, 629 aa] {ON}
           similar to uniprot|Q12204 Saccharomyces cerevisiae
           YOR022C Hypothetical ORF
          Length = 629

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 4   SPIAIDNGSYEIKFGT--TDLSSPYRAINAFAIDKYHTTYLS-----NQIKNIKDITSVT 56
           +PI  D  SYEI+ G    D + P       AI++ H  +LS     ++   ++DI    
Sbjct: 85  NPIYWDGPSYEIRRGIWFDDQNRPLSHDLTKAIEELHQQWLSRDKEKSKTTELRDI---- 140

Query: 57  FRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHL 99
           FR P +           S W Y +F  D+   F L D+ G HL
Sbjct: 141 FRLPKD-----------SKWKYVMFFEDDRTAFLLPDIYGGHL 172

>NDAI0A04690 Chr1 complement(1065525..1073012) [7488 bp, 2495 aa] {ON}
            Anc_3.443 YPR117W
          Length = 2495

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 60/145 (41%), Gaps = 32/145 (22%)

Query: 278  PLPE---NTQTIKLYDE--LFSVPETFFHPEIARILKPGLVETILESLSMVPEL-LRPLL 331
            PLPE      TI+L  E  L  + E  F  E+  ILK GL+E   E L  + EL  R   
Sbjct: 887  PLPETPIKLPTIELTAEAVLIDIEEDPFEQELGLILKVGLLEQ-RERLQKLKELETRLAK 945

Query: 332  VGNLV--CTGGNF-------NLPHFATRLTS----ELQRQLPTDWICRTSVPTKECELFG 378
            + NL    + G+F       N+PH+  +  +    +L     T WI R            
Sbjct: 946  LDNLGKDSSAGHFINRRNLNNVPHYRKKFENNYLQKLLEHFSTSWIARYR---------- 995

Query: 379  WKAMAQFASTESY-RKTRVTREEYY 402
             KA   F  ++ Y RK     EEYY
Sbjct: 996  -KAKLTFQGSKCYIRKNVKLMEEYY 1019

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 56/155 (36%), Gaps = 42/155 (27%)

Query: 68  SWELESSIWDYALFN------PDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFE 121
           +WE     W+Y LFN      P+E+P                  +T+P + K +D  V E
Sbjct: 83  NWEALEQQWNY-LFNDVLRCSPEEYP----------------LVITIPSMKKEIDGEVLE 125

Query: 122 EYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGFN 181
           +Y    + +     F    +     +  GK+                     LVID G +
Sbjct: 126 KYFSLVFERFKFPVFQIILEPLAITLSLGKSS-------------------GLVIDMGSS 166

Query: 182 CTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETL 216
              + P+I G     AV     GG FLD  + ETL
Sbjct: 167 GCRVTPIIDGTVIKNAVLSSKYGGAFLDYQIIETL 201

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNI 233
           LVID   + + + P++ GV     + K   GG FLD  + +  S    D+ +E    +NI
Sbjct: 156 LVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNI 215

Query: 234 KENCLFVSPTSYFDSFK 250
                +VS  S+  +FK
Sbjct: 216 -----WVSSNSWIKNFK 227

>SAKL0F14762g Chr6 (1186204..1188396) [2193 bp, 730 aa] {ON} weakly
           similar to uniprot|Q08905 Saccharomyces cerevisiae
           YOR381W FRE3 Ferric reductase, reduces siderophore-bound
           iron prior to uptake by transporters
          Length = 730

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 261 LPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESL 320
           + NF + F  ++   T     N+  ++LY +  SVP TF       +   GL+ T LESL
Sbjct: 193 IVNFTSKFAPNLLLSTNKRFGNSSFVRLYRKHISVPATFRFSHTNNVFLGGLLPTRLESL 252

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar
           to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
           Hypothetical ORF
          Length = 1557

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 205 GRFLDGLLKETLSFRHYDVMDETILVNNIKE--NCLFVSPTSYFDSFKN 251
           G FLD L+K   +F  YD++    ++N      NC+   P  YF  F+N
Sbjct: 812 GLFLDSLVKRLPNFLSYDLLLLITILNEFAADYNCISPKPIDYFQDFEN 860

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 4/54 (7%)

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLD----GLLKETLSFRHYDV 223
           LVID G   T + P++ G      V K   GG FLD     LL+E L    ++ 
Sbjct: 148 LVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEA 201

>SAKL0F14784g Chr6 (1193821..1195950) [2130 bp, 709 aa] {ON} weakly
           similar to uniprot|Q08905 Saccharomyces cerevisiae
           YOR381W FRE3 Ferric reductase, reduces siderophore-bound
           iron prior to uptake by transporters
          Length = 709

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 261 LPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESL 320
           + NF + F  ++   T     N+  ++LY +  SVP TF       +   GL+ T LESL
Sbjct: 172 IVNFTSKFAPNLLLSTNKRFGNSSFVRLYRKHISVPATFRFSHTNNVFLGGLLPTRLESL 231

Query: 321 SMV 323
            ++
Sbjct: 232 IIL 234

>Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416W
           (REAL)
          Length = 848

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 29/57 (50%)

Query: 166 EKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYD 222
           + +Y ++   ++  +   W+   +    YY +  +LD  G  LD  L++TL+F  +D
Sbjct: 281 DNQYEEFMNQMNVMYAENWVFLTLSLAKYYISRGRLDSCGDLLDKSLRQTLNFSDFD 337

>Ecym_1099 Chr1 (206405..212959) [6555 bp, 2184 aa] {ON} similar to
            Ashbya gossypii AFR657C
          Length = 2184

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 53/129 (41%), Gaps = 24/129 (18%)

Query: 78   YALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYEFDSYYKSSIAGFI 137
            YA+FNPD      L +LKG  L        +    K++ +V  E  + +S Y +  A   
Sbjct: 944  YAVFNPDG----TLAELKGFELKRRGELQLIKNFQKDIFKVFLEGKDLESCYFAVAAVAN 999

Query: 138  QFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQ--------------------LVID 177
            ++ D  + K    +TE+ I L   N+   K+  +Y+                    +V D
Sbjct: 1000 RWLDVLDLKGAMLETEDLIDLICENKSMSKKLKEYEGQKSTSITTARRLGEFLGEDMVKD 1059

Query: 178  SGFNCTWII 186
            +G  C +II
Sbjct: 1060 AGLQCKFII 1068

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 85/219 (38%), Gaps = 41/219 (18%)

Query: 174 LVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNI 233
           LV+D G   + + P+I G     AV +    G FLD  + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 234 KENCLFV--SPTSYFDSFK------------NKNETAVEYVLPNFQTTFLGHVRDKTKPL 279
           K+  L +  +  ++   FK            + +  A++ +   +   FL   + KT  L
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQ-KQKTISL 256

Query: 280 PENTQTIKLYDELF---SVPETFFHPEIARILKPGLVETILESLSMV------------- 323
            +  Q  +L + LF   SV + F   E       GL E + +S+                
Sbjct: 257 TQK-QCCELAEGLFQPRSVSQQFVAAE-------GLSEIVAKSVKKAGASTATSSSATNV 308

Query: 324 --PELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLP 360
             PE     L+ N++ TG +  +     R+ ++L  Q P
Sbjct: 309 TTPEQTHAALLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 321 SMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWICRTSVPTK-ECELFGW 379
           S  PE +   L+ N+V  GG   L     RL ++L  Q P   +   + P   + +L  W
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSW 372

Query: 380 KAMAQFASTESYR-KTRVTREEYYE 403
           +          ++  + VT++EY E
Sbjct: 373 QGGVNMCHLPDWKLGSWVTKQEYLE 397

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 60/139 (43%), Gaps = 12/139 (8%)

Query: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILV 230
           D   V+D G   T I  V +G+    +V  LD GG  +  L  + L   ++   D  + +
Sbjct: 390 DSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQD--LDL 447

Query: 231 NNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYD 290
           N+ +   L       + +F++ + T   Y   NF        R   KP  E  +  K++D
Sbjct: 448 NSPEGWSLMEQLKEKYATFQDADVTIQLY---NFIK------RIPNKPGAEKFE-FKVFD 497

Query: 291 ELFSVPETFFHPEIARILK 309
           E+ + P   F P I R+LK
Sbjct: 498 EVMTAPMGLFFPHILRLLK 516

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 29/143 (20%)

Query: 175 VIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGR-----FLDGLLKETLSFRHYDVMDET-- 227
           +++ G   T I  V +G     ++ KLD GG      F   LL+    F+  D +D T  
Sbjct: 498 IVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLD-LDSTHG 556

Query: 228 -ILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTI 286
             L   +K+N         + +F++ N T   Y   NF     G V +K +         
Sbjct: 557 WTLAEQLKKN---------YATFEDANMTVQLY---NFVKRIPGKVSEKYE--------F 596

Query: 287 KLYDELFSVPETFFHPEIARILK 309
           K++DE+   P   F+P+I + LK
Sbjct: 597 KVFDEVILAPLALFYPDIFQELK 619

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,237,893
Number of extensions: 2291266
Number of successful extensions: 7105
Number of sequences better than 10.0: 174
Number of HSP's gapped: 7041
Number of HSP's successfully gapped: 209
Length of query: 420
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 308
Effective length of database: 40,638,807
Effective search space: 12516752556
Effective search space used: 12516752556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)