Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B049708.254ON66666631850.0
NDAI0B023708.254ON72266927300.0
Smik_12.1428.254ON66365125290.0
Suva_10.1678.254ON68466925220.0
YLR083C (EMP70)8.254ON66765125060.0
KAFR0B026808.254ON66465125030.0
Skud_12.1518.254ON66465324720.0
YDR107C (TMN2)8.254ON67265624310.0
Suva_2.2678.254ON67265624290.0
KNAG0G019908.254ON66765124110.0
Smik_4.3538.254ON69065623780.0
Skud_4.3688.254ON67265623450.0
Kpol_543.358.254ON65865123320.0
TBLA0E043708.254ON67666022520.0
ZYRO0C01848g8.254ON64765122330.0
SAKL0H17248g8.254ON66065022150.0
KLLA0F18931g8.254ON66565222010.0
Kwal_56.235778.254ON68366621920.0
CAGL0B01683g8.254ON69167521750.0
TPHA0A018408.254ON68567321600.0
KLTH0G13882g8.254ON68767021350.0
NCAS0B038908.254ON66365420770.0
TBLA0H014508.254ON67365320510.0
TDEL0F038108.254ON65665119990.0
AGR097W8.254ON65365019230.0
NDAI0J014208.254ON61962718450.0
Ecym_43178.254ON60564815270.0
NCAS0A145207.411ON6706893818e-38
YER113C (TMN3)7.411ON7067103676e-36
NDAI0A015107.411ON6796943472e-33
Smik_5.2587.411ON7067123454e-33
SAKL0F12914g7.411ON7077293358e-32
Suva_5.2347.411ON7067193322e-31
TDEL0C027107.411ON6786903293e-31
Skud_5.2667.411ON7077153223e-30
ZYRO0B03784g7.411ON6586913045e-28
CAGL0G03487g7.411ON7047142869e-26
KLTH0C06226g7.411ON6947172217e-18
KNAG0C034307.411ON6802592201e-17
Kwal_27.107467.411ON6902781932e-14
KLLA0E20835g7.411ON6763291904e-14
KAFR0K019507.411ON6642711797e-13
TBLA0I003307.411ON7135101574e-10
Ecym_71437.411ON6762831493e-09
TPHA0K007307.411ON7332801466e-09
AGL295C7.411ON6572721413e-08
Kpol_1045.287.411ON6812891000.002
NCAS0A148907.481ON616122780.90
KNAG0C062905.646ON41780751.7
Smik_15.1636.33ON339107714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B04970
         (666 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...  1231   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...  1056   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   978   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   976   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   969   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   968   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   956   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   941   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   940   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   933   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   920   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   907   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   902   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   872   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   864   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   857   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   852   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   848   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   842   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   836   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   827   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    804   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   794   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   774   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   745   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   715   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   592   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   151   8e-38
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   145   6e-36
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   138   2e-33
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   137   4e-33
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   133   8e-32
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   132   2e-31
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   131   3e-31
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   128   3e-30
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   121   5e-28
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   114   9e-26
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    90   7e-18
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    89   1e-17
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    79   2e-14
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    78   4e-14
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    74   7e-13
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    65   4e-10
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    62   3e-09
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    61   6e-09
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    59   3e-08
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    43   0.002
NCAS0A14890 Chr1 (2933969..2935819) [1851 bp, 616 aa] {ON} Anc_7...    35   0.90 
KNAG0C06290 Chr3 (1224562..1225815) [1254 bp, 417 aa] {ON} Anc_5...    33   1.7  
Smik_15.163 Chr15 complement(278633..279371,279402..279679) [101...    32   4.7  

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score = 1231 bits (3185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/666 (90%), Positives = 604/666 (90%)

Query: 1   MLSPRXXXXXXXXXXXXRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKN 60
           MLSPR            RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKN
Sbjct: 1   MLSPRLVLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKN 60

Query: 61  KEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKS 120
           KEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKS
Sbjct: 61  KEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKS 120

Query: 121 TIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDG 180
           TIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDG
Sbjct: 121 TIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDG 180

Query: 181 QAPATTKPKQTTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGV 240
           QAPATTKPKQTTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGV
Sbjct: 181 QAPATTKPKQTTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGV 240

Query: 241 IVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDP 300
           IVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDP
Sbjct: 241 IVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDP 300

Query: 301 TIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFR 360
           TIQWF                    MKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFR
Sbjct: 301 TIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFR 360

Query: 361 IPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 420
           IPHKSM          QLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT
Sbjct: 361 IPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 420

Query: 421 SMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLW 480
           SMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLW
Sbjct: 421 SMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLW 480

Query: 481 FIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIA 540
           FIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIA
Sbjct: 481 FIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIA 540

Query: 541 VELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVG 600
           VELYFIYTSLWFNKIFYMFGF                    YHSLCLENWQWQWRGFIVG
Sbjct: 541 VELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVG 600

Query: 601 GVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
           GVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY
Sbjct: 601 GVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660

Query: 661 SAIKVD 666
           SAIKVD
Sbjct: 661 SAIKVD 666

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/669 (75%), Positives = 553/669 (82%), Gaps = 3/669 (0%)

Query: 1   MLSPRXXXXXXXXXXXXRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS-- 58
           M++P             RAFYLPGVAPTTYH  DEIPLLVNHLTPS+YFQ  + +GK+  
Sbjct: 54  MIAPSLVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMK 113

Query: 59  KNKEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLC 118
            +KE FLYS+DYY+DR HFC+PEHIEKQPESLGSIIFGDRIYNSPF++ ML++KTCVSLC
Sbjct: 114 SDKERFLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLC 173

Query: 119 KSTIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAI 178
           K+TIPGKDAKFINKLIKNGFFQNWLIDGLPAA QVYD +TK+EFYGTGFELGFV+  Q  
Sbjct: 174 KTTIPGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGT 233

Query: 179 D-GQAPATTKPKQTTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRV 237
             G    T   K TTNEGLEL+TR+AKNVQM+KN E+ YF NH+DIQVEYHDRGE  YRV
Sbjct: 234 TTGDNANTVAKKPTTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRV 293

Query: 238 VGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHT 297
           VGVIVNPVSIKRSTPGTCET+G PL+LSED DNDVYFTYSVKF+PSET+WATRWDKYLH 
Sbjct: 294 VGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHI 353

Query: 298 YDPTIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGD 357
           YDP IQWF                    +KALKSDFARYNE NL+DDFQE+AGWKLGHGD
Sbjct: 354 YDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGD 413

Query: 358 VFRIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 417
           VFRIPH+S+          QLFLMI CSIFFAALGFLSPSSRGSLATVMFILYALFGFVG
Sbjct: 414 VFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 473

Query: 418 SYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMI 477
           SYTSM VYKFF GPYWKVNMLLTP ++PG IF  IV LN FL+F HSSGV+PA TLFFMI
Sbjct: 474 SYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMI 533

Query: 478 LLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFG 537
           LLWF+FSIPLA AGSLIAHKKC WDEHPTKTNQIARQIPFQPWYLKTWPAT+IAGIFPFG
Sbjct: 534 LLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFG 593

Query: 538 SIAVELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGF 597
           SIAVELYFIY+SLWFNKIFYMFGF                    YHSLCLENW WQWRGF
Sbjct: 594 SIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGF 653

Query: 598 IVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVR 657
           I+GGVGCAIYVF+HSILFTKFKLGGF TIVLYVGYST+ISLLFC+VTGAIGFLSS+ F+R
Sbjct: 654 IIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIR 713

Query: 658 KIYSAIKVD 666
           KIYS+IKV+
Sbjct: 714 KIYSSIKVE 722

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/651 (71%), Positives = 525/651 (80%), Gaps = 6/651 (0%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           +AFYLPGVAPTTY E DEIPLLVNHLTPS+Y+Q  D  G   S +KE+FLYS+DYY  R 
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFCKPE +EKQPESLGSIIFGDRIYNSPF+LKMLEEK CVSLCK TIPG DAKFINKLIK
Sbjct: 77  HFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIK 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGFFQNWLIDGLPAA  V D++TK+ FYG GFELGFVE  Q    +A   T   +TTN+G
Sbjct: 137 NGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTA--ETTNQG 194

Query: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
           +EL+TR+  N  MV+  E  YF NHYDI++EYHDRGEG YRVVGVIVNPVSIKRS P TC
Sbjct: 195 VELDTRDGHN--MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
           ET G PL+L E+ DN+VYFTYSVKFV SET WATRWDKYLH YDP+IQWF          
Sbjct: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVV 312

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     ++ALKSDFARYNE NL+DDFQED+GWKL HGDVFR P +S+         
Sbjct: 313 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QLF M++CSIFFAALGFLSPSSRGSLATVMF+LYALFGFVGSYTSM +YKFF GPYWK 
Sbjct: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           N++LTP ++PG I + I+ LNFFLMF HSSGV+PA TLFFM+ LWF+FSIPL+FAGSL+A
Sbjct: 433 NLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
            KKC WDEHPTKTNQIARQIPFQPWYLKT PAT+IAG+FPFGSIAVELYFIYTSLWFNKI
Sbjct: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    YHSLCLENW+WQWRGFIVGG GCA+YVF+HSILF
Sbjct: 553 FYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           TKFKLGGF TIVLYVGYS++ISLL C+VTG+IGF+SS+ F+RKIYS+IKVD
Sbjct: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/669 (69%), Positives = 533/669 (79%), Gaps = 21/669 (3%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           RAFYLPGVAPTTY E DEIPLLVNHLTPS+Y+Q  D +G   S +KEHFLYS+DYY+D+ 
Sbjct: 17  RAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFCKPEH+EKQPESLGSIIFGDRIYNSPFEL ML+EK CVSLCK+ IPG DAKFINKLIK
Sbjct: 77  HFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIK 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQ-------------- 181
           NGFFQNWLIDGLPAA +V+D +TK++FYG GF LGFVE  Q +D +              
Sbjct: 137 NGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQT 196

Query: 182 --APATTKPKQ--TTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRV 237
             A   T+P++  ++NEG+EL+ R+ +   MVK  E  YF NH+DI++EYHDRGEG YRV
Sbjct: 197 QAADGKTEPEKGKSSNEGMELDARD-QGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRV 255

Query: 238 VGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHT 297
           VGVIVNP+SIKRS+PGTCET G PLVL E  DN+VYFTYSVKF  S T WATRWDKYLH 
Sbjct: 256 VGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYLHV 315

Query: 298 YDPTIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGD 357
           YDP+IQWF                    ++ALKSDFARYNE NL+DDFQED+GWKL HGD
Sbjct: 316 YDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGD 375

Query: 358 VFRIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 417
           VFR P +S+          Q+FLM++CSIFFAALGFLSPSSRGSLATVMFILYALFGFVG
Sbjct: 376 VFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 435

Query: 418 SYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMI 477
           SYTSM +YKFF GPYWK N+++TP +IPG I L I+ LNFFLMF HSSGV+PA TLFFM+
Sbjct: 436 SYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMV 495

Query: 478 LLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFG 537
            LWF+FSIPL+FAGSL+A KKC WDEHPTKTNQIARQIPFQPWYLKT PAT+IAGIFPFG
Sbjct: 496 FLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFPFG 555

Query: 538 SIAVELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGF 597
           SIAVELYFIYTSLWFNKIFYMFGF                    YHSLCLENW+WQWRGF
Sbjct: 556 SIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKWQWRGF 615

Query: 598 IVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVR 657
            VGGVGCA+YVF+HSILFTKFKLGGF TIVLY+GYS++ISLL C+VTG+IGF+SS+ F+R
Sbjct: 616 TVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIR 675

Query: 658 KIYSAIKVD 666
           KIYS+IKVD
Sbjct: 676 KIYSSIKVD 684

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/651 (70%), Positives = 526/651 (80%), Gaps = 6/651 (0%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           +AFYLPGVAPTTY E D IPLLVNHLTPS+ +Q  D +G   S +KE+FLYS+DYY++R 
Sbjct: 21  KAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRF 80

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PE +EKQPESLGS+IFGDRIYNSPF+L ML+EK C SLCK+ IPG DAKFINKLIK
Sbjct: 81  HFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLIK 140

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGFFQNWLIDGLPAA +VYD +TK+ FYG GF LGFV+  Q  D +A  T K  +TT++ 
Sbjct: 141 NGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEA--TPKGAETTDKD 198

Query: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
           +ELETR  +N  MVK  E+ YF NH+DI +EYHDRGEG YRVVGVIV PVSIKRS+PGTC
Sbjct: 199 VELETRNDRN--MVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTC 256

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
           ETTG PL+L E  DN+VYFTYSVKF  S T WATRWDKYLH YDP+IQWF          
Sbjct: 257 ETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVV 316

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     ++ALKSDFARYNE NL+DDFQED+GWKL HGDVFR P +S+         
Sbjct: 317 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSG 376

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QLFLM++CSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM +YKFF GPYWK 
Sbjct: 377 VQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKA 436

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           N++LTP ++PG I L I+ LNFFLMF HSSGV+PA TLFFM+ LWF+FSIPL+FAGSLIA
Sbjct: 437 NLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIA 496

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
            K+C WDEHPTKTNQIARQIPFQPWYLKT PAT+IAGIFPFGSIAVELYFIYTSLWFNKI
Sbjct: 497 RKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI 556

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    YHSLCLENW+WQWRGFI+GG GCA+YVF+HSILF
Sbjct: 557 FYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILF 616

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           TKFKLGGF TIVLYVGYS++ISLL C+VTG+IGF+SS++FVRKIYS+IKVD
Sbjct: 617 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/651 (72%), Positives = 536/651 (82%), Gaps = 4/651 (0%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           RAFYLPGVAPTTYHEGDEIPLLVNHL+PS+Y+Q  +  GK  S +K  +LYS+DYY+DR 
Sbjct: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRF 75

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PE IEKQPESLGSI+FGDRIYNSPF+L MLEEK C SLCKSTIPG DAKFINKLIK
Sbjct: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGFFQNWLIDGLPAA + +D +T ++FYG+GFELG V+  QA+D +  A TK     N+G
Sbjct: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-ETEARTK-VAAANQG 193

Query: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
            EL+ R+AKNV+ +KN+E+ YFVNHYDI++EYHDRG G YRVVGVIVNPVSI+RS+PG+C
Sbjct: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSC 253

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
           E+TG PL L ED DNDVYFTYSV FVPSET WATRWDKYLH YDPTIQWF          
Sbjct: 254 ESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVL 313

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     +KALK+DFARYNEFNL+D+FQEDAGWKL HGDVFRIPHKSM         
Sbjct: 314 LLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSG 373

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QLF+MIS +IFFAALGFLSPSSRG L TVMF+LYALFGFVGSYTSM VYKFF+GPYWK 
Sbjct: 374 VQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 433

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           NM+LTP ++PG IF+TI+ +NFFLM+ HSSGV+PA TLFFM+LLWF+FSIP AFAGSL+A
Sbjct: 434 NMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVA 493

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
           +KKC W+EHPTKT QIARQIPFQPWYLKT PAT IAGIFPFGSIAVE+YFIYTSLW+NKI
Sbjct: 494 NKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKI 553

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    YHSLCLENW WQWR FIVGGVGCAIYVF+HSILF
Sbjct: 554 FYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILF 613

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           TKFKLGGF T+VLY+GYS++ISLL C+VTG+IGFLSS+ FVRKI+S+IKVD
Sbjct: 614 TKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/653 (71%), Positives = 519/653 (79%), Gaps = 9/653 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDRL 75
           +AFYLPGVAPTTY E DEIPLLVNHLTPS+Y+Q  D  G S   +KE+FLYS+DYY+DR 
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+P+H+EKQPESLGS+IFGDRIYNSPFEL ML+EK CV LC +TIPG DAKFINKLIK
Sbjct: 77  HFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIK 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQ--TTN 193
           NGFFQNWLIDGLPAA +VYD +TK+ FYG GFELG VE  Q    +    T PKQ  TTN
Sbjct: 137 NGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSK----TAPKQAETTN 192

Query: 194 EGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPG 253
           EGLEL TR A++  +V+  E  YF NH+DI +EYHDRG G YRVVGVIVNP+SIKRS  G
Sbjct: 193 EGLELGTR-AEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITG 251

Query: 254 TCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXX 313
           TCET   PL+L E+ DN+V FTYSVKF  S T WATRWDKYLH YDP+IQWF        
Sbjct: 252 TCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLV 311

Query: 314 XXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXX 373
                       ++ALKSDFARYNE NLEDDFQED+GWKL HGDVFR P  S+       
Sbjct: 312 VVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVG 371

Query: 374 XXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYW 433
              QLFLM++CSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM +YKFF GPYW
Sbjct: 372 SGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYW 431

Query: 434 KVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSL 493
           K N+LLTP ++PG I L IV LNFFLM  HSSGV+PA TLFFM+ LWF+FSIPL+F GSL
Sbjct: 432 KANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSL 491

Query: 494 IAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFN 553
           IA KKC WDEHPTKTNQIARQIPFQPWYLKT PAT+IAGIFPFGSIAVELYFIYTSLWFN
Sbjct: 492 IARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFN 551

Query: 554 KIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSI 613
           KIFYMFGF                    YHSLCLENW+WQWRGFIVGGVGCA+YVF+HSI
Sbjct: 552 KIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSI 611

Query: 614 LFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           LFTKFKLGGF TIVLYVGYS +ISLL C+VTG+IGF+SS+ F+R+IYS+IKVD
Sbjct: 612 LFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/656 (67%), Positives = 520/656 (79%), Gaps = 7/656 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           + F LPG++PTTYH GDEIPLLVN LTPS+YFQ  D  G   S +KEHFLYS+DYY  R 
Sbjct: 17  KGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PEH+EKQPESLGS+IFGDRIYNSPF+L MLEEK CV+LCKSTIPGKDAKFIN LIK
Sbjct: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIK 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTT--- 192
           +GFFQNWL+DGLPAA + YD +TK+ +YGTGFELGF +  Q +DG+A  +T  + T+   
Sbjct: 137 SGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEAS 196

Query: 193 NEGLELETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRS 250
           NE + L+ R  KNV+  +VK +E+ YFVNH+DI+VE+HDRG   YRVVGVIVNPVSI+RS
Sbjct: 197 NEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERS 256

Query: 251 TPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXX 310
           +PG C TTG PL+L ED DN+VYFTYSVKFV S+TVWATRWDKYLH YDP IQWF     
Sbjct: 257 SPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINF 316

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXX 370
                          ++ALKSD ARYNE NL+++F ED+GWKLGHGDVFR P KSM    
Sbjct: 317 SVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSI 376

Query: 371 XXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKG 430
                 QLFLM+ CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY SM VYKFF+G
Sbjct: 377 LVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRG 436

Query: 431 PYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFA 490
           PYWK NM+LTP ++PG IFL IV +NFFL+FAHSSGV+PA +LFF+ILLWF+ S+PL+FA
Sbjct: 437 PYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFA 496

Query: 491 GSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSL 550
           GS++AHK+C WDEHPTKTNQIARQIP+QPWYL+T  AT+IAGIF FGSIAVELYFIY+SL
Sbjct: 497 GSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSL 556

Query: 551 WFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFV 610
           WFNKIFYMFGF                    Y+SLCLENW WQWR FI+GG+GC+IY F+
Sbjct: 557 WFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTFI 616

Query: 611 HSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           HSILFTKFKLGG  T+VLY+GYS +IS L CVVTGAIGF SS+ F+RKIYSAIKV+
Sbjct: 617 HSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/656 (68%), Positives = 521/656 (79%), Gaps = 7/656 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           +AF LPGV+PTTY   DEIPLLVN LTPS+YFQ  D NGK  S +KEHFLYS+DYY D+ 
Sbjct: 17  KAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFCKPEH+EKQPESLGS+IFGDRIYNSPF+LKMLE+K CV+LCKSTIPGKDAKFIN LIK
Sbjct: 77  HFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIK 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA-PATTKP--KQTT 192
           NGFFQNWL+DGLPAA  VYD +TK+ +YGTGFELGF +  Q + G+  P+T +    + +
Sbjct: 137 NGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDS 196

Query: 193 NEGLELETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRS 250
             G  L+ R+ KN++  +V+ IE+ +FVNH++IQVEYHDRG G YRVVGV VNP+SI+RS
Sbjct: 197 KTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERS 256

Query: 251 TPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXX 310
           +PG C TTG+PL L ED DNDVYFTYSVKF+ S+TVWATRWDKYLH YDP IQWF     
Sbjct: 257 SPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFSLINF 316

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXX 370
                          ++A++SDFARYNE NL+++F EDAGWKLGHGDVFRIP KSM    
Sbjct: 317 SIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLSV 376

Query: 371 XXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKG 430
                 QLFLMI CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYTSM VYKFF G
Sbjct: 377 LVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFHG 436

Query: 431 PYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFA 490
           PYWK N+++TP ++PG IFL IV +NFFL+FAHSSGV+PA TLFF+I LWF  SIPL+FA
Sbjct: 437 PYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFA 496

Query: 491 GSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSL 550
           GS IAHK+C WDEHPTKTNQIARQ P QPWYL+T  AT+IAGIF FGSIAVELYFIY+SL
Sbjct: 497 GSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSL 556

Query: 551 WFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFV 610
           WFNKIFYMFGF                    YHSLCLENW WQWR FI+GG+GC++Y+F+
Sbjct: 557 WFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSVYMFI 616

Query: 611 HSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           H+ILFTKFKLGGF T+VLYVGYS +IS L CVVTGAIGF SS+IF+RKIYS IKV+
Sbjct: 617 HAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/651 (70%), Positives = 525/651 (80%), Gaps = 5/651 (0%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSK--NKEHFLYSFDYYFDRL 75
            AFYLPGVAPTTY   DEIPLLVNHL+PS+Y+Q    +G++   +K  +LYS+DYY+DR 
Sbjct: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRF 79

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PE I K+PESLGSIIFGDRIYNSP+++KMLEEKTCV LC + IPGKDA+FINKLIK
Sbjct: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGFFQNWLIDGLPAA  V+D+ T S+FYG GFELG VE  QA+   A A T PK+  +  
Sbjct: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV---AQAKTHPKEDDSGS 196

Query: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
            +L TR+AKNVQM+KN+E+ YF NH+DI VEYHDRGEG  RVVGV V+P+SIKRS+PGTC
Sbjct: 197 AKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTC 256

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
           +T+GDPL+L E  DN+VYFTYSV+FV S+TVWATRWDKYLHTYDPTIQWF          
Sbjct: 257 QTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVV 316

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     +KAL+SDFARYNE NL+++FQED+GWKL HGDVFRIP KSM         
Sbjct: 317 LLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSG 376

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QLFLMIS SIFFAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM VYKFF+GPYWK 
Sbjct: 377 IQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 436

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           NM+LTP ++PG + L+IVGLN FL+ AHSSG +PA TLFF++LLWF+ S+P A AGSLIA
Sbjct: 437 NMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIA 496

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
           HKKC+WDEHPTKTNQ+ARQ+PFQPWYLKT  AT IAGIFPFGSIAVELYFIYTSLW+NKI
Sbjct: 497 HKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKI 556

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    YHSL LENWQWQWR FIVGGVGCAIY+FVHSILF
Sbjct: 557 FYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILF 616

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           TK KLGGF TIVLYVGYS +ISLL C+VTG+IGFLSS+ FVR+IYS+IKV+
Sbjct: 617 TKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/656 (65%), Positives = 517/656 (78%), Gaps = 7/656 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           +AF LPG++PTTYH+ DEIPLLVN LTPS+YFQ  D NGK  S +KEH+LYS+DYY +R 
Sbjct: 35  KAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNERF 94

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PEH+E+QPESLGSIIFGDRIYNSPF+L+MLE K CV+LC++TIPGKDAKFINKLIK
Sbjct: 95  HFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKLIK 154

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA-PATTKP--KQTT 192
           +GFFQNWL+DGLPAA +V+D +TK+ +YGTGFELG       IDG+  P+T +    +T+
Sbjct: 155 SGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELDSETS 214

Query: 193 NEGLELETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRS 250
           N G  L+ RE KN++  +VK +E+ YFVNH+DI+VE+HDRG+  YRVVGV VNP+SI+RS
Sbjct: 215 NTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIERS 274

Query: 251 TPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXX 310
           +P +C     PL+L E+ DN++YFTYSVKFV S+TVWATRWDKYLH YDP IQWF     
Sbjct: 275 SPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINF 334

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXX 370
                          ++AL SD +RYNE NL+++F ED+GWKLGHGDVFR P KSM    
Sbjct: 335 SVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLLSV 394

Query: 371 XXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKG 430
                 QLFLMI CSIF AALG +SP SRGSL TVMF+ YALFGFVGSYTSM VYKFF G
Sbjct: 395 LVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFFHG 454

Query: 431 PYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFA 490
           PYWK N++LTP ++PG IF+ IV +NFFL+FAHSSGV+PA TLFF+I LWF  SIPL+FA
Sbjct: 455 PYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLSFA 514

Query: 491 GSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSL 550
           GS+IAHK C WDEHPTKTNQIARQ+P+QPWYL+T  AT+IAGIF FGSIAVELYFIY+SL
Sbjct: 515 GSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYSSL 574

Query: 551 WFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFV 610
           WFNKIFYMFGF                    YHSLCLENWQWQWR FI+GG+GC++Y+F+
Sbjct: 575 WFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYMFI 634

Query: 611 HSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           HSILFTKFKLGGF TIVLY GYS +IS L CVVTGAIGF S ++F+RKIYSA+K++
Sbjct: 635 HSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/656 (65%), Positives = 506/656 (77%), Gaps = 7/656 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           +AF LPG++PTTYH  DEIPLLVN LTPS+YFQ  D NG   S +KEHFLYS+DYY +R 
Sbjct: 17  KAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PEH+EKQPESLGS+IFGDRIYNSPF+L+MLEEK CV+LCK TIPG+DA+FIN+LI 
Sbjct: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLII 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAI-DGQAPATTKPKQ--TT 192
           +GFFQNWL+DGLPAA  VYD +TK+ +YGTGFELGF +  Q + D   P T +      +
Sbjct: 137 SGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDAS 196

Query: 193 NEGLELETREAKNVQM--VKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRS 250
           N G  L  R  KN++   VK +E+ YFVNH++I VE+H+RG  +YR+VGV VNPVSI+RS
Sbjct: 197 NAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERS 256

Query: 251 TPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXX 310
           +PG+C  T  PL L ED DN+VYFTYSVKFV S TVWATRWDKYLH YDP IQWF     
Sbjct: 257 SPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIGF 316

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXX 370
                          ++ALKSD  RYNE NL ++F EDAGWKL HGDVFR P KSM    
Sbjct: 317 SVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSV 376

Query: 371 XXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKG 430
                 QLFLMI CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYTSM VYKFF G
Sbjct: 377 LVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHG 436

Query: 431 PYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFA 490
           PYWK N+++TP ++PG I L IV +N FL+FAHSSGV+PA +LFF+I LWF+ SIPL+F 
Sbjct: 437 PYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFV 496

Query: 491 GSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSL 550
           GS++AHK+C+W+EHPTKTNQIARQIP QPWYL+T  ATM+AGIF FGSIAVELYFIY+SL
Sbjct: 497 GSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSL 556

Query: 551 WFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFV 610
           WFNKIFYMFGF                    YHSLCLENW WQWR FI+GG+GC+IY+F+
Sbjct: 557 WFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYMFI 616

Query: 611 HSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           HSILFTKFKLGGF T+VLY+GYS ++S+L CVVTGAIGF SS+IF+RKIY A+KV+
Sbjct: 617 HSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/651 (67%), Positives = 499/651 (76%), Gaps = 14/651 (2%)

Query: 19  AFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDRLH 76
           AFYLPGVAPTTY +GDEIPLLVNHLTPS+ FQ  D  G     NKEHFLYSFDYYF +LH
Sbjct: 19  AFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLH 78

Query: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136
           FCKPEH+EKQPESLGSI+FGDRIYNSPF +KMLE + C SLCK TIP  DAKFINKLIKN
Sbjct: 79  FCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIKN 138

Query: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGL 196
           GFFQNWLIDGLPAA +++D KTKS+FYGTGF LG V   QA+ G A        ++   L
Sbjct: 139 GFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLA--------SSKLNL 190

Query: 197 ELETREAKNVQ-MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
           E   REAKNV  MV N+EI +  NHYDI VEYHDRGEG YRVVGV V+P   K ST   C
Sbjct: 191 ENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDIC 247

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
                 L+L E  DN+V F+YSV+F+PSETVWATRWDKYLH YDPTIQWF          
Sbjct: 248 TKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVVI 307

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     M+ALKSDFARY EFNL+D FQ+D+GWKLGHGDVFRIP KSM         
Sbjct: 308 LLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSG 367

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QLFLM++ SIFFAA+G LSPSSRGSL + MFILYALFGF GSY SM VYKFF GPYWK 
Sbjct: 368 TQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKA 427

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           NM+LTP ++PG +F++IVGLNFFL+F+ SSG +P   L F+I+LWFI SIPL+ AGSLIA
Sbjct: 428 NMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIA 487

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
           +KKC W EHPTKTN+IARQIPFQPWYLKT PAT+IAG+FPFGSIAVELYFIY+SLWFNKI
Sbjct: 488 NKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKI 547

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    Y+SL LENW+WQWR FIVGGVGCA Y+FVHSI+F
Sbjct: 548 FYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIF 607

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           TKFKLGGF TIVLYVGYS +IS L  VVTGAIGF+SS++FV+KIYS++KVD
Sbjct: 608 TKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/660 (63%), Positives = 494/660 (74%), Gaps = 13/660 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
             FYLPGVAPTTYHE D IPLLVNHLTPS++F+  D++G   S +KE+FLYS+DYY+ +L
Sbjct: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78

Query: 76  HFCKP--EHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKL 133
           HFCKP    I+KQPESLGSI+FGDRIYNSPFELKML ++ C  LC + IPG DAKFIN L
Sbjct: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138

Query: 134 IKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTN 193
           IK+GF QNWLIDGLPAA Q+YD+ TKS FYG+GFELG VE  Q +D +AP+ T PKQ   
Sbjct: 139 IKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVD-EAPSHTTPKQPIV 197

Query: 194 EGL-------ELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVS 246
           E +       E  T +  N  +V ++E  YF NH+DI +EYHDRG   YR+VGV VNP+S
Sbjct: 198 EDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPIS 257

Query: 247 IKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFX 306
           +KR +   C+T    L LSE +D DV FTYSV F  S+TVWATRWDKYLH YDPTIQWF 
Sbjct: 258 MKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFS 316

Query: 307 XXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSM 366
                               KALK+DF RYNEFNL D F ED+GWKL HGDVFRIP KSM
Sbjct: 317 LINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSM 376

Query: 367 XXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYK 426
                     QLF MIS  +  AALGFLSPS+RGSL T+MFILYA+FGFVGSYTSM VY+
Sbjct: 377 LLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYR 436

Query: 427 FFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIP 486
           FF GPYWK NM+LTP ++PG IF+ I+ +N FL+F HSS VVP GTL  M+LLW + S+P
Sbjct: 437 FFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLP 496

Query: 487 LAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFI 546
           L+FAGSLI+ K+CTW +HPTKTN++ RQIPFQPWYLKT PAT+I GIFPFGSIAVELYFI
Sbjct: 497 LSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFI 556

Query: 547 YTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAI 606
           Y+SLWFNKIFYMFGF                    YHSLCLENW+WQWR FI+GG+GC+I
Sbjct: 557 YSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSI 616

Query: 607 YVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           Y+F+HSILFT+FKLGGF TIVLYVGYS +I++L  +VTGAIGF+S++ FV+KIYS+IKV+
Sbjct: 617 YIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE 676

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/651 (64%), Positives = 497/651 (76%), Gaps = 22/651 (3%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
           +AFYLPGVAPTTYH  DEI LLVNHLTPS+ FQ  D +G     +KEH+LYS+DYY+ + 
Sbjct: 17  KAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYSKF 76

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFCKPE++ +QP SLGS+IFGDRI+NSPF+L MLEEK CV LC S IPG+DAKF+NKLIK
Sbjct: 77  HFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIK 136

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGF QNWLIDGLPA  +++D +T S FYGTGF+LGFV+                    EG
Sbjct: 137 NGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVD------------------VTEG 178

Query: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
                 E K  +++K +E+ Y  NHYDI +EYHDRG   YRVVGV V+PVSIKRS+  +C
Sbjct: 179 FSDSNDEEK--KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSC 236

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
           +     L LSE  +N+V+FTYSVKF+ S+TVWATRWDKYLH YDPTIQWF          
Sbjct: 237 QYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVV 296

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     ++ALK+D +RYNEFNL+++F ED+GWKL HGDVFRIP +S+         
Sbjct: 297 ALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSG 356

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QLFLMI+CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSMA+YKFFKGP WKV
Sbjct: 357 VQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKV 416

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           N+LLTP ++PG IF+TI+ LNFFL+F  SSG +PAGTLF +ILLWF+FSIPL+FAGSLIA
Sbjct: 417 NLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIA 476

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
           HK+C  D HPTKTNQIARQIP QPWYLKT P ++IAG+FPF SIAVELYFIYTSLWFNKI
Sbjct: 477 HKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKI 536

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    YHSLCLENW+WQWR FI+GG GCAIYVF+HSILF
Sbjct: 537 FYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILF 596

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           TKFKLGGF T+VLY+GYS +IS+L C+VTG+IGF+SS+ F+RKIYS++KVD
Sbjct: 597 TKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/650 (63%), Positives = 489/650 (75%), Gaps = 6/650 (0%)

Query: 19  AFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRLH 76
           AFYLPGVAPTTYH+GDEIPLLVNHLTPS YFQ  D  G   S +KE FLYS+DYY+D+ H
Sbjct: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74

Query: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136
           FC+PE++ KQPESLGSIIFGDRIYNSPFEL MLE KTCV LCKS IP  DAKFINKLI+N
Sbjct: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134

Query: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGL 196
           GFF NWL+DGLPAA +++D +T S FYG GFELGFV+    I  + P T K  ++    +
Sbjct: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI--EDPDTKKVSESDYIEI 192

Query: 197 ELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCE 256
               +E K  +  K  E++YF+NH+DI++EYHDRGE  YRVVGV V P SIKR +  +C+
Sbjct: 193 ADADKELKE-RSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251

Query: 257 TTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXXX 316
           T G+PLVLSEDADN V+FTYSV FVPS+T+WATRWDKYLH YDP IQWF           
Sbjct: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVIL 311

Query: 317 XXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXXX 376
                     +ALK+D +RYNE NL+D+FQE+ GWKL HGDVFR P ++M          
Sbjct: 312 LSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371

Query: 377 QLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVN 436
           QLFLM   +I FA LG LSPSSRGSL TVMFILYALFG  GSYTSMAVYKFF G  WK+N
Sbjct: 372 QLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431

Query: 437 MLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAH 496
           M+LTP +IP  IF++++GLN FL+F HSSG +P GT+  +++LWF+FSIPL+ AGS+I+ 
Sbjct: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491

Query: 497 KKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIF 556
           KK  WD  PT TNQIARQIPFQPWYLKT PA++IAG FPFGSI VELYFIY+SLWFNKIF
Sbjct: 492 KKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550

Query: 557 YMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFT 616
           YMFGF                    Y+SLC+ENW+WQWRGF +GG GCA YVFVH+ILFT
Sbjct: 551 YMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610

Query: 617 KFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           KFKLGG  T+VLY+GYS +IS L C++TGA+GFLSSL FVRKIY +IKVD
Sbjct: 611 KFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/652 (62%), Positives = 486/652 (74%), Gaps = 10/652 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANG-KSKNKEHFLYSFDYYFDRLH 76
            AFYLPGVAPTTYHEGD++PLLVNHLTPS +++  D +   + +KE FLYS+DYY+ + H
Sbjct: 21  EAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDTGDKEGFLYSYDYYYKKFH 80

Query: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136
           FC+P  ++KQPESLGSIIFGDRIYNSPF+L++L+   C SLCKS IPGKDAKFINKLI N
Sbjct: 81  FCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLILN 140

Query: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGL 196
           GFFQNW+IDGLPAA ++ D KT   FYG GFELG V+    +    P T    ++ ++ L
Sbjct: 141 GFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVD---VLSDYEPDT----RSLHDEL 193

Query: 197 ELETREAKNVQMV--KNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGT 254
           EL+    KNV     K  EI YFVNHYDIQ+EYHDRGE  YR+VGV VNP SIKR +P +
Sbjct: 194 ELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDS 253

Query: 255 CETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXX 314
           CE+TG  LVLSE  DN+VYFTYSVKF+ S+TVWATRWDKYLH YDP IQWF         
Sbjct: 254 CESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIV 313

Query: 315 XXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXX 374
                        ALK+D ARYNE NL+ DF+E+ GWKL HGDVFR P+K++        
Sbjct: 314 VLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGS 373

Query: 375 XXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWK 434
             QL LM++ +I FA LGFLSPSSRGSL+TVMF+LYA+FG  GS+TSMA YKFF G  W+
Sbjct: 374 GGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWR 433

Query: 435 VNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLI 494
           +N++LTP ++PG I   ++GLNFFL+F HSSG +P  T+  ++LLWF+ SIPL+  GS+I
Sbjct: 434 LNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVI 493

Query: 495 AHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNK 554
           A KKC W+EHPTKTNQIARQIPFQPWYLKT P  ++AGIFPFGSIAVELYFIY+SLWFNK
Sbjct: 494 AWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNK 553

Query: 555 IFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSIL 614
           I+YMFGF                    YHSLC+ENW+WQWR F++GG GCA YVF HSIL
Sbjct: 554 IYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSIL 613

Query: 615 FTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           FTKF+LGG  TIVLY+GYS +IS L C+VTGAIGFLSSLI VRKIYS +KVD
Sbjct: 614 FTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/666 (61%), Positives = 495/666 (74%), Gaps = 17/666 (2%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK-SKNKEHFLYSFDYYFDRLH 76
             FYLPGVAPTTYHEGD IPLLVNHLTPS+YF+  D +GK + ++E FLYS+DYY+D+ H
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFH 77

Query: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136
           FCKPE +EKQ ESLGSIIFGDRIYNSPF+L+ML++K C +LC S IP  DAKFINKLI N
Sbjct: 78  FCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIAN 137

Query: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQA---IDGQAPATTKPKQTT- 192
           GFFQNWL+DGLPAA +  D +TKSEFY  GFELGF++   A   +DGQ      PK  T 
Sbjct: 138 GFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATK 197

Query: 193 --------NEGLELETREAKNV----QMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGV 240
                   +   + +  + K +    ++VK +E AYF NH++I+V+YHDRG G YRVVGV
Sbjct: 198 PVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGV 257

Query: 241 IVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDP 300
           IVNP SIKR +  +C  TG+ L LSE+ +  V+F+YSVKF PS+TVWATRWDKYLH YDP
Sbjct: 258 IVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVYDP 317

Query: 301 TIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFR 360
            IQW+                     + L+ D +RYN+ NL+DDFQE+ GWKL HGDVFR
Sbjct: 318 KIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVFR 377

Query: 361 IPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 420
            P KS+          QLF+M +C+I FA LG LSPSSRGSL TVMFILYALFG +GSYT
Sbjct: 378 TPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGSYT 437

Query: 421 SMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLW 480
           SMA YKFF G YWKVNM+LTP ++PG +F  ++GLNFFL+   S+G +P GT+  ++LLW
Sbjct: 438 SMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLW 497

Query: 481 FIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIA 540
           F+FSIPL+ AGSLIA KKC W+EHPTKT QI RQIPFQPWYLKT PA +IAGIFPFGSIA
Sbjct: 498 FVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIA 557

Query: 541 VELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVG 600
           VELYF+Y+SLWFNKIFYMFGF                    Y+SLCLENW+WQWRGF +G
Sbjct: 558 VELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFWIG 617

Query: 601 GVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
           G GCA+YVF+H+ILFTKFKLGGF TIVLYVGYS +ISLL C++TGA+GF+SSL FVR+IY
Sbjct: 618 GAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677

Query: 661 SAIKVD 666
           S+IKVD
Sbjct: 678 SSIKVD 683

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/675 (60%), Positives = 483/675 (71%), Gaps = 27/675 (4%)

Query: 19  AFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDRLH 76
            FYLPG AP TY +GD IPLLVNHLTPS+ FQ  D +G     +K   LY +DYY ++LH
Sbjct: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76

Query: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136
           FC+PE IEKQPESLGS+IFG++IYNSPF +KMLE+  CV LC +TIPGKDAKFINKLIKN
Sbjct: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136

Query: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG- 195
           GF QNWLIDGLPAA +++D +T +EFYG GFELGFVE  QA+ G+  + ++ +   +E  
Sbjct: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196

Query: 196 ---------------------LELETREAKNV--QMVKNIEIAYFVNHYDIQVEYHDRGE 232
                                  LE REAKNV   +V N+E+  F NH+DI+VEYHDRG 
Sbjct: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256

Query: 233 GTYRVVGVIVNPVSIKRSTPGTCETTGD-PLVLSEDADNDVYFTYSVKFVPSETVWATRW 291
           G +RVVGVIVNPVS+      +C       L L E+ DN+V FTYSVKF PS+T WATRW
Sbjct: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316

Query: 292 DKYLHTYDPTIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGW 351
           DKYLH YDP IQWF                    ++ALKSD +RYNEFNL D+F+ED+GW
Sbjct: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376

Query: 352 KLGHGDVFRIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYA 411
           KL HGDVFR P  SM          QLFLMI  SI  +ALG LSPSSRGSL T MF+ YA
Sbjct: 377 KLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAMFMFYA 436

Query: 412 LFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAG 471
           +FGFVGSYTSM +YKFFKGPYWK NM+LTP ++PG IFLT++ +N  L F  SS V+P  
Sbjct: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496

Query: 472 TLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIA 531
           TL FM+ LW +FSIPLAFAGSLI++KKC WDEHPTKTN+I RQIPFQPW+LKT PAT+I 
Sbjct: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556

Query: 532 GIFPFGSIAVELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQ 591
           G+  FGSIAVELYFIY+SLWFNKIFYMFGF                    Y +LC ENW 
Sbjct: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616

Query: 592 WQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLS 651
           WQWR F +GG+GC+IY+F+HSILFT+FKLGGFATIVLYVGYS +IS L C+VTGAIGF+ 
Sbjct: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676

Query: 652 SLIFVRKIYSAIKVD 666
           S+ FVR+I+++IKVD
Sbjct: 677 SMFFVRRIFASIKVD 691

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/673 (59%), Positives = 485/673 (72%), Gaps = 27/673 (4%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS-KNKEHFLYSFDYYFDRLH 76
            AFYLPGVAP+TY+EGDE+PLLVNHLTPS+ +Q+ D  GK  +++E  LYSFDYYF +LH
Sbjct: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH 75

Query: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136
           FCKPE I KQP+SLGSI+FGDRIYNSPF +KML+ +  V LC  TIPG DAKFINKLIKN
Sbjct: 76  FCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKN 135

Query: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA-PATTKPKQT---- 191
           GFFQNWLIDGLPAA ++YD  T +EFY  GF LGFVE  + + G   P   K K +    
Sbjct: 136 GFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGKKN 195

Query: 192 -----------------TNEGLELETREAKNV-QMVKNIEIAYFVNHYDIQVEYHDRGEG 233
                              +  + E RE K + ++V N+E  Y  NHY I VE HDRGEG
Sbjct: 196 SNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVEVHDRGEG 255

Query: 234 TYRVVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDK 293
            YRVVGV V+P S   +T       G+ L L E  DN+V F+YSV F+ SETVWATRWDK
Sbjct: 256 NYRVVGVTVDPYS---TTDSANPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATRWDK 312

Query: 294 YLHTYDPTIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKL 353
           YLHTY+PTIQWF                    +KALKSDFARY EFNL++ F ED+GWKL
Sbjct: 313 YLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNEDSGWKL 372

Query: 354 GHGDVFRIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALF 413
           GHGDVFRIP +SM          QLFLMI  SIF AA+G +SPSSRGSL + MF  YALF
Sbjct: 373 GHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALF 432

Query: 414 GFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTL 473
           GF GSY SM+VYKFFKGPYWK NM+LTP ++PGFI ++I+GLNFFL+F HSSG +P   L
Sbjct: 433 GFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTAL 492

Query: 474 FFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGI 533
             ++++WF+ S+PL+F GSL+A+K+  W EHPTKTNQIARQIPFQ WYLKT PA +IAGI
Sbjct: 493 LLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILIAGI 552

Query: 534 FPFGSIAVELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQ 593
           FPFG+IAVELYFIYTSLWFNKIFYMFGF                    Y SLC+ENW WQ
Sbjct: 553 FPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCMENWNWQ 612

Query: 594 WRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSL 653
           WR F +GGVGC++Y+F+HSILFTKFKLGGF T++LY+GY+ ++S+L C+VTGA+GF+SS+
Sbjct: 613 WRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSM 672

Query: 654 IFVRKIYSAIKVD 666
           IFVRKIYS ++VD
Sbjct: 673 IFVRKIYSNVRVD 685

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/670 (60%), Positives = 483/670 (72%), Gaps = 22/670 (3%)

Query: 19  AFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS-KNKEHFLYSFDYYFDRLHF 77
            FYLPGVAPTTYHEGD IPLLVNHLTP++Y+Q  D +G    +KE  LYS+DYY+ + HF
Sbjct: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHF 77

Query: 78  CKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNG 137
           C+PE +EKQ ESLGSIIFGDRIYNSPF+++ML+ K C SLC  +IP  DAKFINKLI NG
Sbjct: 78  CRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNG 137

Query: 138 FFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVE----------SFQAIDGQAPATTK 187
           FFQNWL+DGLPAA +  D +TKSEFY  GFELG+V              + DG    +  
Sbjct: 138 FFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDDSGSHG 197

Query: 188 PKQTTNEGLELETREAKNV-----------QMVKNIEIAYFVNHYDIQVEYHDRGEGTYR 236
             +  +E   L+   AK             ++VK +E  YF NH++I+V+YHDRG G YR
Sbjct: 198 STKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYR 257

Query: 237 VVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLH 296
           VVGVIVNP SIKR +P TC+ TG+ L LSE    +V+F+YSVKF PSETVWATRWDKYLH
Sbjct: 258 VVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYLH 317

Query: 297 TYDPTIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHG 356
            YDP IQWF                       L  D +RYN+ NL+DDFQE+ GWKL HG
Sbjct: 318 VYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHG 377

Query: 357 DVFRIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFV 416
           DVFR P +S+          QLFLM +C+I FA LG LSPSSRGSL TVMFILYALFG  
Sbjct: 378 DVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYALFGSF 437

Query: 417 GSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFM 476
           GSYTSMA YKFF GPYWKVNMLLTP ++PG +F  ++ LNFFL+   S+G +P GT+  +
Sbjct: 438 GSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVI 497

Query: 477 ILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPF 536
           +LLWF+FSIPL+ AGSLIA KKC WDEHPTKT QI RQIPFQPWYLKT PA++IAGIFPF
Sbjct: 498 VLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFPF 557

Query: 537 GSIAVELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRG 596
           GSIAVELYFIY+SLWFNKIFYMFGF                    Y+SLCLENW+WQWRG
Sbjct: 558 GSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWKWQWRG 617

Query: 597 FIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFV 656
           F +GG GCA+Y+F+H+ILFTKF+LGGF TIVLYVGYS ++SLL C++TG +GFLSSL FV
Sbjct: 618 FWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFV 677

Query: 657 RKIYSAIKVD 666
           R+IYS++KVD
Sbjct: 678 RRIYSSVKVD 687

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/654 (57%), Positives = 472/654 (72%), Gaps = 11/654 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYFDRL 75
            AF LPG+ P TY +GD+IPLLVNHLTPS++F   +  GK  S  K++ ++S+DYY+++ 
Sbjct: 16  EAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYYYEKF 75

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+P HIEK   S+GSI+FGDRIYNSPF+L MLE KTCV LC+S IPGKDA+FINKLIK
Sbjct: 76  HFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFINKLIK 135

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAI-DGQAPATTKPKQTTNE 194
           NG++QNW IDGLPAA +VYD++TKS FYG GFELG VE  Q   D   P       + ++
Sbjct: 136 NGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLP------DSVHD 189

Query: 195 GLELETREAKNV--QMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTP 252
             +L  R+AKN+   ++K +E+ YFVNH+DI +EYH+RG G YRVVG  VNPVSI R + 
Sbjct: 190 ISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKSA 249

Query: 253 GTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXX 312
           G C  TG  L L+E+ DN+V+ TYSV FVPS+T W TRWDKYLH YDP IQWF       
Sbjct: 250 GDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFSL 309

Query: 313 XXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXX 372
                        +KALKSDFARYN  NL+DD +E++GWKL HG VFRIP   M      
Sbjct: 310 IVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSILV 369

Query: 373 XXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPY 432
               QLFL+I C++F AA+  LSP  RG+L T M ILY LFGF+ SY SM VYKFFKGPY
Sbjct: 370 GSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGPY 429

Query: 433 WKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGS 492
           WKVNMLLTP ++PG I +T + LN FLMF+ SS VVPA T+  +ILLWF  SIPL+ AGS
Sbjct: 430 WKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAGS 489

Query: 493 LIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWF 552
           L+A KKC WDEHPT TNQIA+ IP Q WYLKT PA++I G+F FGSI+V+LYFIYTSLWF
Sbjct: 490 LMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLWF 549

Query: 553 NKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHS 612
           N IFYM+GF                    YHSLC ENW+WQWRGF +GG+GC+IYV +HS
Sbjct: 550 NNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLHS 609

Query: 613 ILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           + F + KLGGF  I+LY+GYS++++ L  +VTG++GFLSS+ F+++I+S++KVD
Sbjct: 610 LFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/653 (55%), Positives = 470/653 (71%), Gaps = 5/653 (0%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDRL 75
            AFY+PG++  TYH GD I L VN LTPS+YF+ TD NG+S   +KEHFLYS+DYY+D+ 
Sbjct: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFC+PE +E++ ESLGS++FGDRIYNSPFEL MLE K CV LCK+TIP  DAKFINKLIK
Sbjct: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGFF NWLIDGLP+A ++YD KT+S FY +GF LG V       G         +  NE 
Sbjct: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199

Query: 196 LEL-ETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTP 252
           ++  + REAKNV   ++   E+ YF NH++I +EYHDRG   YRVVGV V+P+SIKR   
Sbjct: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259

Query: 253 GTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXX 312
            +C  TG+ L L+E+A+N V FTYSV F+ SET WATRWDKYLHTYDP+IQWF       
Sbjct: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFTI 319

Query: 313 XXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXX 372
                        ++ALK D +RY + NL++ F ED+GWKL HGDVFR+P K+M      
Sbjct: 320 VVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379

Query: 373 XXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPY 432
               QLFLMI C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTSM VYKFF GPY
Sbjct: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439

Query: 433 WKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGS 492
           WK NM+LTP ++PG + L I+ LNFFL+  HSSG +PA T+  MI LW + S+PL+F GS
Sbjct: 440 WKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499

Query: 493 LIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWF 552
            +A KKC W+++PT  N+I R+IP QPWY+++ P  +++GI PFG+IAVELYFIY+SLW+
Sbjct: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559

Query: 553 NKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHS 612
           NKIFYMFGF                    YHSLCLENW+WQWR F+ GG+GCA Y+F++S
Sbjct: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619

Query: 613 ILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKV 665
           I FT+FK  GF +I+LY+GYS++I ++ C++TGA+ F+ ++ FV++I+++IKV
Sbjct: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/651 (56%), Positives = 457/651 (70%), Gaps = 12/651 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDRL 75
           RA +LPG++PT Y    EI L VNHLTPS +FQ  D +G +   +KEH+LYS+DYY  +L
Sbjct: 16  RASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKL 75

Query: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
           HFCKPE++ +Q ESLGS++FGDR+YNSPF+L MLE+K+CVSLCKS IPG+DA FINKLIK
Sbjct: 76  HFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIK 135

Query: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195
           NGF  NWL+DGLPA T + + +  S     GF LG VE  Q +   A AT  P++ T   
Sbjct: 136 NGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMAT--PREETG-- 191

Query: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255
                  A    +V N+E+ +  NHYDI ++YH+   G YR+VGV V P SIK+ T  +C
Sbjct: 192 -----ISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSC 245

Query: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXX 315
           E TG+ + LSED DN+V +TYSV++V     WATRWD Y  +YD T+QWF          
Sbjct: 246 EFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVI 305

Query: 316 XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXX 375
                     ++ALKSDFARYNE NL+D+F E++GWKL HGDVFR+P+KS+         
Sbjct: 306 GLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSG 365

Query: 376 XQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435
            QL L+    I  AA+ F +  SR  L T+ F+LYALFGFVGSY SM VY+FFKGPY KV
Sbjct: 366 VQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKV 425

Query: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495
           NM+LTPF+IPG I LTI+ LNFFL+ AHSS  +P   LF ++LLW I S+PL+ AGSL A
Sbjct: 426 NMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA 485

Query: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
            K C+WD+HPTKTNQIARQIPFQPWYLKT PA ++AGIFPF SIAVELYFIY SLWF++ 
Sbjct: 486 IKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQF 545

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615
           FYMFGF                    YHSLCLENWQWQWR FIVGG+G A+Y+F+HSI F
Sbjct: 546 FYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFF 605

Query: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           T+FKL GF TIVLYVGYS +IS+L C+ TGA+GF SS+  VRKI+S++KVD
Sbjct: 606 TEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/650 (56%), Positives = 464/650 (71%), Gaps = 12/650 (1%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHF 77
           + FYLPG APTTY  GD IPLLVNH+TP+V+          ++KE +LY++DYY+ RLH 
Sbjct: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERYLYAYDYYYPRLHM 74

Query: 78  CKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNG 137
           C+P+ IEK  ESLGSIIFGDR++NSPFELKMLEEK+CV+LC+ T+P +DAKFIN+LI++G
Sbjct: 75  CRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSG 134

Query: 138 FFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLE 197
           FF NWL+DGLPA  +++D +T + FYGTGFELG     + I G    T    Q     +E
Sbjct: 135 FFHNWLVDGLPAGREMHDARTNTVFYGTGFELG-----RVIRG----TEDRNQEEPGEIE 185

Query: 198 LETREAKNVQMVKNI-EIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCE 256
           L+TR    +Q  +++  + YF+NH++I V+YH R E   RVVGV V P S++      C 
Sbjct: 186 LQTRRV--LQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCA 243

Query: 257 TTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXXX 316
            +G+ LVLSE AD  V FTYSV+F  S+  WATRW KYLH YDP +QW+           
Sbjct: 244 NSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLL 303

Query: 317 XXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXXX 376
                     +ALK+D  RYN+FNL+++FQED GWKL H DVFR P K++          
Sbjct: 304 LSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGG 363

Query: 377 QLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVN 436
           QLFLM +C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM+ YK F G  WKVN
Sbjct: 364 QLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVN 423

Query: 437 MLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAH 496
           M+LTP ++PG IF T++ +NFFL+   SSG +P GT+  +++LWF+ SIP++  GSL A 
Sbjct: 424 MVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFAR 483

Query: 497 KKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIF 556
           KK TWD+HPTKT+QIA+QIP QPWYL+TWPA  IAG+FPFG+IAVELYFIYTS+WFN +F
Sbjct: 484 KKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMF 543

Query: 557 YMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFT 616
           YMFGF                    Y+SLC+ENW WQWR FI+GG+GC+ YVF++SILFT
Sbjct: 544 YMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFT 603

Query: 617 KFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           KF+LGGF TIVLYVGYS +IS LFC+VTG IGF+SSL FVRKIYS+IKVD
Sbjct: 604 KFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/627 (55%), Positives = 439/627 (70%), Gaps = 15/627 (2%)

Query: 47  VYFQRTDANGK--SKNKEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPF 104
           +++   +  G+  S + +  +YS+DYY+++LHFCKPEH+EK   S+GS++FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 105 ELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYG 164
           +L ML+ KTC  LC STI G+DAKFINKLIKNG++QNWLIDGLPAA +VYD +TKS FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 165 TGFELGFVESFQAIDGQAPATTKPKQTTNEG---LELETREAKNV--QMVKNIEIAYFVN 219
            GFELG VE  Q        TT  K   N      +L  R+AKN+   ++++IE+ YFVN
Sbjct: 121 NGFELGLVEIRQ--------TTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVN 172

Query: 220 HYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVK 279
           H+DI++EYHDRG   YRVVGV VNPVSI RS  G C+ TG  L LSE   N ++FTYSV+
Sbjct: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232

Query: 280 FVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEF 339
           F+PSET W TRWDKYLH YDPTIQW                     ++ALKSDF+RY E 
Sbjct: 233 FIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGEL 292

Query: 340 NLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSR 399
           NL++  +EDA WKLGHGDVFR P   M          QLFLMI C+IF  A+G ++P SR
Sbjct: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352

Query: 400 GSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFL 459
           G+L TVMF+LY  F F+ S+ SM VYKFF G  W +N +LTPF++PG + L I+GLN FL
Sbjct: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFL 412

Query: 460 MFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQP 519
           +F HSSGV+P  T   +ILLWF   +PL+  GSL+A K C WD HPTKTN +++ IP Q 
Sbjct: 413 IFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472

Query: 520 WYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXX 579
           WYL+T PA++I G+F FGS++VELYF+YTSLWFNKIFYM+GF                  
Sbjct: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVL 532

Query: 580 XXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLL 639
             Y+SL  ENWQWQWR F++ G+GC+ YVF+HS+LFT+ KLGGF   +LY+GYS +I+ L
Sbjct: 533 FTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592

Query: 640 FCVVTGAIGFLSSLIFVRKIYSAIKVD 666
             VVTGA+GFLSS++FVR IYSA+KVD
Sbjct: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/648 (46%), Positives = 395/648 (60%), Gaps = 58/648 (8%)

Query: 19  AFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFC 78
            FY PGV+P TYH GDEIPLLVN+L+                   FL++ DYY D +  C
Sbjct: 16  GFYFPGVSPVTYHIGDEIPLLVNYLS-----------------SDFLWNIDYYSDSIGLC 58

Query: 79  KPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGF 138
           KP  I++Q ESLGS+IFGDR+YNSPF++ ML+   CV LC +TI   D    N      +
Sbjct: 59  KPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFFGYRY 115

Query: 139 FQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLEL 198
             NWL+DGLP                             IDG + A       +   +  
Sbjct: 116 SYNWLVDGLPVL--------------------------GIDGTSDANGY-HNNSELFMGY 148

Query: 199 ETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETT 258
           +  E K           Y  NH+DI + Y+DRG+G YRVV     P+S+ R+    C   
Sbjct: 149 QADEQK-----------YIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKD 197

Query: 259 GDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFXXXXXXXXXXXXX 318
             P+ +      ++ FTYSV F  S+  W+TRWD+YLH YD  IQ               
Sbjct: 198 AKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLS 257

Query: 319 XXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXXXXQL 378
                   + LK D A Y+EFNL+D+FQ+D  WK+ HG+VFR P K++          QL
Sbjct: 258 SVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQL 317

Query: 379 FLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNML 438
           F M  C++   + GFLSPS+RGSL TVMF+LYALFG VGSYTSM++YKFF G  WK+N++
Sbjct: 318 FFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLI 377

Query: 439 LTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKK 498
           LTP +IP F+F+T V LNFFL++A SSG +P GT+  +I+LWFI S+P++  GSL++ K 
Sbjct: 378 LTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKL 437

Query: 499 CTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYM 558
             WDEHP KTNQIARQ+P QPWY+KTW AT +AG+FPFG++AVELY+IY S+W   IF+M
Sbjct: 438 NRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFM 497

Query: 559 FGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKF 618
           +GF                    Y+SLC+ENW+WQWR FI+GGVGC++YVF+HS+ F KF
Sbjct: 498 YGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKF 557

Query: 619 KLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           K  GF ++VLY+GYS M+S++ C+VTG+IGFL++L FVRKIYS IKVD
Sbjct: 558 KFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  151 bits (381), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 171/689 (24%), Positives = 269/689 (39%), Gaps = 119/689 (17%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y +GD + L+VN +                  E  L    Y +  L F  P  + 
Sbjct: 42  LRPNYYSKGDPVELIVNKV------------------ESDLTQLPYAYYDLPFTCPPTMH 83

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  II GDR + S + L   E+  C  LC      +  K   +L+KNG+   W
Sbjct: 84  KKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQW 143

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPA T         ++Y +GF LGFV+         P T K              
Sbjct: 144 LIDDELPAVTTFISTTDHKKYYASGFPLGFVD---------PETGK-------------- 180

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVS-IKRSTPGTCETTGD 260
                         Y   H  I + Y+      + + G  + P S +    PG  +    
Sbjct: 181 -------------TYLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQ 227

Query: 261 -PLVLSEDADNDVY--FTYSVKFVPSETV-WATRWDKYLH----TYDPTIQ--WFXXXXX 310
             LV+ E+ D+  +  FTYSV +     V W  RWD YL+    + D + Q  W      
Sbjct: 228 YELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANS 287

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXX 370
                           +  K     +++ + E+D           G ++ +  K +    
Sbjct: 288 FGIVFLISSITAVILYRTFKISRRSFSDISKEED---------DKGSIYVVARKWLLNEQ 338

Query: 371 X-XXXXXQLFLMISCSIFFAALGFLSPSS--------RGSLATVMFILYALFGFVGSYTS 421
                   +F+ +     F  LG L  S         R S+ T+  + +    F+ S+T 
Sbjct: 339 TPLANVLIIFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTG 398

Query: 422 MAVYKFFK----------GPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAG 471
             + K  +            Y+ V  LL   ++P F+ L  + LN  +    S+  +P G
Sbjct: 399 AHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFG 458

Query: 472 TLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIA---------RQIPFQPWYL 522
           T+ F+I ++F+  IPL+  G  IA K    +  P+ +  I          + I   P  L
Sbjct: 459 TVLFLISVYFVVCIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVL 516

Query: 523 KTWP----ATMIAGIFPFGSIAVELYFIYTSLWFNKI--FYMFGFXXXXXXXXXXXXXXX 576
              P    A +  G+FPF  I VEL ++Y SLW  K   +Y +GF               
Sbjct: 517 INRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEI 576

Query: 577 XXXXXY---HSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLG--GFATIVLYVG 631
                +   +S    +  W+W  F +G   CA Y+ V+S+ +  F L   GF++I + V 
Sbjct: 577 SIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVC 635

Query: 632 YSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
           Y T+ +++    TG+I  L+S  FV+KIY
Sbjct: 636 YGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  145 bits (367), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 164/710 (23%), Positives = 277/710 (39%), Gaps = 135/710 (19%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y +GD + L+VN +                  E  L    Y +  L F  P  + 
Sbjct: 52  ITPNFYRKGDPLELIVNKV------------------ESDLTQLPYAYYDLPFTCPPTMH 93

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  II GDR + S ++LK  E+  C +LC      +  + ++KL++ G+   W
Sbjct: 94  KKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQW 153

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPAAT         ++Y +GF LGF++         P T K              
Sbjct: 154 LIDDELPAATTFISTTDHKKYYASGFPLGFID---------PDTDK-------------- 190

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
                         Y  NH  + + +H        +VG  V P S+     PG  +    
Sbjct: 191 -------------TYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQ 237

Query: 261 -PLVLSEDADNDVY--FTYSVKFVPS-ETVWATRWDKYLH----TYDPTIQ--WFXXXXX 310
             +V+ ED +   Y  FTYSV +    E  W  RWD +L+    + + +IQ  W      
Sbjct: 238 YEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANS 297

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNE---------FNLEDDFQEDAGWKLGHGDVFRI 361
                          ++ + +D +                EDD  +D   K G   V+ +
Sbjct: 298 VGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDD---KYGKYSVYTV 354

Query: 362 PHKSMXXXXXXXXXXQ-LFLMISCSI--FFAALGFLSPSS--------RGSLATVMFILY 410
               +          + L L++S  +   F  +G L+ S         R S+ T+  + +
Sbjct: 355 AKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFF 414

Query: 411 ALFGFVGSYTSMAVYKFFKGPYWKVNML------------------LTPFMIPGFIFLTI 452
            L  F+ S+    +    K    K N L                  L    +PG + ++ 
Sbjct: 415 VLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVST 474

Query: 453 VGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHK---------KCTWDE 503
             LN  +    S+  +P  T+ F + ++FI  IPL+  G ++A+            T DE
Sbjct: 475 FLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDE 534

Query: 504 HPTKTNQI---ARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI--FYM 558
             +  N +     +  F P     +    + GIFP   I VE+ ++Y SLW  K   +Y 
Sbjct: 535 SNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYF 591

Query: 559 FGFXXXXXXXXXXXXXXXXXXXXY--HSLCLENW----QWQWRGFIVGGVGCAIYVFVHS 612
           +GF                    Y     C E+      W+W+ F +G  G  +Y+ ++S
Sbjct: 592 YGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYS 650

Query: 613 I--LFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
           +  +F    + GF++I++ + YS + +++  +  GA+ +L++  F+ KIY
Sbjct: 651 LYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  138 bits (347), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 162/694 (23%), Positives = 265/694 (38%), Gaps = 122/694 (17%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y +GDE+ L+VN +                  E  L    Y +  L F  P  + 
Sbjct: 41  LQPNFYFQGDEVELIVNKV------------------ESDLTQLPYAYYDLPFTCPPTMH 82

Query: 85  KQP--ESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  II GDR + S + LK  ++ TC  LC      +  K   KL+++G+   W
Sbjct: 83  KKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQW 142

Query: 143 LID-GLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPAAT       + ++Y +GF LGFV+         P T K              
Sbjct: 143 LIDEELPAATTFISTIDQKKYYASGFPLGFVD---------PDTGK-------------- 179

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
                         Y   H  + + Y+      + +VG  V P S+     PG  +    
Sbjct: 180 -------------VYLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEP 226

Query: 261 PLVLSEDADND---VYFTYSVKFVPSETV-WATRWDKYLH----TYDPTIQ--WFXXXXX 310
             ++  + D+D   + FTYSV +     V W  RWD YL+    + + T Q  W      
Sbjct: 227 YEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANS 286

Query: 311 XXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVF--RIPHKSMXX 368
                          +++ KS      + N  ++ +    +++    +   R P  ++  
Sbjct: 287 AGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINERTPLANLLI 346

Query: 369 XXXXXXXXQLFLMISCSIFFAALGFLSPSSR--------GSLATVMFILYALFGFVGSYT 420
                    LF+ +     F  LG L+ S           S+ T+  + + L  F+ SY 
Sbjct: 347 ---------LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYI 397

Query: 421 SMAVYKFFKGPYWKVN----------MLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPA 470
              + +       K             +L    +PG + +  + LN  +    S+  +P 
Sbjct: 398 GSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPF 457

Query: 471 GTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDE------HPTKTNQIARQIPFQP----- 519
            T+   I ++FI  IPL+  G  +A+   T         H ++          +P     
Sbjct: 458 KTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIF 517

Query: 520 ------WYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI--FYMFGFXXXXXXXXXX 571
                   +K     +++GIFPF  I VEL ++Y S+W  K   +Y +GF          
Sbjct: 518 LFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCI 577

Query: 572 XXXXXXXXXXYHSLCL---ENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLG--GFATI 626
                     Y  L +    N  W+W  F +G   CA Y+ ++S+ +  F L   GF++I
Sbjct: 578 VVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSI 636

Query: 627 VLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
            + V Y  + + L     G+I  L+S  FV K+Y
Sbjct: 637 FISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  137 bits (345), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 166/712 (23%), Positives = 282/712 (39%), Gaps = 128/712 (17%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y  GD + L+VN +                  E  L    Y +  L F  P  + 
Sbjct: 52  ITPNFYKNGDPLELIVNKV------------------ESDLTQLPYAYYDLPFTCPPTMH 93

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K P   SL  II GDR + S ++L   E+  C  LC      +  + ++KLI+ G+   W
Sbjct: 94  KTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVVQW 153

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPAAT         ++Y +GF LGF++         P T K              
Sbjct: 154 LIDDELPAATTFISTTDHKKYYASGFPLGFMD---------PDTGK-------------- 190

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
                         Y  NH  + + +H    G   +VG  V P S+     PG  +T   
Sbjct: 191 -------------TYLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQ 237

Query: 261 -PLVLSEDADNDVY--FTYSVKFVPS-ETVWATRWDKYLHTYDPT------IQWFXXXXX 310
             + + ED +   Y  FTYSV +    E  W  RWD +L++ + +        W      
Sbjct: 238 YEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANS 297

Query: 311 XXXXXXXXXXXXXXXMKALKSD--FARYNEF--NLEDDFQEDA--GWKLGHGDVFRIPHK 364
                          +  + +D      N+F  N+E    ED     K     V+ +   
Sbjct: 298 VIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVYMVAKD 357

Query: 365 SMXXXXXXXXXXQ-LFLMISCSI--FFAALGFLSPSS--------RGSLATVMFILYALF 413
            +          + L +++S  +   F  +G L+ S         R S+ T+  + + + 
Sbjct: 358 WIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIG 417

Query: 414 GFVGSY--TSMAVY---KFFKGPYWKVN-------------MLLTPFMIPGFIFLTIVGL 455
            F+ S+  T +++    + F   Y+  N              ++    +PG I ++   L
Sbjct: 418 AFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLL 477

Query: 456 NFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHK---------KCTWDEHPT 506
           N  +    S+  +P  T+ F I ++FI  IPL+  G ++A+            T DE  +
Sbjct: 478 NSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDS 537

Query: 507 KTNQIARQIPFQPWYLKTWPATMI--AGIFPFGSIAVELYFIYTSLWFNKI--FYMFGFX 562
           K N++   +P  P          I   G+FP   I VE+ ++Y SLW  K   +Y +GF 
Sbjct: 538 KNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFL 595

Query: 563 XXXXXXXXXXXXXXXXXXXY--HSLCLENW----QWQWRGFIVGGVGCAIYVFVHSI--L 614
                              Y     C E+      W+W+ F +G  G  +Y+ ++S+  +
Sbjct: 596 FLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYI 654

Query: 615 FTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           F    + GF++I++ + YS + +++  +  GA+ +L++  F+ KIY  +KV+
Sbjct: 655 FAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIYH-VKVN 705

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  133 bits (335), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 168/729 (23%), Positives = 277/729 (37%), Gaps = 168/729 (23%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHF-CKPEHI 83
           + P  Y E D + ++VN +                  E  L  F Y +  L F C P ++
Sbjct: 56  IRPNVYEENDPVEIIVNKI------------------ESDLTQFPYAYYELPFTCPPTNV 97

Query: 84  EKQPE-SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           +K    SL  II GDR + S + L   +++ C+ LC         +  ++LIK G+   W
Sbjct: 98  KKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQW 157

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPAAT     K   ++Y +GF LGF++                            
Sbjct: 158 LIDDELPAATTFISTKDHKKYYASGFPLGFMD---------------------------- 189

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDP 261
                   K+    Y  NH  + + YH      + +VG+ V P S+            D 
Sbjct: 190 --------KDTGKTYLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASKNFDH 241

Query: 262 LVLSEDADNDVY--FTYSVKFVPSETV-WATRWDKYLHTYDPT------IQWFXXXXXXX 312
             ++ +     Y  FTYS+ +     V W  RW+ ++++ + +        W        
Sbjct: 242 YEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVV 301

Query: 313 XXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXX 372
                         K++ +D     E       Q  + W + H   + + H ++      
Sbjct: 302 IVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHS--YLLNHLNVFTAMGV 354

Query: 373 XXXXQLF--LMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFV-GSYTSMAVYKFFK 429
                +   L+ISCS+          + R S+ T+     AL  F+ G+YTS  V     
Sbjct: 355 QFLFTILGSLIISCSMNKLH------NIRNSVLTM-----ALMCFISGAYTSSFVGALLS 403

Query: 430 GPY---WKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIP 486
             +    K+++      +PGF    ++ LN  +    S+  +P GT+  +I ++FI  IP
Sbjct: 404 ANHNTTIKISIACGS-ALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIP 462

Query: 487 LAFAGSLIA---HKKCT-----------------WDEHPTKTNQI-------ARQIPF-- 517
           L+  G + A    +KC                  +D+ P   N++         ++P   
Sbjct: 463 LSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLML 522

Query: 518 -QPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI--FYMFGFXXXXXXXXXXXXX 574
            QP  L     T+I+GI PF  I VEL F+Y SLW  K   +Y++GF             
Sbjct: 523 RQPVLL-----TVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVC 577

Query: 575 XXXXXXXYHSL----------------------------------C---LENWQWQWRGF 597
                  Y +L                                  C   L   QW+W+ F
Sbjct: 578 EISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRWKSF 637

Query: 598 IVGGVGCAIYVFVHSILF--TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIF 655
            +GG   A Y+  +S+ +  T  K+  F++I+L+  YS + + L     GA+G+LS   F
Sbjct: 638 QIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWF 696

Query: 656 VRKIYSAIK 664
           V +I++  K
Sbjct: 697 VNRIHTNSK 705

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 156/719 (21%), Positives = 275/719 (38%), Gaps = 135/719 (18%)

Query: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHF 77
             +Y   + P  Y +GD + L+VN +                  E  L    Y +  L F
Sbjct: 45  NTYYDGWITPNFYKKGDPLELIVNKV------------------ESDLTQLPYAYYDLPF 86

Query: 78  CKPEHIEKQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135
             P  + K+P   SL  II GDR + S + L   E+  C +LC      +  + ++KL++
Sbjct: 87  TCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLVR 146

Query: 136 NGFFQNWLIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNE 194
            G+   WLID  LPAAT         ++Y +GF LGFV+         P T K       
Sbjct: 147 EGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD---------PDTGK------- 190

Query: 195 GLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPG 253
                                Y  NH  + + +H        +VG  V P S+     PG
Sbjct: 191 --------------------TYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPG 230

Query: 254 TCETTGD-PLVLSEDADNDVY--FTYSVKFVPS-ETVWATRWDKYLHTYD------PTIQ 303
             +      +V+ ED +   Y  FTYSV +    E  W  RWD +L++ +          
Sbjct: 231 ASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFH 290

Query: 304 WFXXXXXXXXXXXXXXXXXXXXMKALKSDFARYNE---------FNLEDDFQEDAGWKLG 354
           W                     ++ +  D    +            +ED+  +D   K G
Sbjct: 291 WMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDD---KYG 347

Query: 355 HGDVFRIPHKSMXXXXXXXXXXQLFLMI---SCSIFFAALGFLSPSS--------RGSLA 403
              V+ +    +          ++ +++        F  +G L+ S         R S+ 
Sbjct: 348 KNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVI 407

Query: 404 TVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNML-----------LTPFM-------IP 445
           T+  + + L  F+ S+    +    K    ++N L            +P         +P
Sbjct: 408 TMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLP 467

Query: 446 GFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHK-------- 497
           G + ++   LN  +    S+  +P  T+ F I ++FI  IPL+  G  +A+         
Sbjct: 468 GLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWL 527

Query: 498 -KCTWDEHPTKTNQI---ARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFN 553
              T DE    ++++     +  F P     +    + G+FPF  I VEL ++Y S+W  
Sbjct: 528 SGITKDETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLFPFLVIYVELQYVYKSVWLE 584

Query: 554 KI--FYMFGFXXXXXXXXXXXXXXXXXXXXYHSL--CLENW----QWQWRGFIVGGVGCA 605
           K   +Y +GF                    Y  +  C E+      W+W+ F +G  G  
Sbjct: 585 KTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-G 643

Query: 606 IYVFVHSI--LFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSA 662
           +Y+ ++S+  +F    + GF++ ++ + YS + +++  +  G + +L++  F+ KIY +
Sbjct: 644 VYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  131 bits (329), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 163/690 (23%), Positives = 264/690 (38%), Gaps = 113/690 (16%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y  GD + LLVN +                  E  L  F Y +  L F  P   +
Sbjct: 41  LQPNVYRWGDHVELLVNKV------------------ESDLTQFPYGYYDLPFTCPPTED 82

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  II GDR + S ++LK  ++ +C +LC         +   +L++ G+   W
Sbjct: 83  KKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQW 142

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPAAT         ++Y +GF LGFV+         P T K              
Sbjct: 143 LIDQELPAATTFISTIDHKKYYVSGFPLGFVD---------PDTEK-------------- 179

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
                         Y   H  + + Y+     T+ +VG  V P S+     PG  +    
Sbjct: 180 -------------TYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQ 226

Query: 261 -PLVLSEDADNDVY--FTYSVKFVPSETV-WATRWDKYLHTYDPT------IQWFXXXXX 310
             L++ E+ D   Y  FTYSV +     V W+ RW+ +L++ + +        W      
Sbjct: 227 YELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNS 286

Query: 311 XXXXXXXXXXXXXXXMKALKSDF-ARYNEFNLEDDFQEDAG--------WKLGHGDVFRI 361
                           + ++    A   EF    D  E+A         W L   D   I
Sbjct: 287 VGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTW-LAQTDSSSI 345

Query: 362 PHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFIL----YALFGFVG 417
             K +           LF +I    F  +L  L       L+   F L    Y    FVG
Sbjct: 346 SFKILTIFVSIGVQF-LFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVG 404

Query: 418 SYTSMAVYKFFKGPYWKVNM--LLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFF 475
           ++  +       G   +     +L    +PG + ++   LN+ +    SS  +P  T+  
Sbjct: 405 TWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVL 464

Query: 476 MILLWFIFSIPLAFAGSLIAHK--KCTWDEHPTKTNQIARQIPFQPWYLKTWPAT----- 528
            + ++F+  IPL+  G  ++H+  +      P  ++  AR I  +P    T  A      
Sbjct: 465 FVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAPRKISE 522

Query: 529 ---------MIAGIFPFGSIAVELYFIYTSLWFNKI--FYMFGFXXXXXXXXXXXXXXXX 577
                     I G  PF  I VEL +IY S+W  K   +Y++GF                
Sbjct: 523 RLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVS 582

Query: 578 XXXXY-----HSLCLENWQWQWRGFIVGGVGCAIYVFVHSI--LFTKFKLGGFATIVLYV 630
               Y     H        W+W+ F++ G  CA Y+ ++S+  +F   K+ GF +I + V
Sbjct: 583 FLGCYVMMRKHKRVATFDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLKMTGFPSIFISV 641

Query: 631 GYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
            YS + +++     G++G+L+S   V +++
Sbjct: 642 SYSLIFNIMCGCGMGSLGYLTSCWLVNRVF 671

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  128 bits (322), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 157/715 (21%), Positives = 271/715 (37%), Gaps = 135/715 (18%)

Query: 20  FYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCK 79
           +Y   + P  Y + D + L+VN +                  E  L    Y +  L F  
Sbjct: 48  YYDGWITPNFYKKNDFLELIVNKV------------------ESDLTQLPYAYYDLPFTC 89

Query: 80  PEHIEKQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNG 137
           P  + K+P   SL  II GDR + S ++L+  E+  C +LC      K  + ++KL++ G
Sbjct: 90  PPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREG 149

Query: 138 FFQNWLIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGL 196
           +   WLID  LPAAT         ++Y +GF LGFV+         P T K         
Sbjct: 150 YVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD---------PDTDK--------- 191

Query: 197 ELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTC 255
                              Y  NH  + + +H  G+    VVG  V P S+     PG  
Sbjct: 192 ------------------TYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGAS 233

Query: 256 ETTGD-PLVLSEDADNDVY--FTYSVKFVPS-ETVWATRWDKYLHTYD------PTIQWF 305
           +      +V+ ED  +  Y  FTYSV +    E  W  RW+ +L+  +          W 
Sbjct: 234 KNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHWM 293

Query: 306 XXXXXXXXXXXXXXXXXXXXMKALKSDFARYNE---------FNLEDDFQEDAGWKLGHG 356
                               ++ +++D    +             ED   +D   K G  
Sbjct: 294 SLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDD---KYGKN 350

Query: 357 DVFRIPHKSMXXXXXXXXXXQLFLMI---SCSIFFAALGFLSPSS--------RGSLATV 405
            V+ +    +          ++ +++        F  +G L+ S         R S+ T+
Sbjct: 351 SVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTM 410

Query: 406 MFILYALFGFVGSYTSMAVYKFFKGPYWKVNML-----------LTPFM-------IPGF 447
             + + L  F+ S+    +    K     VN L            +P         +PG 
Sbjct: 411 AILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGM 470

Query: 448 IFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHK---------- 497
           + +    LN  +    S+  +P  T+ F I ++F+  IPL+  G ++A+           
Sbjct: 471 VMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSG 530

Query: 498 --KCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555
             K   D + +K  +   +  F P          + GIFP   I VE+ ++Y SLW  K 
Sbjct: 531 ITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKT 587

Query: 556 FYMFGFXXXXXXXXXXXXXXXXXXXXYHSL----CLENWQ----WQWRGFIVGGVGCAIY 607
            + F +                       L    C ++ +    W+WR F +G  G  +Y
Sbjct: 588 TFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVY 646

Query: 608 VFVHSI--LFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
           + ++S+  +F    + GF++I++ + YS + ++L  +  GA+  L++  F+ +IY
Sbjct: 647 MELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  121 bits (304), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 163/691 (23%), Positives = 271/691 (39%), Gaps = 135/691 (19%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y  GD + L+VN +   +    TD              F YY   L F  P   E
Sbjct: 41  LKPNVYSIGDPLELVVNTVESEI----TDI------------PFGYY--DLPFTCPPTPE 82

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  II GDR + S ++L + ++  C  LC      +  +    LIK+G+   W
Sbjct: 83  KKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQW 142

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           +ID  LPAAT         ++Y  GF LG V+         P +++              
Sbjct: 143 MIDDDLPAATTYISTTDNLKYYAPGFPLGSVD---------PRSSR-------------- 179

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTC----- 255
                         +F NH  + + Y+        +VG    P S+     PG       
Sbjct: 180 -------------VFFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGASKDFKP 226

Query: 256 -ETTGDPLVLSEDADNDVYF--TYSVKFVP-SETVWATRWDKYLH------TYDPTIQWF 305
            E T  PL      +  VY   TYSV +   +E  W+ RW  Y++      +   T  W 
Sbjct: 227 FEITDPPL------EEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWM 280

Query: 306 XXXXXXXXXXXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKS 365
                               +   ++     NE  LE    ED+       D+F + +  
Sbjct: 281 ALANSVGIVLFVTFIVIVNLIMIFRNP----NE-QLESKENEDSS------DIFNVANNW 329

Query: 366 MXXXXXXXXXXQLFLMISC-----SIFFAALGFLSPS-----------SRGSLATVMFIL 409
           +          QL  +I C      + F  LG L+ S           S  ++A + F+ 
Sbjct: 330 LRARQGF----QLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVA 385

Query: 410 YALFG-FVGSYTSM----AVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHS 464
            A    FVG++  M    + Y F+      V  +L    +PG I +  + LN  +    S
Sbjct: 386 GAFMASFVGTWLKMDQNISAYTFYN----PVFAVLCGSALPGSIMVLTLSLNCIIWIWDS 441

Query: 465 SGVVPAGTLFFMILLWFIFSIPLAFAGSLIA---HKKCTWDEHPTKT---NQIARQIPFQ 518
           +  +P GT+   +  +F+  I ++  G  +A   H+    D  P  T    ++ R+    
Sbjct: 442 TKALPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAI 501

Query: 519 PWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNK--IFYMFGFXXXXXXXXXXXXXXX 576
              L  + A +I+G  PF  I VEL ++Y S+W  K  ++Y++ F               
Sbjct: 502 SGKLVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEI 561

Query: 577 XXXXXYHSLCLE-----NWQWQWRGFIVGGVGCAIYVFVHSILFTKF--KLGGFATIVLY 629
                   + L      +  W+WR F++   GC+ Y+ ++S+ +  F   + G + + + 
Sbjct: 562 SLLGCLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAVFIS 620

Query: 630 VGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660
           V YS + ++L  + TG++G+L+S  FV+KI+
Sbjct: 621 VCYSFIFNVLCGLATGSLGYLTSSWFVKKIH 651

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  114 bits (286), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 163/714 (22%), Positives = 272/714 (38%), Gaps = 135/714 (18%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           V P  Y  GD + L+VN +                  E  L    Y +  L F  P   E
Sbjct: 51  VNPNLYKIGDHVELIVNKV------------------ESDLTQLPYAYYDLPFICPPTKE 92

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  I  GDR + S ++L    +  C  LC      +      +L++ G+   W
Sbjct: 93  KKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQW 152

Query: 143 LID-GLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID  LPAAT        +++Y  GF +G+V+                           R
Sbjct: 153 LIDESLPAATTFISSTNHNKYYAAGFPVGYVDD--------------------------R 186

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
             K           +  NH  + + YH   E  + +VG  V P S+     PG  +    
Sbjct: 187 TGK----------TFLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDK 236

Query: 261 PLVLSEDADNDVYF---TYSVKFVPS-ETVWATRWDKYLHTYDPT------IQWFXXXXX 310
             ++  + D+++ F   TYSV +    E  W  RW+ +L+  + +        W      
Sbjct: 237 YEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNS 296

Query: 311 XXXXXXXXXXXXXXXMKAL-KSDFARYN---EFNLEDDFQEDAGWKLGHGDVF------- 359
                          +K   K +    N     NL  D ++D   K+  G VF       
Sbjct: 297 VGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSVFVNAKTWI 355

Query: 360 ---RIPHKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILY----AL 412
              +IP+               F ++   I   +L  L  + R ++ T+  I +    A+
Sbjct: 356 TVGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLH-NIRFTVLTMSLICFICGAAI 414

Query: 413 FGFVGSYTSMAVYKFFKGPYWKVNMLLTPF---------MIPGFIFLTIVGLNFFLMFAH 463
            G++GS   +  Y+  KG Y +  +  T            +PG + +    LN  ++   
Sbjct: 415 SGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLNCIILAHD 472

Query: 464 SSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPT-------KTNQIARQIP 516
           S+  +P  T  F++ ++F+  IPL+  G ++A   C  D + T       + N I+R+  
Sbjct: 473 STNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLRRNTISRKSR 531

Query: 517 ---------FQPWYLK------TWPATMIAGIFPFGSIAVELYFIYTSLWFNKI--FYMF 559
                    +Q           T    +  G F F  I VEL ++Y S+W  K   +Y +
Sbjct: 532 SDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYY 591

Query: 560 GFXXXXXXXXXXXXXXXXXXXXYHSLCLENWQ-----WQWRGFIVGGVGCAIYVFVHSIL 614
           GF                    Y  L  +N +     W W+ F++G   CA Y+ ++S+ 
Sbjct: 592 GFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLY 650

Query: 615 FTKFKLG--GFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666
           +  F L   GF++I + V YS + + +     G++ +L+S + V +IY   KVD
Sbjct: 651 YIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 150/717 (20%), Positives = 255/717 (35%), Gaps = 161/717 (22%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDY-YFDRLHFCKPEHI 83
           + P  Y  GD++ L VN +                  E  + +  Y Y+D    C P   
Sbjct: 44  IKPNVYKRGDKVDLTVNKV------------------ESEITNLPYGYYDLRFVCPPSET 85

Query: 84  EKQPE-SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           +K    SL  +I GDR + S + L+    + C  LC         +  ++LI+  +  +W
Sbjct: 86  KKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHW 145

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LIDG LPAAT     ++  +FY  GF LG V+                            
Sbjct: 146 LIDGDLPAATTFASTRSGKKFYTAGFPLGRVD---------------------------- 177

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDP 261
                      +  +  NH  + + Y       Y +VG  V P S+          + +P
Sbjct: 178 --------HETDKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEP 229

Query: 262 LVLSEDADNDVY--FTYSVKFVPSETV-WATRWDKYLH----TYDPTIQWFXXXXXXXXX 314
            V++ +     Y  FTYSV +     + W+ RW+ +        +  + +F         
Sbjct: 230 YVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSA 289

Query: 315 XXXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMXXXXXXXX 374
                      +  LK            DDF     ++     V+ +   ++        
Sbjct: 290 IVVALMTLFIALIFLKIR---------ADDFVGTLAFEWASQPVYYLTQLNLAASMGIQF 340

Query: 375 XXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFK-GPYW 433
              LF +I  S    +L  +       L+T      A+   +G+YTS  V      GP  
Sbjct: 341 ---LFSIIGSSTISCSLCKVHNIRSWELSTA-----AICFVLGAYTSSLVGSLLAPGP-- 390

Query: 434 KVNM---LLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFA 490
           K+N+   +L    +P    + +   N  +    SS  +P GTL  ++  +F+  +PL+F 
Sbjct: 391 KMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFL 450

Query: 491 GSLIAHKKCTWDEHPTKTNQIARQIPFQ--------------PWYLKTWPA--------T 528
           G   A K  +   +     Q   ++PF                   K  PA        T
Sbjct: 451 GGFSARKLRSAPANGLNYEQ--SKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLLT 508

Query: 529 MIAGIFPFGSIAVELYFIYTSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXY---- 582
           ++ G  PF     EL F+Y SLW  K  ++ ++GF                    Y    
Sbjct: 509 IVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVCYVLMI 568

Query: 583 -------------------HSLC---------LENW------QWQ-------WRGFIVGG 601
                               S+C         L+N+      +W+       W+ F+  G
Sbjct: 569 YTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKAFM-AG 627

Query: 602 VGCAIYVFVHSILFTKF--KLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFV 656
              A Y  ++S+ +  F   L  F++I+L+V Y+++ +L+     GA+G+L+ L F+
Sbjct: 628 ASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLWFL 684

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 124/259 (47%), Gaps = 41/259 (15%)

Query: 443 MIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWD 502
           ++PG + LT + LN  +    S+ V+P  T+  ++ ++FI  IPL+  G  IA  K + +
Sbjct: 420 LLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDS-E 478

Query: 503 EHP------------TKTNQI-----------ARQIPFQ-PWYLK-------TWPATMIA 531
           E+             T+ N+I            R++ ++  W LK       T  + + +
Sbjct: 479 EYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLAS 538

Query: 532 GIFPFGSIAVELYFIYTSLWFNKI--FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLEN 589
           GIFPF  I VEL F+Y S+W+ K   +Y +GF                    Y  + + +
Sbjct: 539 GIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSS 598

Query: 590 WQ----WQWRGFIVGGVGCAIYVFVHSI--LFTKFKLGGFATIVLYVGYSTMISLLFCVV 643
                 W+W+ F +    CA Y+  +SI  +F    +  F++I++ V YS + + L  + 
Sbjct: 599 KDNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLA 657

Query: 644 TGAIGFLSSLIFVRKIYSA 662
            G+IG+L+SL FV+++Y +
Sbjct: 658 MGSIGYLASLWFVKRVYRS 676

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 112/276 (40%), Gaps = 62/276 (22%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + PT Y  GD + ++VN +        +DA               Y +  L F  P  ++
Sbjct: 33  LTPTIYRHGDPVEIIVNKI-------ESDAT-----------QLPYGYYDLPFTCPPTVD 74

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  +I GDR + S +EL+  ++  C  LC         + ++K IK  +   W
Sbjct: 75  KKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQW 134

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
            ID  LPAAT       + ++YG+GF LGFV+                         ET 
Sbjct: 135 FIDKELPAATTFISTVDQKKYYGSGFPLGFVDE------------------------ETG 170

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
           +             Y  NH  + + YH   +  + +VG  + P S+     PG  +    
Sbjct: 171 K------------VYVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQ 218

Query: 261 -PLVLSEDADNDVY--FTYSVKFVPS-ETVWATRWD 292
             +V+ E A+ D +  FTYSV +    +  W  R++
Sbjct: 219 YEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYN 254

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 110/278 (39%), Gaps = 60/278 (21%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y +GD++ +++N +                  E   + + YY   L F  P   +
Sbjct: 40  IKPNVYKKGDKVDVIINKVV----------------SETARFPYGYY--DLQFVCPPSDK 81

Query: 85  KQPE--SLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  II GDR + S + L   E   C+ LC      +  K  + LI+ G+  +W
Sbjct: 82  KKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHW 141

Query: 143 LI-DGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LI D LPAAT     K+  +FY  GF LG V+   A+ G+                  TR
Sbjct: 142 LIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD---AVTGK------------------TR 180

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDP 261
                            NH  + V Y       + ++G  V P S+  +          P
Sbjct: 181 ---------------LYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQP 225

Query: 262 LVLSEDADNDVY--FTYSVKFVPSETV-WATRWDKYLH 296
             ++ +     Y  FTYS+ +     + W+ RW+ ++H
Sbjct: 226 YEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 66/142 (46%), Gaps = 26/142 (18%)

Query: 444 IPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDE 503
           +PG +  T++ LN  +    SS  +P GT+   +  +F+ S PL+  G   A +K     
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSA-RKMKNAA 458

Query: 504 HPTKTNQIARQIPFQ-----PWYLKTWPA-----------------TMIAGIFPFGSIAV 541
                N I++  PF       +  ++WPA                 T++AGI PF  I V
Sbjct: 459 KLAPANAISKS-PFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICV 517

Query: 542 ELYFIYTSLWFN--KIFYMFGF 561
           EL+++Y S+W      +Y++GF
Sbjct: 518 ELFYVYKSMWLQTTNFYYLYGF 539

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 591 QWQWRGFIVGG-VGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGF 649
            W+W+ F+ GG V   + ++    L     L   ++I+L+V Y+ + + +     GA+G+
Sbjct: 614 SWRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 650 LSSLIFVRKIYSAIK 664
           LS L F+  I S+ K
Sbjct: 674 LSCLWFLSHISSSSK 688

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 139/329 (42%), Gaps = 47/329 (14%)

Query: 377 QLFLMISCSI--FFAALGFL----SPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKG 430
           QL L++S  I   F  LG L    S +    + + +          GS+TS  +    +G
Sbjct: 342 QLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFISGSFTSSFIGALLEG 401

Query: 431 PYWK---VNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPL 487
              +   VN ++    +PG   + ++ LN+ L   +++  +P GT+  +   +FI  +P+
Sbjct: 402 QMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPI 461

Query: 488 AFAGSLIAHKKCTWDEHPTKTNQIA----RQIPFQPWYLKTWPA-----------TMIAG 532
           +  G   A +    +   T  N  A     +   +P Y+++  +           T+  G
Sbjct: 462 SIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAITLTFG 521

Query: 533 IFPFGSIAVELYFIYTSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLEN- 589
           + PF  I VEL F Y SLW  K  ++Y++GF                    Y  L   N 
Sbjct: 522 LIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGND 581

Query: 590 -----WQ------------WQWRGFIVGGVGCAIYVFVHSILFTKF--KLGGFATIVLYV 630
                W             W+W+ F +GG   A Y+  +SIL+  F  +   F +  L+V
Sbjct: 582 SLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFLFV 640

Query: 631 GYSTMISLLFCVVTGAIGFLSSLIFVRKI 659
            YST+ ++L     G++ +LSSL F+ K+
Sbjct: 641 CYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 116/278 (41%), Gaps = 60/278 (21%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHF-CKP-EH 82
           ++P  Y  GD++ + VN +   +               HF Y    Y+D LHF C P + 
Sbjct: 57  LSPNFYEYGDKVDITVNKVESDL--------------THFSYG---YYD-LHFTCPPSQD 98

Query: 83  IEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           ++  P +   I++G++ + S ++L   +++ CV LC     G+  K   +LIK  +   W
Sbjct: 99  MKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQW 158

Query: 143 LI-DGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           L  D LP AT   + K K ++Y +GF LG  +                         ET 
Sbjct: 159 LADDDLPGATTYLNTKDKKKYYSSGFPLGQYDP------------------------ETD 194

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIK-RSTPGTCETTGD 260
           E            AY  NH  I + YH   +G   +VG  V P S+     PG  +    
Sbjct: 195 E------------AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTP 242

Query: 261 PLVLSEDADND-VYFTYSVKFVPSETV-WATRWDKYLH 296
             +   + D + + FTY+V +     V W  RW+ +++
Sbjct: 243 YKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFIN 280

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 111/271 (40%), Gaps = 51/271 (18%)

Query: 20  FYLPGVAPTTYHEGDEIPLL----VNHLTPSVYFQRTDANGKSKNKEHFLYSFDY-YFDR 74
           F+L  V  +T   G  IP++     N LTP++Y +  D        E  L    Y Y+D 
Sbjct: 11  FFLLIVTISTIIYG-HIPIIQRHDANRLTPNIYRKGDDVELIVNKIESDLTKLPYGYYDL 69

Query: 75  LHFCKPEHIEKQP--ESLGSIIFGDRIYNSPFELKMLEEKTCVSLC-KSTIPGKDAKFIN 131
              C P + +++P   SL  I+ GDR + S + L   ++  C  LC + T P    K IN
Sbjct: 70  PFICPPTN-QRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN 128

Query: 132 KLIKNGFFQNWLIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQ 190
            L+K  +   W ID  LPA+T         ++Y  GF LGFV+         P T     
Sbjct: 129 -LVKKDYIVQWSIDNDLPASTTFISTSENRKYYIPGFSLGFVD---------PDT----- 173

Query: 191 TTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR- 249
                                 E AY  NH  + + YH   +  + +VG+ V P S+   
Sbjct: 174 ----------------------ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDY 211

Query: 250 STPGTCETTGDPLVLSEDADNDVY--FTYSV 278
             PG         +++ D +   Y  FTYSV
Sbjct: 212 HCPGASRNYEQFELVANDDEEVTYIPFTYSV 242

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 104/244 (42%), Gaps = 34/244 (13%)

Query: 443 MIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKC--- 499
           ++P  I +  + LN  +    SS  +P  T+ F+I ++FI  IPL+  G   A   C   
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKR 480

Query: 500 --------TWDEHPTKTNQIARQI------PFQPWYLKTWPATMIAGIFPFGSIAVELYF 545
                      +     + +AR I      PF            I G+FPF  I VEL  
Sbjct: 481 TLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLL------ASIGGLFPFFIIYVELQH 534

Query: 546 IYTSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXY---HS--LCLENWQWQWRGFI 598
           +Y  +W  K   +Y+  F                    Y   HS    LEN  W+WR F 
Sbjct: 535 VYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQ 593

Query: 599 VGGVGCAIYVFVHSILFTKFKLG--GFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFV 656
           +    CA Y+ ++S+ +  + L   GF++I+L V  S + + L     G+IG+L++  FV
Sbjct: 594 ISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFV 652

Query: 657 RKIY 660
            ++Y
Sbjct: 653 GRVY 656

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 105/510 (20%), Positives = 175/510 (34%), Gaps = 96/510 (18%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y  GD++ +  N   P       D    S+           Y+D    C P    
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-------DDPAVSQPALC-------YYDLPFVCPPSD-T 104

Query: 85  KQP--ESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           K+P   SL  +  GD +  S + L+  +++ C  LC      K  +    LIKN +   W
Sbjct: 105 KRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQW 164

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
            +D  LP  T     K   + Y  GF LG+   F    GQ                    
Sbjct: 165 YVDNDLPVGTTYISNKVNKKQYLPGFSLGY---FDNQTGQ-------------------- 201

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSI-KRSTPGTCET-TG 259
                        AY   H    V YH     T+ +VG+ V P SI   + PG  +    
Sbjct: 202 -------------AYLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIP 248

Query: 260 DPLVLSEDADNDVY--FTYSVKFVPS-ETVWATRWDKY------LHTYDPTIQWFXXXXX 310
             + + E+ D+  Y  F+YSV +    +  W  RWD +      L   D +  W+     
Sbjct: 249 LEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWYSLINS 308

Query: 311 XXXXX-XXXXXXXXXXMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIP------- 362
                           M  ++     YN+   +            + ++F I        
Sbjct: 309 NSITVGVITFLCLVISMNRMR---ILYNKSWKKRQLSITTTTTTRYPNIFTICITSGIQF 365

Query: 363 ----HKSMXXXXXXXXXXQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGS 418
                 S+          Q+   I  ++FF A G +     G+L    FIL         
Sbjct: 366 FFLLISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTLIQRTFILTN------- 418

Query: 419 YTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMIL 478
                    F   Y+  N +L    +P FI L++  +N  +  +  +   P     +   
Sbjct: 419 ---------FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFT 469

Query: 479 LWFIFSIPLAFAGSLIAHKKCTWDEHPTKT 508
            +FI SIPL+    +++ +  ++ ++P+++
Sbjct: 470 SYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 110/283 (38%), Gaps = 64/283 (22%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           V P  Y +G+E+ +L+N +            GK         S+ YY D    C P    
Sbjct: 40  VRPRIYQDGEEVEMLLNQVV-----------GKPGE-----LSYGYY-DLQFTCTPTKSR 82

Query: 85  KQ-PESLGSIIFGDRIYNSPFELKMLEEKTCVSLC-KSTIPGKDAKFINKLIKNGFFQNW 142
           +    SL  +  GDR + S ++L    E  C +LC + T P    +  + LI+  +    
Sbjct: 83  RMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIRQNYTVQL 141

Query: 143 LIDGLPAATQVY-DRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
           LID +  A++ Y   +    +Y  GF LGFV+         P T                
Sbjct: 142 LIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD---------PET---------------- 176

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRS-TPGTCETTGD 260
                      ++ Y  NH+ + + Y+      Y +VG  V P S+     PG+ +   +
Sbjct: 177 -----------DVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYEN 225

Query: 261 PLVLSEDADNDVYF---TYSVKFVPSETV-WATRWDKYLHTYD 299
             V    ++ DV F   TYSV +     V W  RW+ YL   D
Sbjct: 226 YAV--NPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGD 266

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 103/269 (38%), Gaps = 57/269 (21%)

Query: 444 IPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDE 503
           +P      +V  N           +P   +  ++ L+F+ S+PL+  G   A  K   D+
Sbjct: 404 LPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQ 462

Query: 504 H----------------PTK-------------TNQIA-RQIPFQPWYLKTWPATMIAGI 533
           H                P+K             T   A  QIP   W  K +  T I GI
Sbjct: 463 HFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGI 520

Query: 534 FPFGSIAVELYFIYTSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXY--------H 583
            PF +I +++ FI+  LW +   +F ++                      Y         
Sbjct: 521 IPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDS 580

Query: 584 SLCLENW-----------QWQWRGFIVGGVGCAIYVFVHSILFTKF--KLGGFATIVLYV 630
             C ++             W+W+ F +GG   A Y   +S+ +  F  +L  F +I+LY+
Sbjct: 581 ECCFDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYL 639

Query: 631 GYSTMISLLFCVVTGAIGFLSSLIFVRKI 659
            Y T++++ +    G+IG+L+   F+ K+
Sbjct: 640 SYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 103/280 (36%), Gaps = 55/280 (19%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           V P TY  GD + ++VN +      Q  D  G S     + Y      D  + C P + +
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEGVSYKYH-----DLPYICPPTNTK 95

Query: 85  KQ-PESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNWL 143
           K    SL  +  GD    S + LK   +  C +LC         +   ++I   +  NW 
Sbjct: 96  KSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNWF 155

Query: 144 IDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETRE 202
           ID  LPAAT      T+ + Y  GF LG+         + P T                 
Sbjct: 156 IDDYLPAATTYISSVTRKKKYFEGFSLGW---------KDPETGS--------------- 191

Query: 203 AKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSI-KRSTPGTCETTGDP 261
                        Y  NH  + + Y+   +  + +VG  V P SI     PG     G  
Sbjct: 192 ------------YYINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGH- 238

Query: 262 LVLSEDADNDVY----FTYSVKFVPS-ETVWATRWDKYLH 296
             L +  +ND +    F+YSV +    E  W TRW  ++ 
Sbjct: 239 YELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVR 278

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 414 GFVGSYTSMAVYKFFKGPYWKVNM-LLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGT 472
            FVG++  M +++    P +   M ++   ++PG     +   N    F   +   P   
Sbjct: 409 SFVGTWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRK 468

Query: 473 LFFMILLWFIFSIPLAFAGSLIAHK 497
           L ++I ++FIFSIP++  G  +A K
Sbjct: 469 LSWLIFVYFIFSIPMSLIGGSLAVK 493

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 107/272 (39%), Gaps = 60/272 (22%)

Query: 27  PTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIEKQ 86
           P+ Y  G+ + LLV+++                ++E +      Y++ L  C P    + 
Sbjct: 39  PSAYTRGERVQLLVDNIW--------------TDREVW-----GYYETLFTCPPPAEARA 79

Query: 87  P-ESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNWLID 145
              SLG +   +  + S + L +  E  C  LC   +     + + ++I++G    W +D
Sbjct: 80  IYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLD 139

Query: 146 GLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETREAKN 205
           GLPAAT   DR++ S  Y  GF+LG V++                           E  +
Sbjct: 140 GLPAATTYPDRQS-SYRYEAGFKLGEVDA---------------------------ETGH 171

Query: 206 VQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDPLVLS 265
           V++          NH  + V Y    +G Y +VG    P S+        +T  +   L+
Sbjct: 172 VRL---------HNHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLN 222

Query: 266 EDADNDVY--FTYSVKFVPSETV-WATRWDKY 294
            DA   +   FTY+V +     V W  RW  Y
Sbjct: 223 PDAQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 590 WQWQWRGFIVGGVGCAIYVFVHSILFTKFKLG--GFATIVLYVGYSTMISLLFCVVTGAI 647
           + W+W+ F VGG   A Y+  H+I   +      G   I+L + Y+T++++ + +V GA 
Sbjct: 577 YSWRWKLFGVGGAA-AWYLEAHAIHSIRHAYAHLGSPNIILAIFYATVLNIAYWLVFGAF 635

Query: 648 GFL 650
           G+L
Sbjct: 636 GYL 638

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 104/289 (35%), Gaps = 63/289 (21%)

Query: 25  VAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHFCKPEHIE 84
           + P  Y  GD + LLVN    ++     +A+ K            Y +  L F  P    
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL-----NADLKP-----------YIYHDLPFVCPPTSV 90

Query: 85  KQPESL--GSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNW 142
           ++P  L   S+  GD +  S ++LK  ++  C  LC              +IK  +   W
Sbjct: 91  RKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQILW 150

Query: 143 LIDG-LPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLELETR 201
            ID  LP +       T+ + Y  GF LG                               
Sbjct: 151 SIDDELPISMPYISTITQRKKYIPGFPLG------------------------------- 179

Query: 202 EAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKR-STPGTCETTGD 260
                +  K+    Y  NH  + + Y+   +  + +VG  V   S+     PG  +   +
Sbjct: 180 -----RFDKDKNKVYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEE 234

Query: 261 -PLVLSEDADNDVY--FTYSVKFVPS-ETVWATRW---DKYLHTYDPTI 302
             LV+ E+ D+  +  FTYSV +    +  W +RW   D  +   DP +
Sbjct: 235 YELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKL 283

>NCAS0A14890 Chr1 (2933969..2935819) [1851 bp, 616 aa] {ON}
           Anc_7.481
          Length = 616

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 388 FAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMI--- 444
           FA  G  S SS  S    + ILYA+   +G  ++ A Y  +   YW    +L+ ++    
Sbjct: 322 FARFGKSSKSSVYSQLIAIPILYAVISLIGILSASAAYTIYGVNYWSPLDILSRYLDHYT 381

Query: 445 ---PGFIFLTIVGLNFFLMFAHSSG-VVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCT 500
                 +FL      F  + A+ SG  +PAGT    +L  FI     A+  + I+   C 
Sbjct: 382 SGNRAGVFLISFAFAFDQLGANLSGNAIPAGTDMTALLPKFINIRRGAYICTCISLAICP 441

Query: 501 WD 502
           WD
Sbjct: 442 WD 443

>KNAG0C06290 Chr3 (1224562..1225815) [1254 bp, 417 aa] {ON}
           Anc_5.646 YKL162C
          Length = 417

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 19/80 (23%)

Query: 112 KTCVSLCKSTIPGKDAKFINKLIKNGFFQ---------------NWLIDGLPAATQVYDR 156
           + C S+CKS +      F  KL KN F +               + ++DG+P   ++ + 
Sbjct: 131 RACTSMCKSIM----TFFEKKLSKNHFEKIHYILVPLYKLDKIPSAIMDGIPGHVELVND 186

Query: 157 KTKSEFYGTGFELGFVESFQ 176
             KS F+ TG +LG ++S +
Sbjct: 187 IKKSPFHKTGGKLGALQSLE 206

>Smik_15.163 Chr15 complement(278633..279371,279402..279679) [1017
           bp, 339 aa] {ON} YOL007C (REAL)
          Length = 339

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 420 TSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILL 479
           TS A        +   N L T  +IP  +++ +   N F+  AH     P GT+ F+   
Sbjct: 83  TSSASTSLHSNAWSNFNGLSTSSIIPSSVYIPVTNGNKFIYQAHH----PNGTV-FIAFA 137

Query: 480 WFIFSIPLAFAGSLIAHKKCTWD--EHPTKTNQIARQIPFQPWYLKT 524
             + +I L+  G+ IA    +W       K   +  Q  + P+Y ++
Sbjct: 138 GCLGAILLSLTGAWIALSVKSWRSARRENKLRNLENQYQYDPFYFQS 184

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,862,035
Number of extensions: 2862865
Number of successful extensions: 8467
Number of sequences better than 10.0: 62
Number of HSP's gapped: 8455
Number of HSP's successfully gapped: 98
Length of query: 666
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 550
Effective length of database: 40,180,143
Effective search space: 22099078650
Effective search space used: 22099078650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)