Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B049808.256ON1204118853430.0
NDAI0B023808.256ON1219120928040.0
Smik_12.1438.256ON1220120624380.0
Suva_10.1688.256ON1220120524290.0
Skud_12.1528.256ON1220120523980.0
YLR084C (RAX2)8.256ON1220120523800.0
ZYRO0C01804g8.256ON1209120223220.0
KAFR0B026908.256ON1210120323000.0
TDEL0F038308.256ON1195119422100.0
SAKL0H17204g8.256ON1211121521520.0
Kpol_392.108.256ON1226121520240.0
TPHA0B032508.256ON1215121219110.0
KNAG0G020008.256ON1202121418280.0
TBLA0E043908.256ON1278127318120.0
KLTH0G13838g8.256ON1214120916540.0
KLLA0F18975g8.256ON1200121916080.0
Kwal_56.235898.256ON1213121215910.0
CAGL0L12144g8.256ON1156117715550.0
AGR095W8.256ON1201122414890.0
Ecym_43158.256ON1212121814600.0
NCAS0G032901.421ON268145790.81
TDEL0A057708.631ON433109800.89
NCAS0C039908.67ON73073800.96
KLLA0F07733g7.90ON37177753.4
KLLA0D07546g8.67ON64785736.7
TPHA0A018108.262ON45775737.0
TPHA0M009303.253ON34383727.9
SAKL0A09592gna 1ON686111728.9
Smik_4.6985.528ON39333719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B04980
         (1204 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...  2062   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...  1084   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   943   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   940   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   928   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   921   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   899   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   890   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   855   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   833   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   784   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   740   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   708   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   702   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   641   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   624   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   617   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   603   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   578   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   566   0.0  
NCAS0G03290 Chr7 complement(606690..607496) [807 bp, 268 aa] {ON...    35   0.81 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    35   0.89 
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    35   0.96 
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    33   3.4  
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    33   6.7  
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...    33   7.0  
TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {...    32   7.9  
SAKL0A09592g Chr1 complement(839689..841749) [2061 bp, 686 aa] {...    32   8.9  
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    32   9.3  

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score = 2062 bits (5343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1051/1188 (88%), Positives = 1051/1188 (88%)

Query: 17   YASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            YASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN
Sbjct: 17   YASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFI                        
Sbjct: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
             KQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMRNISDINLGQLIPLSAATWSSTG 256
            NSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMRNISDINLGQLIPLSAATWSSTG
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMRNISDINLGQLIPLSAATWSSTG 256

Query: 257  SFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSD 316
            SFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSD
Sbjct: 257  SFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSD 316

Query: 317  PSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWS 376
            PSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWS
Sbjct: 317  PSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWS 376

Query: 377  QDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXXXXXX 436
            QDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEP        
Sbjct: 377  QDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNSLESF 436

Query: 437  XXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNT 496
                    TWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNT
Sbjct: 437  SSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNT 496

Query: 497  CSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGT 556
            CSSRGI                   YQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGT
Sbjct: 497  CSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGT 556

Query: 557  TAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSI 616
            TAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSI
Sbjct: 557  TAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSI 616

Query: 617  NQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKS 676
            NQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKS
Sbjct: 617  NQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKS 676

Query: 677  YSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVFDNNLIFX 736
            YSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVFDNNLIF 
Sbjct: 677  YSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVFDNNLIFN 736

Query: 737  XXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNLSATSLRSI 796
                                     GDTLFSGALSQVQFTNLSGSVSIANNLSATSLRSI
Sbjct: 737  VSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSIANNLSATSLRSI 796

Query: 797  GSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSS 856
            GSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSS
Sbjct: 797  GSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSS 856

Query: 857  SSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSISNTECFGLCLY 916
            SSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSISNTECFGLCLY
Sbjct: 857  SSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSISNTECFGLCLY 916

Query: 917  NYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIR 976
            NYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIR
Sbjct: 917  NYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIR 976

Query: 977  WGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXXXXXXXXXXXXXNNL 1036
            WGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWV                       NNL
Sbjct: 977  WGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSSTTIDSIGWTTTTDNNL 1036

Query: 1037 KKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDR 1096
            KKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDR
Sbjct: 1037 KKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDR 1096

Query: 1097 DVSKLFDSQLALQVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALG 1156
            DVSKLFDSQLALQVSN                            IDRGFVVLIGLALALG
Sbjct: 1097 DVSKLFDSQLALQVSNTTASITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALG 1156

Query: 1157 TMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204
            TMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI
Sbjct: 1157 TMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1209 (47%), Positives = 795/1209 (65%), Gaps = 29/1209 (2%)

Query: 18   ASQLSSLQENLNITHINIPNLNLT-TDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            ASQLS+++  LN+T++NIP LNLT ++D++F+LLG ID LSFYRY GQQNFT+GI+P SN
Sbjct: 18   ASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGSN 77

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            SNGL YYSNNT IQL EPS D+ I +I PFGSDSFI                        
Sbjct: 78   SNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLTTLS 137

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
             + IFN +++ V +IL+D ++V FGGNFT+   + N HS+ +W+ T++ST  L F GFGE
Sbjct: 138  IEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGE 197

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDT-----MRNISDINLGQLIPLSAAT 251
            NS+INSI KLNDDNILFAG+FYTLD    L + N T     + N + +++GQL+PLSA+T
Sbjct: 198  NSIINSIVKLNDDNILFAGEFYTLDEPDFL-IQNTTSSQNNIFNSTTVDIGQLVPLSAST 256

Query: 252  WSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLF 311
            W +  S FD +TFVCPD T E+W Q+GT+G+L C LPF+VAPTKIRIYNSP+ DN++SLF
Sbjct: 257  WDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLF 316

Query: 312  RIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTS 371
            RI ++ ++ IMNLTYIDP+  +LKHCDAFCPLY+K +L  A  N T  S+ I LL DNT+
Sbjct: 317  RILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTT 376

Query: 372  DIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXX 431
            DI+W+Q+FQEFAF+NQ+S SS++F+AL+SYG NV LSSFQ+YQ+AYA+FAN++LNEP   
Sbjct: 377  DIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCN 436

Query: 432  XXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGC 491
                          W  G+  Q Y+ TTY P+Q  +P V+F P +KY GQYSI +YTPGC
Sbjct: 437  SIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGC 496

Query: 492  QQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSG 551
             QD+TCSSR I                   YQNN +LKYDELYSGYL+ SP++T+ Y SG
Sbjct: 497  TQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSG 556

Query: 552  IYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE---LNGLFQYQLSNFSTSSKDSSI 608
            +Y+  T  TVV DRLN++I+SL++     N TN+ E   LNGL QYQ+SNFSTSS +++ 
Sbjct: 557  LYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTD 616

Query: 609  ARVANTSINQLTLTGFSSNVSLSASLYND-TLLVGAGDDGLSIYELNKDLAIQSSSQQGI 667
             ++ NTS+NQL+L  FS N S+ A LY+D TLL+G  + G+ + +LN+++ I+SS++  +
Sbjct: 617  VKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESSNEASL 676

Query: 668  EGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNI--TSPITNFANITIDDSE 725
             G   G  SYS G+L YG++N S + + ++++NG+F+ I N    S ITN  N+TI D+E
Sbjct: 677  TGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTE 736

Query: 726  LLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIA 785
            LLV DN  I+                           DT+FSGA++ + +T+L+GS++I 
Sbjct: 737  LLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIG 796

Query: 786  NNLSATSL----RSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDS 841
            NN + T++     S  S Y  +FLNDS++ Y  K D S SE++FS+G  APW +   ++ 
Sbjct: 797  NNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTD-SYSELLFSNGYSAPWSFFEGINY 855

Query: 842  MLYLTNQSMLAVGSSS-SVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVG 900
            M+Y ++Q+MLAV SS  + N ELSILNL +F+ +ANETLN NS +  +++FE NS+++VG
Sbjct: 856  MVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGLINFEHNSTLIVG 915

Query: 901  GNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSV 960
            GNF+I  + C GLCLYNY  N+W TF N +INGTI ++++ N +QL+++G+F+ ++ SSV
Sbjct: 916  GNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSV 975

Query: 961  NLALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXX 1020
            NLA+M+L+   +  I+ G    ++ F TI D I  WN   L  Y + +W           
Sbjct: 976  NLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQSNFNSST 1035

Query: 1021 XXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSIN 1080
                           L+KRD + +++   I+ G IYD  YG IQAMIYNF+EW PY  I+
Sbjct: 1036 TIRSIEPIGFGPT--LQKRDGTGSADG-FIINGNIYDTEYGTIQAMIYNFKEWRPYYIIS 1092

Query: 1081 SLVSSANQPAELFIDRDVSKLFDSQLALQVSN-----XXXXXXXXXXXXXXXXXXXXXXX 1135
            S  +++    ++F++RD S L++SQ  LQ  N                            
Sbjct: 1093 S--TNSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQPHHQKQ 1150

Query: 1136 XXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTV 1195
                 IDRGFVVLIGLALALGT+++LGI+G++LAY F+D DG +D + PR NEDEML+TV
Sbjct: 1151 VGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETV 1210

Query: 1196 PPEKLMEFI 1204
            PPEKLM+F+
Sbjct: 1211 PPEKLMKFL 1219

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1206 (42%), Positives = 730/1206 (60%), Gaps = 24/1206 (1%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDD-NSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            ASQL +++  L+I    +PNLN++ ++ N+ ++LGG+D++SFY+YTGQQNFT GI P +N
Sbjct: 20   ASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFTKGISPGTN 79

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            S+GL YYSNNT+IQL + S D+RI++I PFG DSFI                        
Sbjct: 80   SHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTINNISVGNQILYNLSTLS 139

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
               IFNQ+L  V ++LV+ T V FGGNF+ +  S+ GHS  +W+  +++  LLPF GFGE
Sbjct: 140  MAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDTAQLLPFGGFGE 199

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL-----NVVNDTMR-NISDINLGQLIPLSAA 250
            NS +NSI KLNDDNI+FAGKFYTLD+S++L     N  N T   N + + LGQ I L  A
Sbjct: 200  NSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTFSLNATKLELGQRISLRYA 259

Query: 251  TWSSTGSF-FDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309
            +W S GS      + VCP+    AW    TSG+L CNLP++V+PTKIR+YNS D  +EI+
Sbjct: 260  SWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKIRLYNSQDAGSEIA 319

Query: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369
            LF+I ++PS SIMNLTY+DP+ G+LK+CD FCPLY++  L +AS+N + S +MI  ++ N
Sbjct: 320  LFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGN 379

Query: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNE-P 428
             +D++WS DFQ+FAF N+L  +SL+ +ALNSYG ++GLS  ++YQ+ ++ +ANNSLNE  
Sbjct: 380  NTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYG 439

Query: 429  XXXXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKYSGQYSIELY 487
                            +W  G+  ++Y+ T YIP Q   +P V F+P++ +SG Y+I  Y
Sbjct: 440  CSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTY 499

Query: 488  TPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVT 547
            TPGC QDNTCSSRGI                   YQNND LKYD+++SGYL++SP+I + 
Sbjct: 500  TPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLE 559

Query: 548  YHSGIYSGTTAGTVVVDRLNIMINSLDILN---EIHNSTNSLELNGLFQYQLSNFSTSSK 604
            Y SGIYS  TA  VV DR+N++  SLD  N   EI+N      LNG+FQYQ SNF+ ++ 
Sbjct: 560  YISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQYQKSNFTGTTS 619

Query: 605  DSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQ 664
            + +  +V NT++N   +  +  N SL   +YND L+VG   + +S  +LN++  I+SS  
Sbjct: 620  NKT--KVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLNENFEIKSSEN 677

Query: 665  QGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDS 724
            + I+G + G+     G+L+YGD  SS   S VL FN SF  + N +  + +  NI+I D+
Sbjct: 678  RTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVNSATNISIADN 737

Query: 725  ELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSI 784
            EL VFDNN I                           GD LFSG +S ++F+NL+GS S 
Sbjct: 738  ELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASF 797

Query: 785  ANNLSATSLRSIGS---PYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDS 841
             N     +L +IG    PY   +LN+SV+ Y  + D + +++ FS+     W W+  +  
Sbjct: 798  KNEDQVQAL-NIGRGIVPYFGAYLNESVSAYAYETD-ALNKIYFSNKVNPSWNWSNTITR 855

Query: 842  MLYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGG 901
            MLY  NQ+ML V S SS   +L+I NL +   +ANETL  N+ V  +V+FE+NSSILVGG
Sbjct: 856  MLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGG 915

Query: 902  NFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVN 961
            +F I+   C GLCLYNY    W TF N TI G +T+L + N S+LII+G+F+T+   S+ 
Sbjct: 916  DFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIR 975

Query: 962  LALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXX 1021
            L   NL +  +V +  G +  +  F+  D+++ AWN+TSLF Y +  W            
Sbjct: 976  LGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLI 1035

Query: 1022 XXXXXXXXXXXXNNLKKR-DNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSIN 1080
                        + L KR  N+    ++L++ G      YG++Q+++++F+ W PY  I+
Sbjct: 1036 GSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYF-IS 1094

Query: 1081 SLVSSANQPAELFIDRDVSKLFDSQLALQVSNXXXX--XXXXXXXXXXXXXXXXXXXXXX 1138
             + +S+N     FI+RDVS  F+SQ+ L   N                            
Sbjct: 1095 EISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEK 1154

Query: 1139 XXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPE 1198
              IDRGFVVLIGLALALGT++VLGIVGVILAY F+D +GDY  I PR++E+EML TVPPE
Sbjct: 1155 KKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPE 1214

Query: 1199 KLMEFI 1204
            KLM+F+
Sbjct: 1215 KLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1205 (42%), Positives = 734/1205 (60%), Gaps = 22/1205 (1%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTD-DNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            ASQL S++  L+I    +P+LN++ D DN+ ++LGG+D+LSFY YTGQQNFT  I   +N
Sbjct: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            S GL YYSNNT+I L E   D+RI++I PFG+DSFI                        
Sbjct: 80   SRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLS 139

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
              +IF Q+L SV ++LV+ T V FGGNF+ +  S+ GH   +W+ T+N+T LLPF GFGE
Sbjct: 140  MARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGE 199

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMR------NISDINLGQLIPLSAA 250
            +S +NSI KLNDDNILFAGKFYTLD+S++L   +          N + + LGQ IPL  A
Sbjct: 200  DSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTLNATTLELGQRIPLRYA 259

Query: 251  TWSSTGSF-FDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309
            +W S GS  F+    VCPD + +AW   GTSG+L C LP++VAPTKIR+YNSP+ DN+IS
Sbjct: 260  SWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDIS 319

Query: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369
            LF+I ++PS SIMNLTY+DP+ G+L+ CD FCPLY++  L SAS+NV+ S +MI  +++N
Sbjct: 320  LFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNN 379

Query: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNE-P 428
             +D++WS DFQ+FAF N+LS +SL+F ALNSYG  VGLS  ++YQD ++ +ANNSLNE  
Sbjct: 380  NTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYG 439

Query: 429  XXXXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQ-GVLPEVTFHPDLKYSGQYSIELY 487
                             W  G+  Q+Y+   Y+P+Q    P VTF+P + + G Y+I  Y
Sbjct: 440  CSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTY 499

Query: 488  TPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVT 547
            TPGC QDNTCSSRGI                   YQNN+ LKYD++YSGYL++SP+I + 
Sbjct: 500  TPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMK 559

Query: 548  YHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTN---SLELNGLFQYQLSNFSTSSK 604
            Y SGIY+  TA  +V D++NI+ +SLD  + +  +T+      LNG+ QYQ SNF+ ++ 
Sbjct: 560  YVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTS 619

Query: 605  DSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQ 664
            + +  ++ANT++N  ++  +  N S+ A +Y+  L++G  D+ +S+ + N +L + SS  
Sbjct: 620  NGT--KIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSEN 677

Query: 665  QGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDS 724
            + I+G + G+   + G+L++GD  SS   S VL FNGSF+S+ N +  + N  NIT+ ++
Sbjct: 678  KTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLANN 737

Query: 725  ELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSI 784
            +L+VF+N+ IF                           D LFSGA+SQ+QF++LSGS   
Sbjct: 738  DLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSARF 797

Query: 785  ANN--LSATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSM 842
             N   + A +L     PY   +LN+S   Y  K + S S++ FS+     W W+  +  M
Sbjct: 798  LNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTN-SLSKIYFSNNVSPSWNWSNNITKM 856

Query: 843  LYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGN 902
            +Y  NQ++L +GS SS   ELSILNL +F  +ANETL  N+ +   V+FE+NSS+LVGG+
Sbjct: 857  VYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGD 916

Query: 903  FSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNL 962
            F +S   C GLC+YNY    W TF N TI G IT+L   N+S+LII+G+F T+ Q S+ L
Sbjct: 917  FQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRL 976

Query: 963  ALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXX 1022
               NLT++ +V +  G    +  F   +++I AWN+TSL  Y    W             
Sbjct: 977  GSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVS 1036

Query: 1023 XXXXXXXXXXXNNLKKRDNSETSN-NVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINS 1081
                         L+KR  ++    ++L++ G      YG++Q ++++ + W PY +  +
Sbjct: 1037 SVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSET 1096

Query: 1082 LVSSANQPAELFIDRDVSKLFDSQLALQVSNXXXXXXXXXXXXXXXXXXXXX--XXXXXX 1139
            L +S+  P  +FI+RDVS  F+SQ+ L  SN                             
Sbjct: 1097 LEASSYNPT-IFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLSPSSSASSEPNKKSKKK 1155

Query: 1140 XIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEK 1199
             +DRGFVVLIGLALALGT++VLGIVGVILAY F+D +GDY  I PR++E+EML TVPPEK
Sbjct: 1156 NMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEK 1215

Query: 1200 LMEFI 1204
            LM+F+
Sbjct: 1216 LMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1205 (42%), Positives = 728/1205 (60%), Gaps = 22/1205 (1%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDD-NSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            ASQL +++  L+I    +PNLN++ D+ N+ ++LGG+D+LS Y YTGQQNFT  I P +N
Sbjct: 20   ASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTN 79

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            S GL YYSNNT+IQ+ + S D+RI++I PFG+DSFI                        
Sbjct: 80   SRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLS 139

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
               IF+Q L SV S+L++GT V FGGNF+ +  S+ GHS  +W+  +N T LLPF GFGE
Sbjct: 140  MAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGE 199

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL------NVVNDT-MRNISDINLGQLIPLSA 249
            NS +NSI KLNDDNILFAGKFYTLD+S+ L      N  N T + N + + LGQ IPL  
Sbjct: 200  NSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNSTSLLNATKLELGQRIPLRY 259

Query: 250  ATWSSTGSF-FDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEI 308
            ATW   GS  F+  + VCP+   +AW    TSGTL C LP++V+PTK+R+YNS D D EI
Sbjct: 260  ATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDGEI 319

Query: 309  SLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLND 368
            S+F+I ++PS SIMNLTY+DP+ G+LK+CD FCPLY++  L SAS+NV+   +MI  L++
Sbjct: 320  SVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDN 379

Query: 369  NTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNE- 427
            N +D++WS DFQ+FAF N+L  + L+F A+NSYG +VGLS  ++YQD ++ +ANNSLNE 
Sbjct: 380  NNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEY 439

Query: 428  PXXXXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKYSGQYSIEL 486
                             +W  G+  ++Y+ T Y+P+Q    P V F+P++ + G Y I  
Sbjct: 440  GCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYIINT 499

Query: 487  YTPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITV 546
            YTPGC QD+TCSSRGI                   YQNND LKYD++YSGYL++SP+I +
Sbjct: 500  YTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEIIL 559

Query: 547  TYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE---LNGLFQYQLSNFSTSS 603
             Y SGI++  TA  VV D++N++   LD  + +  S N+ E   LNG+ QYQ SNF++++
Sbjct: 560  EYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTSTT 619

Query: 604  KDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSS 663
             + +  ++ NT++N   +  + +N SL A    D L++G  ++ +SI  LN +L +  S 
Sbjct: 620  SNET--KIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLNDNLEVVLSE 677

Query: 664  QQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDD 723
            +Q I+G + G+   S G+L++GD  SS   S+VL FNGSF+++ N +  + +  NI++ +
Sbjct: 678  KQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVFNYSRTVNSAINISLAN 737

Query: 724  SELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVS 783
            ++L+VFDN+ I                            D LFSGA+S++QF  L+GS  
Sbjct: 738  NDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSAR 797

Query: 784  I--ANNLSATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDS 841
                + + A +L +   PY A +LN+S T Y  + +   +++ FS+     W W+  +  
Sbjct: 798  FLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETN-LLNKIYFSNNVDPSWNWSTSITR 856

Query: 842  MLYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGG 901
            MLY  NQS+L VGS SS   ELSI NL +F ++ANET+  N+ +  +V+FE+NSS+LVGG
Sbjct: 857  MLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGG 916

Query: 902  NFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVN 961
            NF +S   C GLCLYNY    W TF N T  G IT+L     SQL+I+G+FDT+   SV 
Sbjct: 917  NFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVR 976

Query: 962  LALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXX 1021
            LA  NLT++ ++ +  G +  +  F+  +++I AWN+TSL  Y    W            
Sbjct: 977  LASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSSI 1036

Query: 1022 XXXXXXXXXXXXNNLKKRDNSETSNN-VLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSIN 1080
                          L +R  +   N  +L++ G      YG++Q ++++FE W PY  ++
Sbjct: 1037 GSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYF-VS 1095

Query: 1081 SLVSSANQPAELFIDRDVSKLFDSQLALQVSNXXXX-XXXXXXXXXXXXXXXXXXXXXXX 1139
               +++N+   +FI+RDVS  F+SQ+ L   N                            
Sbjct: 1096 ESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSKK 1155

Query: 1140 XIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEK 1199
             IDRGFVVLIGLALALGT++VLGI GVILAY F+D +GDY  I PR++E+EML TVPPEK
Sbjct: 1156 RIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEK 1215

Query: 1200 LMEFI 1204
            LM+F+
Sbjct: 1216 LMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1205 (41%), Positives = 736/1205 (61%), Gaps = 22/1205 (1%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDD-NSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            ASQL +++  L+I    +PNLN++ ++ N+ ++LGG+D+LSFY YTGQQNFT  I P ++
Sbjct: 20   ASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETS 79

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            S+GL YYSNNT+IQL + S D+RI++I PFG DSFI                        
Sbjct: 80   SHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLS 139

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
               IFNQ+L +V ++L D + + FGGNF+ +  S+ G+S  +W+  +N+T LLPF GFGE
Sbjct: 140  MTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGE 199

Query: 197  NSLINSITKLNDDNILFAGKFYTLDN-STLLNVVNDTMRNISDIN-----LGQLIPLSAA 250
            NS +NSI KLN+DNILFAG+FYTLD+ S L++  N+   + S +N     LGQ IPL  A
Sbjct: 200  NSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTLELGQRIPLRYA 259

Query: 251  TWSSTGSF-FDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309
            +W S GS  F  ++ VCP+   +AW    TSG+L CNLP++V+PTKIR+YNS   D+EIS
Sbjct: 260  SWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEIS 319

Query: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369
            +F+I +DPS SIMNLTY+DP+ G+LK+C  FCPLY++  L SAS+NV+ S +MI  +++N
Sbjct: 320  VFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNN 379

Query: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNE-P 428
             +D++W+ DFQ+FAFVN+L  SSL+F+ALNSYG +VGLS  ++YQD ++ +AN+SLNE  
Sbjct: 380  KTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYG 439

Query: 429  XXXXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKYSGQYSIELY 487
                             W  G+  ++Y+   Y+P Q   +P V F+P++ + G Y+I +Y
Sbjct: 440  CSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMY 499

Query: 488  TPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVT 547
            TPGC QDNTCS+RGI                   YQNND LKYD++YSGYL++SP+I + 
Sbjct: 500  TPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLE 559

Query: 548  YHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE---LNGLFQYQLSNFSTSSK 604
            Y SGIY+  TA  VV D++N++  SLD  N + +S+N+ +   LNG+ QYQ SNF+++  
Sbjct: 560  YVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTSTRL 619

Query: 605  DSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQ 664
            + +  +V NT++N   +  +  N SL A +Y++ L++G   + +SI +LN D  + SS  
Sbjct: 620  NET--KVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKN 677

Query: 665  QGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDS 724
            Q I+G + G+   + G+L++GD  SS   S V  FNGSF+++ N +  + +  NI++ ++
Sbjct: 678  QTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVNSALNISLANN 737

Query: 725  ELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSI 784
            + +V DN+ +                           GD LFSGA+S +Q+ NL+GSV  
Sbjct: 738  DFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRF 797

Query: 785  ANNLSATSLRSIGS--PYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSM 842
             N      L   G   PY   +LN+S T Y  + D S +++ FS+     W W+  +  M
Sbjct: 798  LNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVD-SLNKIYFSNEVYPSWNWSSGITQM 856

Query: 843  LYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGN 902
            LY  NQ++LAV + SS   ELSI +L +  ++ANETL  N+ +  +V+FE+N S+LVGG+
Sbjct: 857  LYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGD 916

Query: 903  FSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNL 962
            F ++   C GLCLYNY    W TFLN TI G IT+L   N S+LII+G+F+TK   S+ L
Sbjct: 917  FQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRL 976

Query: 963  ALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXX 1022
               NLT++ ++ +  G +  +  F   +D+I AWN+TSLF Y +  W             
Sbjct: 977  GSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSIS 1036

Query: 1023 XXXXXXXXXXXNNLKKRD-NSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINS 1081
                       N L KR  N+  + ++L++ G    + YG++Q+++++F++W PY  I+ 
Sbjct: 1037 SVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYF-ISE 1095

Query: 1082 LVSSANQPAELFIDRDVSKLFDSQLALQVSNXXXX--XXXXXXXXXXXXXXXXXXXXXXX 1139
              +++N    +FI+RDVS  F+SQ  L   N                             
Sbjct: 1096 TTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKSKKK 1155

Query: 1140 XIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEK 1199
             I RGFVVLIGLALALGT++VLGI GVILAY F+D +GDY  I PR++E+EML TVPPEK
Sbjct: 1156 KIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEK 1215

Query: 1200 LMEFI 1204
            LM+F+
Sbjct: 1216 LMKFV 1220

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1202 (41%), Positives = 712/1202 (59%), Gaps = 25/1202 (2%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDN-SFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
             SQLS LQ+ LN ++I +P L+LT+  N + ELLG    L+FY+YTGQ+NFTS +  +++
Sbjct: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            S+GL YYSN+TF+QL   S D+ I++I+P G DSFI                        
Sbjct: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
             K IF + L  VNSILVD  +V FGGNFT S  S  GHSV LWN   NSTSLLPF+GFG+
Sbjct: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLLN------VVNDTMRNISDINLGQLIPLSAA 250
            NS +NSI +L+ DNILFAG FY LD+  LL         + +  N +D+ LG  IPL  A
Sbjct: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNA 257

Query: 251  TWSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISL 310
             W+S+ S FD + F+CPDP  E+W Q+GTSG+L C+LP +  P KIRIYNSP  DNE+SL
Sbjct: 258  NWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSL 317

Query: 311  FRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNT 370
            FRI ++P++ I+NL+Y+DP  G+L++CDAFCPLY +Q L+ AS N +    M    ++NT
Sbjct: 318  FRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNNT 377

Query: 371  SDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXX 430
            +DI+W +DFQEFAFVN +  SS+ F+AL+SYG+NVGLSS+Q +Q   +I+ANNSLN+P  
Sbjct: 378  TDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPAC 437

Query: 431  XXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPG 490
                           W +G++ Q Y+ T+Y+  QG +P VTFHP ++Y G YSI+LYTPG
Sbjct: 438  GKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTPG 497

Query: 491  CQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHS 550
            C  D TC+ R I                   Y+NN++LKYDEL+ G+L  SPK+T+ YHS
Sbjct: 498  CLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYHS 557

Query: 551  GIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIAR 610
             IY       VV D +++   S D           + LNG+FQYQ+SNF   +K+ +   
Sbjct: 558  PIYPNNPTSVVVADYISLEAKSFD---HFEKHKKDITLNGIFQYQISNF---TKNITKES 611

Query: 611  VANTSINQLTLTGFSSNVSLSASLY-NDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEG 669
            + NTS++   L+ FS+N SL ASLY NDTLL+       +  +L+K+ ++ SS    +  
Sbjct: 612  IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLAS 671

Query: 670  KITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVF 729
            ++ G+ SYS+G++++GD+NSS+     LSFNGSF+S   I   +  F NI +  +ELLVF
Sbjct: 672  QVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTELLVF 731

Query: 730  DNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNLS 789
            DN   +                          GD +FSGA+S   + NL G VS+  N S
Sbjct: 732  DNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGS 791

Query: 790  ATS--LRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTN 847
            A S  ++   +PY   +LND++T Y  K D S S ++FS+G + PWRWT  +++M+Y   
Sbjct: 792  AVSSNIKDNINPYMGAYLNDTLTAYAYK-DGSDSRIVFSNGDEGPWRWTNSIETMIYRNR 850

Query: 848  QSMLAVGS-SSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSIS 906
             ++LA+G+ SS    +LS+LNL + +VLANETL++ + V +M+ F +NS++L+GGNFS S
Sbjct: 851  DALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFS 910

Query: 907  NTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMN 966
            +  C GLCLYNY   +W TF N +I G +T++Q+ N S+L+IAG       S VNL  +N
Sbjct: 911  DAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVN 970

Query: 967  LTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXXXXXX 1026
            +T   +  +  G++ P++ F+  +D +  WN+TSL  Y + SW                 
Sbjct: 971  ITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSW-RHISTSNSTSFTKLQD 1029

Query: 1027 XXXXXXXNNLKKRDNSETSNNV--LIVKGQIYDNVYG-HIQAMIYNFEEWIPYLSINSLV 1083
                   ++L+KR NS +++N+  L+V G   D   G   QA IY++  W P    NS  
Sbjct: 1030 IHQVSLEHSLEKRANSSSNSNLDGLLVYGN--DKTQGDSYQASIYDYYSWTPLFIANSKS 1087

Query: 1084 SSANQPAELFIDRDVSKLFDS-QLALQVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXID 1142
             ++N    +F+++DVS  F S Q+    +N                            +D
Sbjct: 1088 ENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVD 1147

Query: 1143 RGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLME 1202
            RG+VVLIGLALA+GT+ V+G+ G+++AY F +D G Y+ ++P     +  +T PP K  +
Sbjct: 1148 RGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSK 1207

Query: 1203 FI 1204
            F+
Sbjct: 1208 FL 1209

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1203 (44%), Positives = 733/1203 (60%), Gaps = 28/1203 (2%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTD-DNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
            ASQLS L+ +L I     P L  +++ D+S +LLG  D+LS Y YTGQQNF+  I P++N
Sbjct: 20   ASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTN 79

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
            SNGL YYSNNT IQL +   D+RI  I+P GSDSFI                        
Sbjct: 80   SNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLS 139

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
               IFN TL+ V SILVD  +V FGGNFT S  + +GHSVA+WN T+NST LLPF+GFGE
Sbjct: 140  VYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGE 199

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL--NVVNDTMRNISDINLGQLIPLSAATWSS 254
            NS IN+I +LNDDNILFAG+FYTLD+++LL  N  N T  NI D+ L  L+PL+ ATWSS
Sbjct: 200  NSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNATT-NIYDLELSPLLPLNEATWSS 258

Query: 255  TGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIF 314
              S FD  +F+C +P  +AWF +GT+GTL C+LP+D A TKIRIYNSPD  N+IS FR+ 
Sbjct: 259  DVSDFDASSFICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLI 318

Query: 315  SDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIR 374
            SDPS SIMN+TYIDP  G L+HCD++CPL ++  L SAS+     SEM  LL+DN + I+
Sbjct: 319  SDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASD-AASVSEMARLLSDNATVIK 377

Query: 375  WSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXXXX 434
            WS ++QEF FVN +S + L+FLALNSYG+NV L+ + +YQD YA+FANNSLN        
Sbjct: 378  WSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNN 437

Query: 435  XXXXXXXXXXT-WTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQ 493
                        W  G   Q YV T Y      +P+VTF+ +L YSG Y I LYTPGC  
Sbjct: 438  SDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSD 497

Query: 494  DNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSGIY 553
            D TCS+RG+                   YQNN+ LKYDEL+SGYL  S +I + Y SGI 
Sbjct: 498  DGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGIS 557

Query: 554  SGTTAGTVVVDRLNIMINSLDILNEIHNSTN--SLELNGLFQYQLSNFSTSSKDSSIARV 611
            S +T  TVV DR NI + SLDIL +I +S N  ++ LNGLFQYQLSN  +S+ +SS A+V
Sbjct: 558  SDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLSN-FSSTFNSSSAKV 616

Query: 612  ANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKI 671
              T +NQ  L  F++N SL AS Y++ LLVG  +  +   E + DL   +S   G+EG+ 
Sbjct: 617  GKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQF 676

Query: 672  TGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSI---GNITSPITNFANITIDDSELLV 728
              ++ +S G+ +YG+FN S  +   +++NGSF+     GN  S I  F N+T  +SE+LV
Sbjct: 677  KNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGN--SSIDTFKNVTFGNSEILV 734

Query: 729  FDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSI-ANN 787
            F+N  ++                          GD LF+GA SQ+ ++  + S++I ANN
Sbjct: 735  FNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESINIGANN 794

Query: 788  L-SATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLT 846
            +    +      PY  +++N S   Y  ++D +T  + F++GS+  W+W   V + +Y  
Sbjct: 795  IVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNT-RVYFTNGSQPSWQWPNDVVAAIYSD 853

Query: 847  NQSMLAVGSSSSVNGE--LSILNLDSFKVLANETLNQNSSVKT-MVHFERNSSILVGGNF 903
            NQS+L  G+SSS+     L++LN  ++ V+ANE+L+   S  + +V+F  N++ ++GGNF
Sbjct: 854  NQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGNF 913

Query: 904  SISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLA 963
            S+ N  CFGLCL+NY  + W +F + +INGT+  +Q+FN+S+LI++G+F TK+ SS+ +A
Sbjct: 914  SMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMA 973

Query: 964  LMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXXX 1023
             +NL +NK+  ++ G     K F   D  I AWN T+L  Y  N W              
Sbjct: 974  SLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWT-VERISNINSSSV 1032

Query: 1024 XXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLV 1083
                      + L KRD S  S++ ++V GQ+YDN YGHIQAM+Y+F  W+PYL IN   
Sbjct: 1033 VDNLNYVTLASALSKRDTS--SSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLIN--- 1087

Query: 1084 SSANQPAELFIDRDVSKLFDSQLAL--QVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 1141
            S ++     FIDRD+S   ++Q+AL                                  I
Sbjct: 1088 SESDSSINAFIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKTHKRKI 1147

Query: 1142 DRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLM 1201
            DRGFVVL+GLALALGT+ VLGI GVI+AY FRDD+G Y+ I PR++E+EM++TVPPEKLM
Sbjct: 1148 DRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLM 1207

Query: 1202 EFI 1204
            ++I
Sbjct: 1208 KYI 1210

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1194 (40%), Positives = 693/1194 (58%), Gaps = 22/1194 (1%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNS 77
            ASQL +L+    I +I  P L+   +  + +L GG ++L+F +Y GQ+NFT  I  N++S
Sbjct: 17   ASQLENLKNKHGIVNIGTPRLDFPGE--ALQLFGGFNALTFPQYEGQENFTGTINNNTDS 74

Query: 78   NGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXXX 137
             G+ YYSN+TFI+L   S DS +E+I+PFGS+SFI                         
Sbjct: 75   RGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSDLSL 134

Query: 138  KQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGEN 197
            + IF  +L  V  IL D  V  FGGNF+    S  GHSVA WN ++N+TSLLPF GFGE 
Sbjct: 135  RPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGFGEE 194

Query: 198  SLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMR--NISDINLGQLIPLSAATWSST 255
            S++NSI KL+ DNILF G+FYTLD+ TLL    +T +  +   I + +L+PL AATW++ 
Sbjct: 195  SIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINELLPLRAATWNTD 254

Query: 256  GSFFDEE-TFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIF 314
                 +   F+CP+   EAW    TSG+L  +LP++  P K+RIYNSP+  N +SLFRI 
Sbjct: 255  SDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRII 314

Query: 315  SDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIR 374
            + PS  IMNLTY+DP+ G+L +CDAFCPL  +  LK+A  N   S   +  L++N +DI+
Sbjct: 315  TKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS--QVVRLDNNLTDIQ 372

Query: 375  WSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXXXX 434
            WS D+Q+FAFVN+++ + L+FLAL+SYG  VGLSSFQ+YQD    +ANNSLNE       
Sbjct: 373  WSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCESND 432

Query: 435  XXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQD 494
                       W +G+  Q+Y+   +   Q  LP+VTF+P + Y+GQY++ LYTPGC  D
Sbjct: 433  IASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSD 492

Query: 495  NTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYS 554
             TC+SR I                   +QNN+ +KYD++YSG+L  +P +T+ Y+S I  
Sbjct: 493  QTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISP 552

Query: 555  GTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANT 614
               +  VV DRL +++ S+DIL    + T  + LNG+FQYQLSNF T+S DS    +ANT
Sbjct: 553  NNPSNVVVADRLEVIVESVDILKNQTDET--IPLNGMFQYQLSNF-TNSTDSK-PSIANT 608

Query: 615  SINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGL 674
            ++N  T+  F  N SL +S+YN+TL VG    G++  EL++DL + S+++    G + G+
Sbjct: 609  TLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTAKYATGGTVEGI 668

Query: 675  KSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVFDNNLI 734
             SYS+G++++G FN S +  + L+FNG F S GN+ + +  + N++    ELLVF+N  +
Sbjct: 669  SSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDELLVFNNEYV 728

Query: 735  FXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNLSAT--S 792
            F                           DTLFSGA+++ QF  L GS SI +N S    S
Sbjct: 729  FNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFS 788

Query: 793  LRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLA 852
            L++   PYAA  LNDSVT Y  +   S S++ F +G + PW W G ++SM Y  N ++LA
Sbjct: 789  LQNGAQPYAACHLNDSVTAYAYRY-GSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILA 847

Query: 853  VGSSSSVNGE-LSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSISNTECF 911
            +G+  S +   LS+ NL SF VLAN T+++N ++ +MV F+RNSS+LVGG++ IS+ +C 
Sbjct: 848  IGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCS 907

Query: 912  GLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNK 971
            GLCLYNY   QW  F N +I G IT++Q+     L+I+G  +  +++SVNL   N+++ +
Sbjct: 908  GLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYE 967

Query: 972  LVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXXXXXXXXXXX 1031
            +  + W    P+K FI  D++I  WNETSL  Y+   W                      
Sbjct: 968  VNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVDVIAVKTE 1027

Query: 1032 XXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAE 1091
                L KR    ++ + ++V GQ Y     + QA IYNF+ W+PY   N           
Sbjct: 1028 PA--LDKRQTFSSTFDAILVAGQNYAE---YPQASIYNFQRWLPYYVANKADDEDPSRTT 1082

Query: 1092 LFIDRDVSKLFDSQ-LALQVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIG 1150
             F ++D S+L+DSQ L    +                             I+RGFVVLIG
Sbjct: 1083 FFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVLIG 1142

Query: 1151 LALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204
            LALALGT+ ++GI GV+LA  F    G Y+ + PR +E EM+ TVPPEKL++F+
Sbjct: 1143 LALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVPPEKLLKFL 1195

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1215 (40%), Positives = 712/1215 (58%), Gaps = 51/1215 (4%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDN-SFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
             SQLSSL+E LNI  ++IP ++L++  N    LLG  + L+FYRYTGQ+NFT  I     
Sbjct: 20   GSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSITETEK 79

Query: 77   SNGLTYYSNNTFIQL---YEPSLDSRIERIIPFGSDSFIXXXXXXX-XXXXXXXXXXXXX 132
               L YYSN TFI+L    + +  + I  IIPFG DSFI                     
Sbjct: 80   D--LIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNL 137

Query: 133  XXXXXKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFV 192
                   IFNQ++ +VN IL D  +V FGG F  +  +  GHSV LWN T N   LLPF 
Sbjct: 138  SSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFK 197

Query: 193  GFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVV--NDTMRNISDINLGQLIPLSAA 250
            GFG +S++NSI +L++DNI+FAGKF TLD++TLL  +  +++ +N +DI   QLIPL  A
Sbjct: 198  GFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATDIEFDQLIPLKHA 257

Query: 251  TWSSTGSFFDEETFVCPDPTIEAWFQNGTS-GTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309
             WSS GS  +  + +CP    + WFQ GT+ G    +L  D+ P+K+RIYN+ D D ++S
Sbjct: 258  GWSSQGSL-EHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDSDYQVS 316

Query: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369
            LFRI + P+  IMNLTY+DP  G+L +CDA+CPL + ++L+ A  NVT+SS+ +  + +N
Sbjct: 317  LFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNN 376

Query: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPX 429
             ++I+W+  +QEFAFVN++S  SL FLAL+SYG++VGL  F++YQ+ Y  FAN++LN+P 
Sbjct: 377  NTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPN 436

Query: 430  XXXXXX-XXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYT 488
                             WT+G  D +Y+ +TY    G LP V F+P++ Y+G Y++ + T
Sbjct: 437  CDNINSYSHAVTSSKQQWTQGSMDSSYILSTY-DGTGDLPSVNFYPNITYAGDYTLNMVT 495

Query: 489  PGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTY 548
            PGC  D +CSSRGI                   YQNN+  KYD LYSGYL  +PKIT+ +
Sbjct: 496  PGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKF 555

Query: 549  HSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSI 608
            +  I + ++   +V DR++++I+S+D  ++I   T +  LNGLFQYQ+SNF+T S DS  
Sbjct: 556  YESINTDSSTSIMVADRVDVIIDSID-QSKIGLKTINETLNGLFQYQISNFTTISNDS-- 612

Query: 609  ARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIE 668
             ++ NT+IN+ ++    SN  L A  YN+TLLV    +G+++ +LN DL I S  + G  
Sbjct: 613  LKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNIISEQRMGTG 672

Query: 669  GKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLV 728
            G   G+ +YSNG+L  GDFN S +  + LS+NG+F S GN+ + IT F NITIDDSELLV
Sbjct: 673  GPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFNNITIDDSELLV 732

Query: 729  FDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNL 788
            F+N  IF                           D +  GA+SQ Q+T L+G+V I +  
Sbjct: 733  FNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYIND-- 790

Query: 789  SATSLRSIGSP-------YAAIFLNDSVTGYVL--KNDSSTSEMIFSDGSKA---PWRWT 836
             A S+ +IG P       Y A ++NDS T Y    KND ST  ++ + G+++   P  W+
Sbjct: 791  -ANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKND-STHHVLIARGNRSEDLPVSWS 848

Query: 837  GYVDSMLYLTNQSMLAVGSSSS-VNG-ELSILNLDSFKVLANETLNQNSSVKTMVHFERN 894
              V++M+Y  + S+LAVG+++   NG  LS+ N+ + K++  E L   SSV  +V F +N
Sbjct: 849  HAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFNKN 908

Query: 895  SSILVGGNFSI--SNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVF 952
            SS+LVGG+F+I   +T C GLCLYNY  ++W  F N +I+G IT LQ FN +QL+I+G  
Sbjct: 909  SSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNL 968

Query: 953  DTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFAWNETSLFEYTSNSW 1009
             T++++ +NLA +N+  N++ ++R G    V+ F+T D   D +   ++  +  YT+  W
Sbjct: 969  YTENETGINLAKLNMASNEVTILRHG-STMVQSFVTFDHTTDELITQSDNEISYYTNGEW 1027

Query: 1010 VXXXXXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYN 1069
                                    +   KRD    SN  L+V G +  + YG + AM+Y+
Sbjct: 1028 KNLTSEDFNDSLYMGAQLIPLKQTS--SKRD---VSNRALLVNGDLKHSTYGSVSAMLYD 1082

Query: 1070 FEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNXXXXXXXXXXXXXXXXX 1129
            FE+W+PY  ++    +A + + +F+++D+S L+ +Q  LQ                    
Sbjct: 1083 FEDWMPYFIVDG--ENAGRASNIFMNKDLSSLYTTQTILQ----GSNTSTSTTSSNMPSE 1136

Query: 1130 XXXXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNED 1189
                       IDRGFVVLIGLALA+GT+ VLG  G I+AY F  + G Y+ + PRV+E 
Sbjct: 1137 TSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPLKPRVDEG 1196

Query: 1190 EMLKTVPPEKLMEFI 1204
            +M+ TVPPEKLM+F+
Sbjct: 1197 DMIDTVPPEKLMKFV 1211

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1215 (39%), Positives = 703/1215 (57%), Gaps = 35/1215 (2%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNS 77
            ASQL++++++L I  +NIP +N    +N  ++L  I+ L+FY+Y GQQNFT  I  NSN+
Sbjct: 19   ASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTGSIDTNSNT 78

Query: 78   NGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXXX 137
            +GL YYSN+T I+L E S +++I++I+P   D+FI                         
Sbjct: 79   HGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLSDLSI 138

Query: 138  KQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGEN 197
              +FN  L ++ SILVD  +V FGGNF+ ++N+   +S+  WN    +  +LPF+GFG+N
Sbjct: 139  IPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIGFGKN 198

Query: 198  SLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDT----------MRNISDINLGQLIPL 247
            S +NSI KL++DN+LF G F TLD+ +LL V N T              +++ L Q I L
Sbjct: 199  STVNSILKLDEDNLLFFGDFSTLDDKSLL-VSNITTYTQQNSTSSSSTETNLELEQQISL 257

Query: 248  SAATWSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNE 307
              A+W+S G       F+CP+   EAW   GT+G + CNL F+ + +KIRI+NSP   ++
Sbjct: 258  KYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSPYEQDQ 317

Query: 308  ISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLN 367
            I+ FRI + PS  IMNLTY+DP+  ++K+CDAFCPLY+   L+++SEN T S+     +N
Sbjct: 318  IASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSAFIN 377

Query: 368  DNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNE 427
             N ++I WS D+QEFAFVNQ+  ++L+ +AL SYG NVGLS FQ+YQ++Y+IFANNSLNE
Sbjct: 378  GNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNSLNE 437

Query: 428  PXXXX-XXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIEL 486
            P                  W +G++ Q+Y+ T Y P     P V F+P +   G Y++ +
Sbjct: 438  PACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNYTVNI 497

Query: 487  YTPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITV 546
            YTPGC  D TCS RGI                   YQNN+++KYD+L+ G+L+Y+PK+T+
Sbjct: 498  YTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTL 557

Query: 547  TYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE-----LNGLFQYQLSNFST 601
             Y+SGI    +   VV D ++++  ++++   I N T+S E     LNG+FQYQLSNF++
Sbjct: 558  EYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQLSNFTS 617

Query: 602  SSKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQS 661
            S+ +S++ +V NTS+N   ++ FSS+VSL    YN+TLL+G    G+    L+    I+S
Sbjct: 618  SNNNSTL-KVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNYTNIRS 676

Query: 662  SSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITI 721
            +      G++TG  +Y+ GV+++G+FN S    + LS+NG+FDS GN+ S I  F+N+T 
Sbjct: 677  TRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSNIATFSNLTF 736

Query: 722  DDSELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGS 781
             +SE+L F+N   F                          GDTLFSG +++ +F NL+ S
Sbjct: 737  GESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNS 796

Query: 782  VSIANNLSATS--LRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYV 839
              +  N +A S  LR+   PY  ++LNDS+T Y L + SS S ++FS+G +  W     V
Sbjct: 797  AVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAY-LYDSSSNSNILFSNGLQGNWNLPRSV 855

Query: 840  DSMLYLTNQSMLAVGSSSSVNG----ELSILNLDSFKVLANETLNQNSSVKTMVHFERNS 895
             S  Y  N++M  VGSS S NG    EL +LN  +  +L NET + NSS+ ++V F RNS
Sbjct: 856  SSAYYSDNETMF-VGSSLS-NGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNS 913

Query: 896  SILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTK 955
            S+LVGG+F+  NT C  LCL N   NQW +F N   +GTIT L+  NDS+L+I+G +  +
Sbjct: 914  SLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFSN-KFDGTITGLEFANDSRLLISGSYRFE 972

Query: 956  SQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXX 1015
            +QS ++L  ++L + +   +     + V  F   +  I AW+ ++++ Y  +SW      
Sbjct: 973  NQSGISLGYIDLNNQEFKSLLSD-SQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIP 1031

Query: 1016 XXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLI-VKGQIYDNVYGHIQAMIYNFEEWI 1074
                              N+L   + S   N+ LI V G++Y   YG +QAM Y+F+ WI
Sbjct: 1032 NTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWI 1091

Query: 1075 PYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNXXXXXXXXXXXXXXXXXXXXXX 1134
            PY       S       LF+++D+S L++SQ+ LQ  N                      
Sbjct: 1092 PYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSS 1151

Query: 1135 XXXX-----XXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNED 1189
                       I RG+VVLIGLALA+GT+ +LGI GV +AY F DD G+Y  I PR++E 
Sbjct: 1152 TSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEH 1211

Query: 1190 EMLKTVPPEKLMEFI 1204
            EML TVPPEKLM+FI
Sbjct: 1212 EMLDTVPPEKLMKFI 1226

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1212 (36%), Positives = 665/1212 (54%), Gaps = 43/1212 (3%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFT----SGILP 73
            AS LS++ + LNI    +PNLN     NS +LLG +++L FY Y GQQNFT    SGI  
Sbjct: 22   ASSLSNILKLLNIQEFELPNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGI-- 79

Query: 74   NSNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXX 133
             S++N L YYS++  IQL   S D+ I++IIP G DSF+                     
Sbjct: 80   -SSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLT 138

Query: 134  XXXXKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVG 193
                K IF+Q L ++ SILVD  +V FGG FT  T S N  SV  WN T++    LPF G
Sbjct: 139  TLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQG 198

Query: 194  FGENSLINSITKLNDDNILFAGKFYTLDNSTLL---------NVVNDTMRNISDINLGQL 244
            FG +S +NSI KLNDDNILF G F TL NS+LL         N  N T  N S I L Q 
Sbjct: 199  FGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNST-ENSSTIQLEQQ 257

Query: 245  IPLSAATWSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDP 304
            I L  ATW +  ++FD+  FVC   + EAW   G SG L  N P  V+P+KIRIYN+   
Sbjct: 258  ISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTA 317

Query: 305  DNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIE 364
            ++ +SLFRI + PS  IMNLTY+DP+ GQLK+CDAFCPL     L++AS N T  +    
Sbjct: 318  EDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRV 377

Query: 365  LLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNS 424
             +N+NT+ + WS+ +QEFAF+N +  S+L  +A +SYG+   LS  +++QD++  +ANN+
Sbjct: 378  FINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNT 437

Query: 425  LNEPXXXXXXXX--XXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQY 482
            LN+P                   W +G+D  +Y+   Y      LP V F+P+++  G +
Sbjct: 438  LNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDF 497

Query: 483  SIELYTPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSP 542
            SI++YTPGC  D TC SR I                   YQNN+++KYDE+++G L  SP
Sbjct: 498  SIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSP 557

Query: 543  KITVTYHSGIYSGTTAGTVVVDRLNIM---INSLDILNEIHNSTNSLELNGLFQYQLSNF 599
            +IT+T++S I     +  +V DR+++    IN  DIL + +  + SL+LNGLFQYQLSNF
Sbjct: 558  EITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNF 617

Query: 600  STSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAI 659
            ++ +K     +V N SI+QL L+ F S+VSL  + +N+++ +      +   +LN DL +
Sbjct: 618  TSDTK----TKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLEL 673

Query: 660  QSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNV---LSFNGSFDSIGNITSPITNF 716
            +++      G+ T +++YS G+L +G +N S  S+NV   LSFNG+F S   +   +T F
Sbjct: 674  RNTVVVDNGGETTRIENYSQGLLFFGQYNIS--STNVVDNLSFNGTFSSFSQLGDNVTTF 731

Query: 717  ANITIDDSELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFT 776
            AN T + SELL F+N+ ++                           DTL  G + + +++
Sbjct: 732  ANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYS 791

Query: 777  NLSGSVSIANNLSATSLRSIGS--PYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWR 834
            N +  + +  N S  SL    S  PYAA+FLND+   Y  K D   S++I+ +       
Sbjct: 792  NFNEPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYK-DGENSKIIYGNNMTTSLD 850

Query: 835  WTGYVDSMLYLTNQSML-AVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFER 893
            ++G ++ + +  N S+L A   +++ +  L I N+     LA+E LN    + +M+ F  
Sbjct: 851  FSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNS 910

Query: 894  NSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFD 953
            N++ILV GNF++ + +C G+CLYNY   +W  F N TI G+I ++Q++N  Q++I+G+F 
Sbjct: 911  NNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFS 970

Query: 954  TKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVXXX 1013
             ++ SS+ LA +++    + ++    K  +  FI    +I  W+  ++ EY S  W    
Sbjct: 971  AQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEIS 1030

Query: 1014 XXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEW 1073
                                 ++  ++++   + +L   G+    +YG + AM++   +W
Sbjct: 1031 FPNTTSKYIESVEAV------SIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDW 1084

Query: 1074 IPYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVS-NXXXXXXXXXXXXXXXXXXXX 1132
             PY SIN+   + +    LF +RD+S LF+S+ +L  +                      
Sbjct: 1085 KPYFSINNFQVNEDPAITLFENRDLSSLFNSKNSLPANITSAETSSRSTVSSATATTVVN 1144

Query: 1133 XXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEML 1192
                    IDRGFVVLI LALA+GT+ +LG+ GV +AY FRD+   Y+ I PR++  EML
Sbjct: 1145 KIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDEQ-KYESIKPRIDGQEML 1203

Query: 1193 KTVPPEKLMEFI 1204
             TVPPEKLM+FI
Sbjct: 1204 DTVPPEKLMKFI 1215

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1214 (36%), Positives = 659/1214 (54%), Gaps = 64/1214 (5%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNS 77
            AS L +++  LN T + +P  ++   +N F++L  I+ +SFY Y GQQNFT+     ++ 
Sbjct: 18   ASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQQNFTTDA-NVTDV 76

Query: 78   NGLTYYSNNTFIQLYEP-SLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
              L YYSN TF+ L +  + +++I+ IIP G DSFI                        
Sbjct: 77   QRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTDLS 136

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
              +IF+  L S+  + VDG +V F GNFT + N+       +W+    S +LLPF GFG 
Sbjct: 137  ITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIMWDSRDRSINLLPFHGFGP 192

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL---NVVNDTMRNISDINLGQLIPLSAATWS 253
             + INSI KLNDDNILFAG F T+ NS+LL   NV  +++RN + + L   +PL  + W 
Sbjct: 193  YANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQWK 252

Query: 254  STGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRI 313
            + G   D    +CPDP+ ++W  + T+G   C LPF + P+KIRIYNSPD D+++SLFR 
Sbjct: 253  TNGEL-DSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRF 311

Query: 314  FSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDI 373
             + P+ SIMNLTY+DP+ G +  CDAFCPLY+K VL+S  +N T  +  + ++N+N+++I
Sbjct: 312  LTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEANTVAIINNNSTNI 370

Query: 374  RWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXXX 433
            +W+ ++QEFA V+ ++A+SL F AL SYG N+GL+ FQIYQ +++ F NNS N P     
Sbjct: 371  QWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSFNTPNCNNN 430

Query: 434  XXXXXXXXXXXT-----WTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYT 488
                       +     WT   +   Y+   Y P++  +P+VT+  D+++SG+YSI ++T
Sbjct: 431  DKDSNNTFTSSSLSPNNWTSVGE---YLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFT 487

Query: 489  PGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTY 548
            PGC  DNTCS+RGI                   YQNND++KYD LYSG LN S +IT+TY
Sbjct: 488  PGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTY 547

Query: 549  HSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSI 608
            +SG+Y+  T  T+V DR+++ I S+D+ +    S   L LNGLFQYQ+SNF   + DS  
Sbjct: 548  YSGLYASNTVTTIVADRVDLNIISMDLSHRTEVS--KLALNGLFQYQISNF---TNDSIP 602

Query: 609  ARVANTSINQLTLTGFSSNVSLSA-SLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGI 667
             ++ANTS+NQ  L  F  +VSL A  L N ++L+   +  +    LN DL++Q+S++   
Sbjct: 603  MKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLIS 662

Query: 668  EGKITGLKSYSNG-VLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSEL 726
                T  + YSNG V++ G  N S    N  + N + D      S  T+ ANIT++  EL
Sbjct: 663  TENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDG-----SLATDVANITLNGDEL 717

Query: 727  LVFDNNLIFXXXXXXXXXXXXXX-XXXXXXXXXXXXGDTLFSGALSQVQF--TNLSGSVS 783
            LVF+N  I+                            DT+F G + Q Q+   N S  V+
Sbjct: 718  LVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVN 777

Query: 784  IANN--LSATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDS 841
               N  +   SL S   P   IFLND  TGY  K  + +   I +  S +   W G  ++
Sbjct: 778  ADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPET 837

Query: 842  MLYLTNQSMLAVG--SSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILV 899
            ++Y  N ++L VG  + ++ +  LS+ NL SF V+  E LN  SS+ ++++F +N ++LV
Sbjct: 838  VVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSLLYFAKNDTLLV 897

Query: 900  GGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSS 959
             G+F  SN  C  LCLYNY   QW +  N +++G++  LQ++ +  +++ G       + 
Sbjct: 898  AGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQAND 957

Query: 960  VNLALMNLTDNKLVLIRWGFKEPV--KDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXX 1017
            VN+A +NL++N +  +      PV     I  +  I AWN+T LF +  NSW        
Sbjct: 958  VNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGT 1017

Query: 1018 XXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYL 1077
                                     E +++ L++ G+   + +G I++++YNF +WIPYL
Sbjct: 1018 DSSATSISSVQFISM----------EGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYL 1067

Query: 1078 SINSLVSSANQ-PAELFIDRDVSKLFDSQLAL---------QVSNXXXXXXXXXXXXXXX 1127
                 V    Q    LF++RD+S    +Q+ L         Q                  
Sbjct: 1068 ---LYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVLTNQSFASSTSSSVSSTSTTLP 1124

Query: 1128 XXXXXXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGD-YDVITPRV 1186
                         +DRGFVVLIGLALAL T++V+G+ GV+LAY FRD+ GD Y  + PR+
Sbjct: 1125 KVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRM 1184

Query: 1187 NEDEMLKTVPPEKL 1200
            +E+ M+ T+PPEKL
Sbjct: 1185 DENAMVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1273 (35%), Positives = 691/1273 (54%), Gaps = 104/1273 (8%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDN-SFELL--GGIDSLSFYRYTGQQNFTSGILPN 74
            A+QL+ L++ L I +I  P  NL    N S +LL   G D+L+F  Y GQQNFT  I+ +
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPII-S 81

Query: 75   SNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXX 134
            S+ N L YYSN+T+I+L +    +RI+ IIP+G D+FI                      
Sbjct: 82   SSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 135  XXXKQIF-NQTLDSVNSILVDG--TVVCFGGNFT-LSTNSLNGHSVALWNYTANSTSLLP 190
                 IF N+ +  V +I  D    +V FGGNF+ L  +S   + + +W+ ++N T    
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 191  FVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVV------NDT-----MRNISDI 239
            F GFG NS+IN+I KLN +++LF+G+FYTLD+ ++L++       N+T      +N+S  
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 240  NLGQLIPLSAATWSS--TGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIR 297
             L Q IPL+   +S+  T  + ++   +CP   IEAW  +  +G+L   LPF + P+KIR
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 298  IYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVT 357
            I+NSPDPD+E++ FRI      SIM+L Y+DP+ GQLK+C  FCPLY +  LK  + N  
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 358  LSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAY 417
            L S +I LL++NT+DI+WS  +QEFAFVNQ   ++L F AL+SYG+ VGLS   ++Q   
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 418  AIFANNSLNEPXXXXXXXXXXXXXXXXT----------------WTRGMDDQNYVKTTYI 461
            A+FAN S N+P                                 W   + + +Y+  TY+
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 462  PHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXX 521
                ++P VTF+P+L Y+G Y++++ TPGC  DN+C SRGI                   
Sbjct: 502  SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLI 561

Query: 522  YQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILN---- 577
            YQ N+  K+D++++GYL+   KIT++++SG+YS T   T+V DR+N++INSLD +     
Sbjct: 562  YQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSS 621

Query: 578  ---EIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASL 634
               +I+N T    LNGLFQY   N    S ++      N++INQ   + + +NVSL A+ 
Sbjct: 622  NEIDIYNVT----LNGLFQYPEYN----SVNNLNENYTNSTINQYAYSNYPANVSLIAAA 673

Query: 635  YN-DTLLVGAGDDGLSIYELNKD---LAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSS 690
            Y+ DTLLVG   + L  +++ K+   +++Q++ +      +TG+  YS+G++ YGD   S
Sbjct: 674  YDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKD--LNSVTGIVPYSDGLIAYGDIMDS 731

Query: 691  KESSNVLSF-NGSFDSIGNITSPITNFANITIDDS-ELLVFDNNLIFXXXXXXXXXXXXX 748
              S   ++F N  F ++GN T  I +F+NI++  S E+L F+N   +             
Sbjct: 732  SGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTST 791

Query: 749  XXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNLSATSLRSIGS---PYAAIFL 805
                          D +FSG +S+ +  NL+G VSI  N     L ++G+   PY+A+FL
Sbjct: 792  FELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKEL-NLGNNIYPYSAVFL 850

Query: 806  NDSVTGYV-LKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVG--SSSSVNGE 862
            NDS T Y  ++ ++  + +I S+G +  W W   + SM +  N+S+L+VG  S   V   
Sbjct: 851  NDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPS 910

Query: 863  LSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQ 922
             SILNL S KV+ANETLN+NS + ++++F +NSS+LVGGNF+ S+ +C GLCL+NY    
Sbjct: 911  FSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKN 970

Query: 923  WYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNL-TDNKLVLIRWGFKE 981
            W TF+N T+ GT++KL++ N+S ++I+G   T   ++++LAL+NL T N  +L++     
Sbjct: 971  WSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQ---NT 1027

Query: 982  PVKDFITIDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXXXXXXXXXXXXXNN----LK 1037
             +  F    + I AWN ++LF+Y + +W                         N    L+
Sbjct: 1028 NLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILE 1087

Query: 1038 KRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYL--SINSLVSSANQPAELFID 1095
            KR   +T  N+++  GQ Y    G +QA+ Y  + WIPY   ++ + + ++N    +F +
Sbjct: 1088 KRALRDT--NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNS-INIFPN 1144

Query: 1096 RDVSKLFDSQLALQVSN------------------------XXXXXXXXXXXXXXXXXXX 1131
            +D+S    S   L+  N                                           
Sbjct: 1145 KDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPII 1204

Query: 1132 XXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEM 1191
                     I RGFVVLIGLAL+L T+ +LGI G++L++ FRD  GDY+ + PR  E EM
Sbjct: 1205 GKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEM 1264

Query: 1192 LKTVPPEKLMEFI 1204
               VPPEKLM F+
Sbjct: 1265 FDAVPPEKLMPFV 1277

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1209 (33%), Positives = 633/1209 (52%), Gaps = 36/1209 (2%)

Query: 18   ASQLSSLQENLNITHINIPNLNLT-TDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
             S L +L+  L +   +IPNL+L+ + +N  +LLG    ++  +Y+GQ+NFT G +  + 
Sbjct: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT-GEVSGNP 78

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRI---ERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXX 133
             N L YYSN TF+++Y  S  S +   + I+PF  D+FI                     
Sbjct: 79   ENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLS 138

Query: 134  XXXXKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVG 193
                ++IF Q L  VN+I  +G  V FGG+F    ++   HS+ +W+   +   +LPF G
Sbjct: 139  SLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGG 198

Query: 194  FGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVVN-DTMRNISDINLGQLIPLSAATW 252
            FG+NS +NSI  L++ NILFAG F  +DN+  LN +N     N S   LG  I L +A W
Sbjct: 199  FGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTSNTSVPELGHQISLQSAAW 258

Query: 253  SSTGSFFDEETFVCPDPTIEAWFQNG-TSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLF 311
             S G+  D+    CP      W + G T G     +P +  P+K+R++N+ D D ++SLF
Sbjct: 259  VSDGTL-DKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLF 317

Query: 312  RIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTS 371
            RI + PS  IMNLTY+DP  G+L  CDA+CPL + Q L   S   +   + ++   +N +
Sbjct: 318  RIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SYPGDQVQYF-ENRT 375

Query: 372  DIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXX 431
             ++WS+ FQ+FAFVN +  S L F+AL+SYG++VGL+  ++Y+ AY+++ANN+LN P   
Sbjct: 376  TLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCA 435

Query: 432  XXXXXXXXXXXXXT-WTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPG 490
                         + W  G  + NY+ T+ +      P V F+P + Y G Y+I++ TPG
Sbjct: 436  QGSATSNALLSNSSAWDSGSSEGNYLSTS-VQDSETNPFVIFYPSIIYPGVYTIDVLTPG 494

Query: 491  CQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHS 550
            C +D++C +RGI                   YQNND  K+D LYSG+L+   K+T+ +  
Sbjct: 495  CLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDG 554

Query: 551  GIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIAR 610
             I SGT    +V  +  I++N  D    +  +  S  +NGL  Y  SN  TSS  S +  
Sbjct: 555  AINSGTEVPVMVASK--IVVNIEDFDQSVFENNTSGFINGLLHYSTSN--TSSFLSELGS 610

Query: 611  VANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGK 670
             + T +   +++    + ++ A+++ D L++   D  ++  +L  +L+I+  + + I   
Sbjct: 611  YSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKD 670

Query: 671  ITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLVFD 730
            I+ +  YS G+++ G FN S E +    FNG+F ++    S +  F+N+T+  +E+L+FD
Sbjct: 671  ISTISEYSGGLIIVGTFNGSSEPA-ARGFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFD 729

Query: 731  NNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNLSA 790
             N+I                            DTLF G + Q  +TNL+GS  I+ N   
Sbjct: 730  KNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEE 789

Query: 791  TS--LRSIGS--PYAAIFLNDSVTGYVLKNDSSTS-----EMIFSDGSKAPWR-WTGYVD 840
             S    ++G   PY A F+++S T Y   N  +TS      ++   GS      W+G V 
Sbjct: 790  VSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVG 849

Query: 841  SMLYLTNQSMLAVGSS-SSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILV 899
            +M    N S+LA+G      + +L + N  S + LA+   +   S+ +++ F RN+S+LV
Sbjct: 850  AMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLV 909

Query: 900  GGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSS 959
            GG+F ++NT+C GLCL+NY   +W  FLN +I G I +++IFN+S L+IAG F       
Sbjct: 910  GGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDG 969

Query: 960  VNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFAWNETSLFEYTSNSWVXXXXXX 1016
            V+LA + L D+   ++  G    +  F+++D   +N+ A+++TSL +  S  W       
Sbjct: 970  VSLASICLKDSSSEILHEG-NITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNF 1028

Query: 1017 XXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPY 1076
                                +KRD   +S+ VL++ G +    +G I A  Y+  EW P+
Sbjct: 1029 TENSKFKGLDVFPLKDTTRKQKRD---SSSKVLLITGSLQHAKFGSINAAFYDSGEWTPF 1085

Query: 1077 LSINSLVSSAN-QPAELFIDRDVSKLFDSQLALQVSNXXXXXXXXXXXXXXXXXXXXXXX 1135
            LS N   SS++ + + +F++RD+S   D +  LQ +                        
Sbjct: 1086 LSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSPSNLQ 1145

Query: 1136 XXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTV 1195
                 IDRGF+VLI LALALGT+ VLG++GVI +Y F D    Y +  PR +E+EM+ TV
Sbjct: 1146 RKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENEMIDTV 1205

Query: 1196 PPEKLMEFI 1204
            PPEKLM FI
Sbjct: 1206 PPEKLMRFI 1214

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1219 (32%), Positives = 639/1219 (52%), Gaps = 70/1219 (5%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNS 77
             SQLS++++ LNI+    PN     D      +   + L+   YTGQQNFT      +N 
Sbjct: 20   GSQLSNIEKLLNISRYEAPNW----DSPDLTYMNNFEELTVISYTGQQNFTV----QANE 71

Query: 78   NGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXXX 137
            + L YYSN+TF++L+E S ++ +  I+P   DSFI                         
Sbjct: 72   SSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILLNLTSLTT 131

Query: 138  KQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGEN 197
              IF   +++V  IL     V F GNF++S ++  GH   LW+  AN+T L PF GFGEN
Sbjct: 132  SPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFPFKGFGEN 191

Query: 198  SLINSITKLNDDNILFAGKFYTLDNSTLL----NVVNDTMRNISDINLGQLIPLSAATWS 253
            S++NS+ KLN DNILFAG F  + N++LL    N  N +  +++ +   Q +PL  +  S
Sbjct: 192  SIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFDQSVPLKLS--S 249

Query: 254  STGSFFDEETFVCPDPTIEAW-FQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFR 312
             TG     +  +CP      W        TL  +L  ++ P+K+RIYNS + ++EISLFR
Sbjct: 250  ITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVEENSEISLFR 309

Query: 313  IFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSD 372
            I + PS  IMNLTY+DP  G+LK CDA+CPL + + L   S+N T + + +  +N+N+++
Sbjct: 310  IITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVG-INNNSTN 368

Query: 373  IRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXX 432
            ++WS+ +QEFAFVN +  + L+F+AL SYG+N  L S +I++  + ++ANNS NEP    
Sbjct: 369  LKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYNEPNCES 428

Query: 433  XXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQ 492
                         W    +   Y+ T    +   +P VTFHP++ Y G+Y+  +YTPGC 
Sbjct: 429  VTEYSKAELSSDNWYTTDESDTYISTNIDDN---IPYVTFHPNITYPGRYTFNIYTPGCL 485

Query: 493  QDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSGI 552
            QDN+CS RGI                   YQ N++ K+D LY+G L  +P+I VT+   I
Sbjct: 486  QDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVTWDKAI 545

Query: 553  YSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVA 612
              G +   +VVDRL ++   +D ++   N T +  LNGLFQY  +N + S          
Sbjct: 546  --GESDSVMVVDRLGVITEYIDTISISSNDT-TFHLNGLFQYNTANVTAS------IFST 596

Query: 613  NTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKIT 672
            N + N   L  F  + +L A+  N+ +L+G   +G++  ELN +  I SS + G  G  T
Sbjct: 597  NDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLGTSGYTT 656

Query: 673  GLKSYSNGVLVYGDFNSSKESSN-VLSFNG-SFDSIGNITSPITNFANITIDDSELLVFD 730
            G+  YSNG+L+ G +    +S + +LS++G +F+S G +  PI    N TID  ELL+FD
Sbjct: 657  GIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGHELLLFD 716

Query: 731  NNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANN--L 788
            N  IF                           D+L  G+  +     L+G  S++++  +
Sbjct: 717  NAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQV 776

Query: 789  SATSLRSIGS---PYAAIFLNDSVTGYVLKN---DSSTSEMIFSDGSKAPW----RWTGY 838
            S+ +L  + +   PY A ++ND+   Y L+    D+    ++ ++ + +      +W+  
Sbjct: 777  SSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAP 836

Query: 839  VDSMLYLTNQSMLAVG-----SSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFER 893
            +++ LY    ++LA+G     SSS  + + SILNL  ++ +A    + N  V +MV F  
Sbjct: 837  INAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERVNSMVSFSS 896

Query: 894  NSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQ-LIIAGVF 952
            N+SILVGG++ I N  C  LCLYNY   +W +FLN +I G I ++Q  ++ + L++ G+ 
Sbjct: 897  NNSILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLI 954

Query: 953  DTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFAWNETSLFEYTSNSW 1009
             T ++S++ L  + +  N    ++ G  EP+  F+ ID   DNI A   + +    S +W
Sbjct: 955  KTNNESNIQLLSVEVGSNIFSTVKSG-TEPLLSFVPIDDSTDNIIAQMNSEILRLESGTW 1013

Query: 1010 VXXXXXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYN 1069
                                       KKRD     +++++++G +  + +G++ +++Y+
Sbjct: 1014 SSFGPQLNNDSIVSGFKVLSGTES---KKRDE---GSHIVLLEGTLNSSEWGNLTSVVYD 1067

Query: 1070 --FEEWIPYLSINSLVSSANQPAELFIDRDVSKLF--DSQLALQVSNXXXXXXXXXXXXX 1125
               ++W PY  I+      + P+  F  ++V+ L+   SQ  LQ +N             
Sbjct: 1068 GSTQKWQPYFVISDPKEQESLPSSSFF-QNVNDLYLSSSQTVLQSNN----SDTSASSTP 1122

Query: 1126 XXXXXXXXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPR 1185
                           IDRGF+VLIGLALAL T+ V+G++G ++ Y F +++G Y+ + PR
Sbjct: 1123 TPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNG-YESLKPR 1181

Query: 1186 VNEDEMLKTVPPEKLMEFI 1204
            +N+DEML TVPPEKLM+FI
Sbjct: 1182 INQDEMLDTVPPEKLMKFI 1200

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1212 (32%), Positives = 633/1212 (52%), Gaps = 43/1212 (3%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNS-FELLGGIDSLSFYRYTGQQNFTSGILPNSN 76
             + L++++  L + +  +P+L+L+  +N   +LLG   +L++YRYTGQ NFT GI     
Sbjct: 20   GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFT-GISDEKA 78

Query: 77   SNGLTYYSNNTFIQLYEPSLDSR---IERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXX 133
               L Y+SN T ++L  P   +    ++ +IP   DSFI                     
Sbjct: 79   RESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLS 138

Query: 134  XXXXKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVG 193
                  IFNQ+L  VN+I V+G    FGG+F       + H + +W++  N    LPF G
Sbjct: 139  DLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGG 198

Query: 194  FGENSLINSITKLNDDNILFAGKFYTLDNSTLLNV---VNDTMRNISDINLGQLIPLSAA 250
             G++S +NSI  L+D+NILFAG F T+D  + LN    +N T  +  +  L   IPL  A
Sbjct: 199  LGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAPE--LSHKIPLKTA 256

Query: 251  TWSSTGSFFDEETFVCP-DPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309
             W+S GS   ++  VCP +    AW   GT+G    ++   + P+K+R++N+   D E+S
Sbjct: 257  KWTSDGSL-QKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNARTLDEEVS 315

Query: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369
            LFR+ + PS  IMNLTY+DP  G+L+ CDA+CPL + Q L +A+++   S++ +E LN+ 
Sbjct: 316  LFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNL-TAAKSKAASTDQVEFLNNQ 374

Query: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPX 429
            T+ ++WS+ +Q+FAFVN +  +S+ F+AL+SYG++VG++ F++Y+D ++++AN+S N P 
Sbjct: 375  TT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPD 433

Query: 430  XXXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTP 489
                            W +G  D++YV  T + +    P VTF+P + YSG Y+I + TP
Sbjct: 434  CSSTSNYSKASLSASQWDQGSSDEDYVY-TLVENSQEAPSVTFYPQIVYSGLYTINVLTP 492

Query: 490  GCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYH 549
            GC  D +C SR +                   YQNND  KYD LYSGYL    K+ + Y 
Sbjct: 493  GCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLENEVKVVLEYE 552

Query: 550  SGIYSGTTAGTVVVDRLNIMINSLDILNEIH-NSTNSLELNGLFQYQLSNFSTSSKDSSI 608
              I  G T G+ ++    I +N+ +  + +  +   + +LNGL  Y LSN S+  ++   
Sbjct: 553  GAI--GNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHYSLSNSSSYLQN--F 608

Query: 609  ARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIE 668
                +T + Q +++ F+ N +     + + +++ A    +S  E+++   +++ + + + 
Sbjct: 609  KSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVRTVTTEEVG 668

Query: 669  GKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELLV 728
             +++G+ ++S G+ V G F+ S + +    +NGSF  I    S +T F N T+D +EL+ 
Sbjct: 669  DEVSGVFAFSEGLGVIGTFDGSTKGAKF--YNGSFFDIPLSHSNVTTFTNFTLDGAELVS 726

Query: 729  FDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANNL 788
              N                              G+T+F G+L++ ++T+L+GS  I+ + 
Sbjct: 727  LGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSFFIS-SN 785

Query: 789  SATSLRSIGSP----YAAIFLNDSVTGYVLKNDSSTSE----MIFSDGSKA---PWRWTG 837
            S +S R  GS     Y A ++++S TGY   + SST+      I+ D +K     +RWT 
Sbjct: 786  SQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLSYRWTN 845

Query: 838  YVDSMLYLTNQSMLAVGSSSSVNG-ELSILNLDSFKVLANETLNQNSSVKTMVHFERNSS 896
             V SMLY  N S+LA+G  +     +L + NL + +  A      N S+ +++ F++N+S
Sbjct: 846  MVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLIFFDQNTS 905

Query: 897  ILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKS 956
            +LVGG+F+ S + C GLCL++Y    W  F +  ING+I  ++IFN S L++ G FD   
Sbjct: 906  VLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGFFDIND 965

Query: 957  QSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFAWNETSLFEYTSNSWVXXX 1013
               VNLA M+LTD    ++  G  E + DFI +D   DN+ A +   LF  T+N+W    
Sbjct: 966  TKQVNLASMSLTDGSYNILHQG-TETILDFIFVDGKVDNLVAVSANDLFRLTNNNWESIS 1024

Query: 1014 XXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEW 1073
                                   KKR   E   N L++ G +    YG I A +Y+F +W
Sbjct: 1025 AQFDDSSVFGGLSEFPIQQGGQNKKR---EEEKNSLLITGDLLHKTYGKISAALYDFNDW 1081

Query: 1074 IPYLSINSLVSSAN-QPAELFIDRDVSKLFDSQLALQVSNXXXXXXXXXXXXXXXXXXXX 1132
            IPY S     S+     + ++ ++D+S  F+ Q  LQ S                     
Sbjct: 1082 IPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGTSSPTSSSPS 1141

Query: 1133 XXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEML 1192
                    I RGFVVLIGLALA+GT+ V+G++G+ L + F      Y  + PR +E EM+
Sbjct: 1142 QLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRADESEMI 1201

Query: 1193 KTVPPEKLMEFI 1204
             TVPPEKLM FI
Sbjct: 1202 DTVPPEKLMRFI 1213

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1177 (34%), Positives = 607/1177 (51%), Gaps = 39/1177 (3%)

Query: 41   TTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRI 100
            ++ +N  +LLG I++ ++Y Y GQQNFT+    + N   L YYSNNT ++L     D  +
Sbjct: 6    SSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPTDVEM 64

Query: 101  ERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXXXKQIFNQTLDSVNSILVDGTVVCF 160
              IIPF  D FI                         + IF + L  V SI VD  VV F
Sbjct: 65   RHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYF 124

Query: 161  GGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTL 220
            GG+ T + N ++G SV  WN T NS+SLLPF GFG NS +NSI +L ++N+LF G+F  L
Sbjct: 125  GGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKL 184

Query: 221  DNSTLLNVVNDTMRNIS----DINLGQLIPLSAATWSSTGSFFDEETFVCPDPTIEAWFQ 276
            +N++ ++  N T RN S    D  +GQ I L  ATW++  S  D + F+CP+   +AW+ 
Sbjct: 185  ENNSFVSKTNRT-RNFSISMEDSEVGQQISLRQATWNAN-SNLDVDAFICPNSDQQAWYS 242

Query: 277  NGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKH 336
             G+ G + CN P  +  +KIRIYN+P  DN+ISLFR+ + P   I+NLTY+DP+   +KH
Sbjct: 243  EGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKH 302

Query: 337  CDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFL 396
            C   CPL+T++ L +A  NVT  S++I  +N+N+++I+W++ +QEFAFVNQL  +SL+F+
Sbjct: 303  CTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFV 362

Query: 397  ALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXXXXXXXXXXXXXXT-WTRGMDDQNY 455
            A NSY  NVGLS FQIYQD++ IF NNS NEP                  W    +D +Y
Sbjct: 363  ASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSY 422

Query: 456  VKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNTCSSRGIXXXXXXXXXXXXX 515
            +  +YIP+QG  P +T+   +   G+Y + L TPGC +DNTCS+RGI             
Sbjct: 423  LANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNI 482

Query: 516  XXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSL-- 573
                  YQNN+ LKYD++++G LN S  + V Y+SGI + T   TVVV  ++++  S+  
Sbjct: 483  LGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISS 542

Query: 574  DILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSAS 633
            + +++  +   SL LNG+F+Y  SNF T        ++  T ++   ++ F+   S+ A 
Sbjct: 543  EFISDQIDGDRSLHLNGIFEYSPSNF-TFDNGYLTGKIDYTILDDFGVSNFNKGASIFAV 601

Query: 634  LYNDTLLVGAGDDGLSIYELNK-DLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKE 692
              N  L +G+ +   S+YELN  + +   S++  + G I G+ S   G++++G       
Sbjct: 602  DQNQNLYLGSTNG--SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIAHRGR 659

Query: 693  SSNVLSFNGSFDSIGNITS-PITNFANITIDDSELLVFDNNLIFXXXXXXXXXXXXXXXX 751
                +  N S   +  + +  I    N T+  S LLVFDN+ IF                
Sbjct: 660  EYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYRNL 719

Query: 752  XXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSIANN--LSATSLRSIGSPYAAIFLNDSV 809
                       D L  G +        + S+ I++N   S  SL    +   AI+LND+ 
Sbjct: 720  DLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDTK 779

Query: 810  TGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSSSSVNGELSILNLD 869
              Y L    + +    SD  + PW W   V  + Y   Q +L     +S   ++ +++L 
Sbjct: 780  ALYSLS-SGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIVLIDLF 838

Query: 870  SFKVLANETLNQN-SSVKTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLN 928
            S +V+ N+T N     +  +V+F  N++ LVGG+FS+SN  C GLCLYNY  + W +FLN
Sbjct: 839  SSQVI-NDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNWSSFLN 897

Query: 929  GTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFIT 988
             +I G I++++ FND+Q++++G  +    + +NL  +NLT NK  ++ +     + DFI 
Sbjct: 898  NSITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFIL 956

Query: 989  IDDNIFAWNETSLFEYTSNSWVXXXXXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNV 1048
            + + +  WN T +F      W                           +  +    SN  
Sbjct: 957  VRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATIN------------RIENFGADSNPA 1004

Query: 1049 LIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLAL 1108
            LI+ GQ     YG I A+IY+F  W PY  ++ +VS    P   F DRD S   +++   
Sbjct: 1005 LIIYGQFDSMKYGTINAVIYDFNSWYPYFEVD-VVSQTATPL-FFADRDQSSYGNTR--- 1059

Query: 1109 QVSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVIL 1168
             V                              I RGFVVLIGLALAL T+ VLGI GV++
Sbjct: 1060 HVVPDHIIVSSSHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALATLIVLGITGVVI 1119

Query: 1169 AYAFRDD-DGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204
            A  F    +GDYD+I    +++     + PEKL+  +
Sbjct: 1120 ALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1224 (31%), Positives = 603/1224 (49%), Gaps = 79/1224 (6%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELL-GGIDSLSFYRYTGQQNFTSGILPNSN 76
             S L S+ ++ +I H   P L+L+   N   L+     +  +Y Y GQQ FT        
Sbjct: 20   GSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTG--QEQHQ 77

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
             + L YYS  T++QL +   D+ + RI+PFGSDSFI                        
Sbjct: 78   GSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLE 137

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
              +I  Q+L+SVN ILVDG +V FGG FT S  + +GHS   WN T+ +TSLLPF GFG 
Sbjct: 138  VTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGR 197

Query: 197  NSLINSITKLNDDNILFAGKFYTL------DNSTLLNVVNDTMRNISDINLGQLIPLSAA 250
             S +N+I KL+   +LF G+F  L      + +++L        N++ I    L  L  +
Sbjct: 198  GSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRYS 257

Query: 251  TWSSTGSFFDEETFVCPDPTIEAWF-----QNGTSGTLNCNLPFDVAPTKIRIYNSPDPD 305
            T +S G   D+  F+CP    ++WF          G LN  +   + P+KIRIYNS    
Sbjct: 258  TITSDG-HLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNG 316

Query: 306  NEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIEL 365
            NEI LFRI + PS+SIMN+TYIDP  G+L  CDA+CPL  +  L S +   +  +++  L
Sbjct: 317  NEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVARL 375

Query: 366  LNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSL 425
            +ND    I+W+ D+QEFAF+NQ+    ++F+AL+SYG NVGL   +++Q  Y  + N++L
Sbjct: 376  VNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTL 435

Query: 426  NEPXXXXXXXXXXXXXXXXTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIE 485
            N+P                 W +G  D +Y+    +      P V   P + +SG Y++ 
Sbjct: 436  NQP-NCGEQQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTYTLN 491

Query: 486  LYTPGCQQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKIT 545
            LYTPGC+ D TC  RGI                   YQNN +LKYD LY+G+L+ +P + 
Sbjct: 492  LYTPGCEDDGTCDYRGI-VNVTLLASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVR 550

Query: 546  VTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKD 605
            + + S I S      +V DR++ +I+SLD L++I +      LNGLFQY  +    SS D
Sbjct: 551  MEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREK-SLNGLFQYTPAG---SSLD 606

Query: 606  SSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDG--LSIYELNKDLAIQSSS 663
            + I +     IN+   T     VSL   +Y+  L++G    G    +     D      +
Sbjct: 607  NGIQKY----INKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVT 662

Query: 664  QQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDD 723
            +Q + G + G+  YS G++  G FN S   S+ L ++G+F S  ++ S  ++  N+TID 
Sbjct: 663  RQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTIDG 722

Query: 724  SELLVFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVS 783
            SELL+F+N  I+                           D LF+G+++ ++  +  G+V+
Sbjct: 723  SELLLFNNKFIYNTSTSQMLTSSMFQLSALSAAANSNN-DLLFTGSIADIKHGSAHGAVA 781

Query: 784  I--ANNLSATSLRSIGSP--YAAIFLNDSVTGY----VLKNDSSTSEMIFSDGSKAPWRW 835
            +    N+  +   SI     +  ++LND+ T Y    V  N S  +  +  +     +  
Sbjct: 782  LDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNL 841

Query: 836  T---GYVDSMLYLTNQSMLAVGSS--SSVNGELSILNLDSFKVLANETLNQNSSVKTMVH 890
            +     V  M+Y+   + L + ++      G L + +L + + +A E LN    + ++V 
Sbjct: 842  SNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIVL 901

Query: 891  FERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAG 950
            F  ++++LVGG+F      C  LCLYN+    W  F +G I+G I +LQ  N+  LI  G
Sbjct: 902  FGEDNTLLVGGSFEKDG--CHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVG 959

Query: 951  VFDTKSQSSVNLALMNLTDNKLVLIRWGFKEP----VKDFITIDDN---IFAWNETSLFE 1003
                +S+ ++     +L  +++V      ++P        +TI D+     A +   ++ 
Sbjct: 960  SMTVQSRPNILFLNFDLVRSRVVEQH---EQPNGRAFNSVLTIGDSGDEYVAEDGKQVWH 1016

Query: 1004 YTSNSWVXXXXXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHI 1063
            Y+ + W                         +  KR+     N ++++ GQ+  + YG I
Sbjct: 1017 YSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRN--RVGNELVVIHGQMNSSEYGEI 1074

Query: 1064 QAMIYNFEEWIP-YLSINSLVSSA-NQP-AELFIDRDVSKLFDSQLALQVSNXXXXXXXX 1120
             AM YNFE W P Y +I S      N P  ++F+++D+S+   + L L+V          
Sbjct: 1075 NAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEV---------- 1124

Query: 1121 XXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYD 1180
                                + +G+VVLI L LAL T+ +LGI+GVILAYAF D +  Y 
Sbjct: 1125 ------VVSDSPPTAEPKRKLAKGYVVLIALGLALATIALLGIIGVILAYAFGDHNA-YQ 1177

Query: 1181 VITPRVNEDEMLKTVPPEKLMEFI 1204
             + PR+NEDEMLKTVPPEKLM+FI
Sbjct: 1178 PLKPRINEDEMLKTVPPEKLMKFI 1201

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1218 (33%), Positives = 625/1218 (51%), Gaps = 56/1218 (4%)

Query: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELL-GGIDSLSFYRYTGQQNFTSGILPNSN 76
             SQ++ +  + NIT    P+L+L+T  NS  L+     +  +Y Y GQQ FT   L +  
Sbjct: 20   GSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG--LADER 77

Query: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFIXXXXXXXXXXXXXXXXXXXXXXXX 136
             N L YYSNNT++QL E    + I++I+P+G DSFI                        
Sbjct: 78   KNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLSSFE 137

Query: 137  XKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196
              +I  + L+ VN IL DG VV FGG FT +  +L+GHSV  W+ T  S+SLLPF GFG+
Sbjct: 138  ITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYGFGQ 197

Query: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL---NVVNDTMRNISDINLGQLIPLSAATWS 253
             S++N+I KL+D NILF GKF T+DN+ LL   NV +  + N ++I    L  L  ++  
Sbjct: 198  GSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALASLRFSSLV 257

Query: 254  STGSFFDEETFVCPDPTIEAW-FQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFR 312
              G+  +   FVCP+ + ++W   + T G L   +   + P+KIRIYNS D +N+++LFR
Sbjct: 258  HDGT-LNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFR 316

Query: 313  IFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSD 372
            I + PS SIMN+TY+DP+ G L  CDA+CPL    VL + +EN T SS M    N+N   
Sbjct: 317  IVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENST-SSVMAAFPNNNNVL 375

Query: 373  IRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPXXXX 432
            ++W+  +QEFAFVN++    L F+A++S+G NVGL   +++Q  Y  + NN+LN+P    
Sbjct: 376  VKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDS 435

Query: 433  XXXXXXXXXXXXT-WTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGC 491
                        T W +G+ DQ+Y+ T++   +   P VT  P + Y G Y++ L TPGC
Sbjct: 436  QQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLVTPGC 492

Query: 492  QQDNTCSSRGIXXXXXXXXXXXXXXXXXXXYQNNDQLKYDELYSGYLNYSPKITVTYHSG 551
              DNTC+ RGI                   YQNN+ LKYD L+ GYL+ SP + + +   
Sbjct: 493  LTDNTCAFRGI-VNVTIRAQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGP 551

Query: 552  IYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARV 611
            I        +V DR+  +I+S++ L   + ++NS  LNGLFQY  SNF+ ++  +    V
Sbjct: 552  IDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAASNFTNTNLST---LV 608

Query: 612  ANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGD-DGLSIYELNKD---LAIQSSSQQGI 667
             +T+I+Q  +     + SL   +YNDTL +G+   DGL+     KD     I        
Sbjct: 609  GSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLIDT 668

Query: 668  EGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELL 727
            EG +TG+  YSNG+ +    N +  +S+ LSFNGS  +I    +P  +  N+TID SE+L
Sbjct: 669  EGPVTGIFPYSNGLALTVHSNQTNMASS-LSFNGSISTIFRSNAPSLSILNLTIDGSEIL 727

Query: 728  VFDNNLIFXXXXXXXXXXXXXXXXXXXXXXXXXXGDTLFSGALSQVQFTNLSGSVSI--- 784
            VFDN  ++                           D + +G +   +    +G+++I   
Sbjct: 728  VFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDAD 787

Query: 785  ANNLSATSLRSI--GSPYAAIFLNDSVTGYVLKNDS--STSEMIFSDGSKAPWRWT---G 837
            +N +  + L S+  G  Y  +F+NDS + Y   + S  S+   I   G   P   +    
Sbjct: 788  SNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEYLSTDDS 847

Query: 838  YVDSMLYLTNQSMLAVGSSSSVNG--ELSILNLDSFKVLANETLNQNSSVKTMVHFERNS 895
             V+ MLY+ + ++LAV +S +  G   L I +L +      ET      + TMV F RN 
Sbjct: 848  TVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMVLFGRNY 907

Query: 896  SILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTK 955
            ++LVGG F  +   C  LCLYNY  N W  F++G I G I +LQ  + + L++AG+  + 
Sbjct: 908  TLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASS 965

Query: 956  SQSSVNLALMNLTDNKLVLIRWGFKEPV-KDFITIDDN---IFAWNETSLFEYTSNSW-- 1009
                + L  ++L++ +++    G      +  +T+ ++   + A +   +F +    W  
Sbjct: 966  DSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKN 1025

Query: 1010 VXXXXXXXXXXXXXXXXXXXXXXXNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYN 1069
            +                       N++ KRD     N ++++ G      YG I AM Y+
Sbjct: 1026 ISPDTSGQTQINGLTLLSTDFSQRNSIMKRD--RVGNELVVINGNFSSPDYGDINAMYYD 1083

Query: 1070 FEEWIPYLSINSLVSSANQ---PAELFIDRDVSKLFDSQLALQVSNXXXXXXXXXXXXXX 1126
            F  W PY       S++++     +LF+++DVS    SQ+ L   N              
Sbjct: 1084 FNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDN--------DNDDTP 1135

Query: 1127 XXXXXXXXXXXXXXIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRV 1186
                          + + FVVLI LALAL T+ VLG+VGV+ AY F D +  Y+ + PR+
Sbjct: 1136 AASEPATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDHNA-YEPLKPRI 1194

Query: 1187 NEDEMLKTVPPEKLMEFI 1204
            NE EMLKTVPPEKLM+FI
Sbjct: 1195 NEAEMLKTVPPEKLMKFI 1212

>NCAS0G03290 Chr7 complement(606690..607496) [807 bp, 268 aa] {ON}
           Anc_1.421
          Length = 268

 Score = 35.0 bits (79), Expect = 0.81,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 60/145 (41%), Gaps = 10/145 (6%)

Query: 837 GYVDSMLYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSS 896
           G++D M     + +++ G  +++      LN D  K++      +   + TM   +   +
Sbjct: 13  GHIDKMAQNIKEGIISAGGMATIYRVEETLNDDVLKLMGAPPKPEGIPIATMETLKEYDA 72

Query: 897 ILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKS 956
            L G      N        ++ TG  W   +NG+++G +  +        +  G +    
Sbjct: 73  FLFGVPTRYGNVPAQWSAFWDKTGELW---INGSLDGKMAGV-------FVSTGTYGGGQ 122

Query: 957 QSSVNLALMNLTDNKLVLIRWGFKE 981
           +++V   L  LT + +V +  G+KE
Sbjct: 123 EATVKNFLNYLTHHGIVFVPLGYKE 147

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 17/109 (15%)

Query: 295 KIRIYNSPDPD----NEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLK 350
           K+++ NS   D    N+I+L R      ES      ID + G++K  DA  P  TK +  
Sbjct: 32  KLKLQNSQLRDEEFQNQINLAR-----QESKQLYVQIDKIKGKIK--DATLPDMTKSIPP 84

Query: 351 SASENVTLSSEM-IELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLAL 398
            + + + L   + ++  N+  SD+RWS+D ++      LSAS   F+ L
Sbjct: 85  LSKDKINLKPTLALKGHNNKISDVRWSRDSKKI-----LSASQDGFMLL 128

>NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {ON}
           Anc_8.67
          Length = 730

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 618 QLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKSY 677
           + TLTG +++V       +D ++ GA D  L IY+      ++  S  G EG +  LK  
Sbjct: 348 RTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELS--GHEGGVWALKYD 405

Query: 678 SNGVLVYGDFNSS 690
           ++G++V G  + S
Sbjct: 406 ADGIIVSGSTDRS 418

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 652 ELNKDLAIQSSSQQGIEGKITGLK--SYSN-GVLVYGDFNSSKESSNVLSFNGSFDSIG- 707
           +L + L I    Q+ I+G + G++  +YSN  +L  GDFNSS++S  +   NG     G 
Sbjct: 223 KLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVKILFSGDFNSSRDSLVIKFLNGKIIKHGD 282

Query: 708 -NITSPITNFANITIDD 723
            N+ +P+  + + +I D
Sbjct: 283 INLQNPMRAYLSHSIYD 299

>KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {ON}
           similar to uniprot|P07834 Saccharomyces cerevisiae
           YFL009W CDC4 F-box protein required for G1/S and G2/M
           transition associates with Skp1p and Cdc53p to form a
           complex SCFCdc4 which acts as ubiquitin-protein ligase
           directing ubiquitination of the phosphorylated CDK
           inhibitor Sic1p
          Length = 647

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 612 ANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKI 671
            N    +  L G S+NV       N+ ++ GA D  +++Y+   DL +   +  G EG +
Sbjct: 246 PNYKPGRTCLDGHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELN--GHEGGV 303

Query: 672 TGLKSYSNGVLVYGDFNSSKESSNV 696
             LK     +LV G  + S    N+
Sbjct: 304 WALKFVDGKILVSGSTDRSVRIWNI 328

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 10/75 (13%)

Query: 301 SPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVT--- 357
            P+P+ + + F+   DP   + N+ YI P +GQ K+     PL  KQ+L+     V    
Sbjct: 9   EPNPEKDRNEFK---DPEHVLANIKYIIPRIGQ-KYDSLITPLLDKQLLQKGEIAVANSK 64

Query: 358 ---LSSEMIELLNDN 369
              LS E+ +L+ ++
Sbjct: 65  TNYLSKELYDLVKND 79

>TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {ON}
           Anc_3.253 YBR046C
          Length = 343

 Score = 32.3 bits (72), Expect = 7.9,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query: 639 LLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSS-----KES 693
           + V + DD L + +L+    + +SS   I  K+     Y+NG  V   F+S      + S
Sbjct: 186 IAVASSDDKLQLAKLHGAKHLINSSTDDIVEKVN---EYTNGKGVEAVFDSIGKDTFETS 242

Query: 694 SNVLSFNGSFDSIGNITSPITNF 716
             VL   G+F S GN + P+  F
Sbjct: 243 MKVLRLKGTFVSFGNASGPVAPF 265

>SAKL0A09592g Chr1 complement(839689..841749) [2061 bp, 686 aa] {ON}
           conserved hypothetical protein
          Length = 686

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 16/111 (14%)

Query: 767 SGALSQVQFTNLSGSVSIANNLSATSLRSIGSPY---AAIFLNDSVTGYVLKNDSSTSEM 823
           SG++ Q  FTN +  V   N+++  +L+ +G  +   A   +  S   Y +K     ++ 
Sbjct: 505 SGSVDQSPFTNRTYKVINENSINPVTLKPVGYKFEMPAKQMIVASPKSYNVKRAHYATKQ 564

Query: 824 IFSDGSKAPWRWTGYVDSMLY----LTNQSMLAVGSSSSVNGELSILNLDS 870
            +          T Y D  LY     TNQS    G S   NG+ S+ N D+
Sbjct: 565 FWV---------TKYRDDELYAAGEFTNQSQTDTGLSKWANGDDSVRNTDT 606

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 32.0 bits (71), Expect = 9.3,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 868 LDSFKVLANETLNQNSSVKTMVHFERNSSILVG 900
           L SF+V+ N T+N ++ V+T +H  RNS+  VG
Sbjct: 130 LPSFRVIRNTTVNTDTEVETHLHSSRNSTWDVG 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,231,374
Number of extensions: 5168919
Number of successful extensions: 19255
Number of sequences better than 10.0: 92
Number of HSP's gapped: 19474
Number of HSP's successfully gapped: 144
Length of query: 1204
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1083
Effective length of database: 39,606,813
Effective search space: 42894178479
Effective search space used: 42894178479
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)