Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038808.255ON70670637090.0
Suva_2.2688.255ON69570524310.0
NDAI0J014108.255ON71669024060.0
YDR108W (TRS85)8.255ON69870423940.0
Skud_4.3698.255ON69870823670.0
Smik_4.3548.255ON69870823520.0
ZYRO0C01826g8.255ON69972622570.0
TDEL0F038208.255ON68769622230.0
Kpol_392.118.255ON67569421460.0
KAFR0B055708.255ON66969121130.0
CAGL0B01705g8.255ON67268620920.0
TPHA0B032608.255ON71473220310.0
Kwal_56.235838.255ON70071718300.0
SAKL0H17226g8.255ON71974018230.0
KLTH0G13860g8.255ON70872518120.0
KNAG0H032708.255ON64871816960.0
TBLA0E043808.255ON88963515820.0
AGR096C8.255ON62369213291e-175
Ecym_43168.255ON62368413081e-172
KLLA0F18953g8.255ON64768912311e-160
TPHA0I016708.587ON90459860.12
TPHA0L004907.85ON290169751.7
TBLA0D047601.418ON38264733.0
Smik_4.4248.374ON70252725.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03880
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...  1433   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   941   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   931   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   926   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   916   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   910   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   874   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   860   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   831   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   818   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   810   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   786   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   709   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   706   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   702   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   657   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   613   0.0  
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   516   e-175
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   508   e-172
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   478   e-160
TPHA0I01670 Chr9 complement(373263..375977) [2715 bp, 904 aa] {O...    38   0.12 
TPHA0L00490 Chr12 complement(82007..82879) [873 bp, 290 aa] {ON}       33   1.7  
TBLA0D04760 Chr4 complement(1174113..1175261) [1149 bp, 382 aa] ...    33   3.0  
Smik_4.424 Chr4 (770506..772614) [2109 bp, 702 aa] {ON} YDR176W ...    32   5.5  

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score = 1433 bits (3709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/706 (97%), Positives = 691/706 (97%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
           YMLLRFFSGCVSDRDQANELEKSQKDKI               KVRTRGRSRSNSLFQRD
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQRD 120

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180
           STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI
Sbjct: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180

Query: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240
           YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP
Sbjct: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240

Query: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL 300
           IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL
Sbjct: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL 300

Query: 301 HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ 360
           HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ
Sbjct: 301 HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ 360

Query: 361 PRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDF 420
           PRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDF
Sbjct: 361 PRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDF 420

Query: 421 KTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTY 480
           KTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTY
Sbjct: 421 KTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTY 480

Query: 481 ENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILV 540
           ENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILV
Sbjct: 481 ENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILV 540

Query: 541 ECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPL 600
           ECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPL
Sbjct: 541 ECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPL 600

Query: 601 TKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYS 660
           TKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYS
Sbjct: 601 TKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYS 660

Query: 661 KIGLADRDDLILKKIQNKLKTAETETIDAGAEKNAEVSHHEVDSPN 706
           KIGLADRDDLILKKIQNKLKTAETETIDAGAEKNAEVSHHEVDSPN
Sbjct: 661 KIGLADRDDLILKKIQNKLKTAETETIDAGAEKNAEVSHHEVDSPN 706

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/705 (65%), Positives = 543/705 (77%), Gaps = 31/705 (4%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNLLFHLD+ +ETVP EIAKRIVSNAI+PVI VTST   D HI E Y++DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRFFSGCVSDRDQANE--LEKSQKDKIXXXXXXXXXXXXXXXKVRTRG-RSRSNSLF 117
           YMLLRFF GCVSDRDQANE   E+ +++                     RG RSRSNSLF
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120

Query: 118 QRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLK 177
           QRDSTQSQY+RFT+PLGD+I T++ NDMLF+YHSLE++L NYL L+  NTD+  P++LLK
Sbjct: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180

Query: 178 KSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH 237
           KSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN +T 
Sbjct: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240

Query: 238 NFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYP--SD 295
           +FPIFMNTN+MLPV LLCY+D+  E+FE CQAL KK+KKQLFVE I LPLWKDS+    +
Sbjct: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVEN 300

Query: 296 PQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWD 355
             + LHQPVMSSLEE+++FL  P +  L   LI SIY++LD LVY+LMIPFMKRKI+FW+
Sbjct: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360

Query: 356 ETILQPRKSLFHGAKFLKKFMTKTALT--HQENLLTKDAQGNEYFTSASSEFLMRKLADW 413
           ETILQPRKSLF+GAKF KKFM K  +   HQ N LTKD QGNEYF S+SSEFLMRKLADW
Sbjct: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420

Query: 414 SMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLI 473
           SMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ+IVTVKM+KNDINPLI
Sbjct: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480

Query: 474 EKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAIS 533
           E+AL+TYENC+ +     K  T   ++ PVRSYETRCMILASELFLSLSDTWTSTPYAI 
Sbjct: 481 ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ 540

Query: 534 YLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGH 593
           YLETIL ECKLG CSQIM+WERLSDCY LRVDPR+KHK  G                   
Sbjct: 541 YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGG------------------- 581

Query: 594 VMTPSPLTKEDVSNDANNDTD----QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVS 649
            M  S    ED+ ND   DTD    +DI+S+G TR+RKAAFFRLMAAKKWAEQK+WRQVS
Sbjct: 582 -MKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVS 640

Query: 650 WCLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694
           WCL+ I++TYS I     + LIL  ++N+L + + ++     EKN
Sbjct: 641 WCLKDIENTYSDIDFLHGNGLILSNLKNQLNSKDVDSAPTPTEKN 685

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/690 (67%), Positives = 552/690 (80%), Gaps = 12/690 (1%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNLLFHLD+ KE+VP EIAKRIVSNAI+PVI VTST +LD+HI ETYNIDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIX---------XXXXXXXXXXXXXXKVRTRGRS 111
           YMLLR+F GCVSDRDQANEL   Q+  +                        K R RGRS
Sbjct: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKAR-RGRS 119

Query: 112 RSNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNT 171
           RSNSLFQRDSTQSQYIRFTKP+ D++A K++NDMLFDYHSLEIYL+ YL LI  NT+++T
Sbjct: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179

Query: 172 PYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKN 231
           PYELLK SIYH+FFSLAISSTT LSPYE FNHP+VSLIAVDIS+GQ YDD+RDLLV+FKN
Sbjct: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239

Query: 232 LNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDS 291
           LN++T NFPIFMNTNDMLP+ LLCYD  + EQFE CQ+LTK++KKQLFVE + LPLW + 
Sbjct: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299

Query: 292 YPSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKI 351
           Y  D +V LHQP+MSSLEEMIYFL  P    L   LI SIYNILDSL+Y+LM+PFMKRK+
Sbjct: 300 YEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKL 359

Query: 352 AFWDETILQPRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLA 411
            FW+ETILQPR+SLFHGAKFLKKFMTK     QEN+LTKD++GNEYF  +S+E LMRKLA
Sbjct: 360 LFWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLA 419

Query: 412 DWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINP 471
           DWSMM+SDFKTAY+TYESL+ DL++FPKY ASCLEWCA SLLMGAQ+IVTVKM+KNDINP
Sbjct: 420 DWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINP 479

Query: 472 LIEKALSTYENCA-TVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530
           LIE+AL TYENCA T++ +T  +   E  V P+RSYETRCMIL SELFLSLSDTWTSTPY
Sbjct: 480 LIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPY 539

Query: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590
           AI+YLETIL ECKLG CSQI IWERLSDCY+LR+DPRI++K   T   T++   ++   +
Sbjct: 540 AITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKV 599

Query: 591 QGHVMTPSPLTKEDVSN-DANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVS 649
                T  P T +  S+ ++   + ++I+SKGFTR+RK+AFFRL+AAKKWAEQK+WRQV+
Sbjct: 600 VATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVA 659

Query: 650 WCLQSIDDTYSKIGLADRDDLILKKIQNKL 679
           WCL+ ++  Y    L  RDDLI+ K++N L
Sbjct: 660 WCLKDMESIYDATDLGKRDDLIVAKLRNLL 689

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/704 (65%), Positives = 544/704 (77%), Gaps = 26/704 (3%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNLLFHLD  KETVP EIAKRI+SNAI+PVI VTST   D HI ETY +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQK-----DKIXXXXXXXXXXXXXXXKVRTRG-RSRSN 114
           YMLLRFF GCVSDRDQANE +  Q      D                  +  +G RSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 115 SLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYE 174
           SLFQRDSTQSQYIRFT+PLGD+I T++ANDMLF+YHSLE++L NYL L+  NTD+  P+ 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 175 LLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNS 234
           LLKKSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN 
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 235 STHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPS 294
           +T NFPIFMNTN+MLPV LLCY+D   E+FE CQAL KK+KKQLFVE I L LWKDS+  
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 295 DPQ--VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352
           D    + LHQPVMSSLEE+++FL  P + TL   LI SIY++LD LVY+LMIPFMKRK++
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 353 FWDETILQPRKSLFHGAKFLKKFMTKTALT--HQENLLTKDAQGNEYFTSASSEFLMRKL 410
           FW+ETILQPRKSLF+GAKF KKFM K  +   HQ N LT+D+QGNEYF S+SSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470
           ADWSMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ+IVTVKM+KNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530
           PLIE+AL+TYENC+ +     K +    +  PVRSYETRCMILASELFLSLS+TWTSTPY
Sbjct: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540

Query: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590
           AI YLETIL ECKLG CSQIM+WERLSDCY LRVDPRIKH+      +     K +E D+
Sbjct: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDA----KDTE-DL 595

Query: 591 QGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650
           +G         +   S D  + TD+DI+S+G TR+RKAAFFRL+AAKKWAEQK+WRQVSW
Sbjct: 596 RG---------EHKYSTD--HFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSW 644

Query: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694
           CL+ I+ TYS+I     + LIL K++N+L   + ++    +EKN
Sbjct: 645 CLKDIESTYSEIKFLHGNGLILSKLKNQLNLKDVDSAPRPSEKN 688

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/708 (64%), Positives = 539/708 (76%), Gaps = 34/708 (4%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNLLFHLD  +E VP EIAKRIVSNAI+PVI VTST   D HI ETYN+DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKD------KIXXXXXXXXXXXXXXXKVRTRGRSRSN 114
           YMLLRFF GCVSDRDQANE +    +       +                ++   RSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 115 SLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYE 174
           SLFQRDSTQSQYIRFT+PLGD+I T++ NDMLF+YHSLE+YL NYL L+ +NT++  P++
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 175 LLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNS 234
           LLKKSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN 
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 235 STHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPS 294
           +T NFPIFMNTN+MLPV L+CY+D+  E+FE CQAL KK+KKQLFVE I LPLWK+S+  
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 295 DPQ--VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352
           D    + LHQPVMSSLEE+++FL  P + TL   LI SIY+ILD LVY+LMIPFMKRK++
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 353 FWDETILQPRKSLFHGAKFLKKFMTKTAL--THQENLLTKDAQGNEYFTSASSEFLMRKL 410
           FW+ETILQPRKSLF+GAKF KKFM K     +HQ N LT+D QGNEYF+S+SSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470
           ADWSMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ+IVTVKM+KNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530
           PLIE+AL+TYE C+ +     K  +   +  PVRSYETRCMILASELFLSLSDTWTSTPY
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590
           AI YLETIL ECKLG CSQIMIWERLSDCY LRVDPRIKH+                   
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVG----------------- 583

Query: 591 QGHVMTPSPLTKEDVSNDANNDTD----QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWR 646
              VM  S    ED+ N   + TD    +DI+S+G TR+RKAAFFRL+AAKKWAEQK WR
Sbjct: 584 ---VMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWR 640

Query: 647 QVSWCLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694
           QVSWCL+ I+ TYS+I     +D IL K++++L   + ++     EKN
Sbjct: 641 QVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLNLKDLDSAPGPTEKN 688

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/708 (63%), Positives = 534/708 (75%), Gaps = 26/708 (3%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNLLFHLD  KETVP EIAKRIVSNAI+PVI VTST   D HI E Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKV------RTRGRSRSN 114
           YMLLRFF GCVSDRDQANE++  Q +                  +      +   RSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 115 SLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYE 174
           SLFQRDSTQSQYIRFT+PL D+I T++ NDMLF+YHSLE++L NYL L+  NTD+  P++
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 175 LLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNS 234
           LLKKSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN 
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 235 STHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY-- 292
           +T NFP+FMNTN+MLPV LLCY+D+  E+FE CQAL KK+KKQLFVE + L LWKDS+  
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 293 PSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352
            ++  + LHQPVMSSLEE+++FL  P + +L   LI SIY++LD LVY+LMIPFMKRK++
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 353 FWDETILQPRKSLFHGAKFLKKFMTK--TALTHQENLLTKDAQGNEYFTSASSEFLMRKL 410
           FW+ETILQPRKSLF+GAKF KKFM K  +   H  N LT D QGNEYF S+SSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470
           ADWSMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ IVTVKM+KNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530
           PLIEKAL+TYENC+ +     ++++    V PVRSYETRCMILASELFLSLSD WTSTPY
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590
           AI YLETIL ECKLG C QIMIWERLSDCY LRVDPRIKH+                  M
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGA---------------M 585

Query: 591 QGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650
           +  +     L   D  N  ++ TD DI+S+G TRKRKAAFFRL+AA+KWAEQK+WRQVSW
Sbjct: 586 KKGIRDTEDLRGGD-GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSW 644

Query: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKNAEVS 698
           CL+ I+  YS I   + D LIL K+ N+L   +  +  +  EKN  ++
Sbjct: 645 CLKDIESIYSDIKFLNGDGLILSKLHNQLNLKDLNSAPSPTEKNPTMT 692

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/726 (58%), Positives = 525/726 (72%), Gaps = 63/726 (8%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M  SYE+YMNLLFHLD+G+ETVP +IA+RIVSNA+SPVI V+ST ELD HI +TY++DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRFFSGCVSDRDQANE-----------------------LEKSQKD--KIXXXXXXX 95
           YM LRFF  CVSDRDQANE                       +E S+K   K+       
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 96  XXXXXXXXKVRTRGRSRSNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIY 155
                         R RSNSLFQRD TQSQY+RFT+P+ D+I + ++NDMLFDYHSLE++
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 156 LQNYLDLIQKNTDDNTPYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISL 215
           L+N L L+++ TDDNTP+ELLKKS+YH FFSLAISSTT LSPYE FNHPVVSLIA+DIS 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 216 GQNYDDVRDLLVDFKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIK 275
           GQ Y++ RDLL+ FKNLN +  NFPIFM+T D+LPV LLCY+D+  ++   CQ L  ++K
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 276 KQLFVECISLPLWKDSYPSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNIL 335
           KQLFVE + LPLWK SY    +V LHQP+MSSLEEM+YFL  P    LP +LI   YNIL
Sbjct: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360

Query: 336 DSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFLKKFMTKT---ALTHQENLLTKDA 392
           + LV +LM+PFMKRKI+FW+ETILQPRKSLFHGA F KK M+K    +  HQ   L KD 
Sbjct: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420

Query: 393 QGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSL 452
            GNEYF ++S+EFLMRKLADWSMMLSDFKTAY+TYESL HDLE+FPKY ASC EWCAVS+
Sbjct: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480

Query: 453 LMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMI 512
           LMGAQNIVTVKM+KNDI+PLI++AL TYENCA      D+ +T E + VPVRSYETRCM 
Sbjct: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCA-----ADEDSTGEELYVPVRSYETRCMF 535

Query: 513 LASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKA 572
           LASELFLSLSDTWTSTPYA++ LETIL EC+LG CS+IMIWERLSDCY  R+DPRI+HK 
Sbjct: 536 LASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKT 595

Query: 573 AGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFR 632
           +                 QG       L  ++ SN       ++IV++G TRKRKAAFFR
Sbjct: 596 SA----------------QGAKAMTDELAPDEESN-------EEIVTRGLTRKRKAAFFR 632

Query: 633 LMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKI-------QNKLKTAETE 685
           L+AA KW EQK+W+Q  WCL+ I++ Y+ +   +R+DLIL ++       QN +  +  +
Sbjct: 633 LIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMNEAQNNVDESSNQ 692

Query: 686 TIDAGA 691
           T+++GA
Sbjct: 693 TVESGA 698

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/696 (60%), Positives = 522/696 (75%), Gaps = 39/696 (5%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           +  SYE+YMNLL HLD+G + VP++IAKRIVSNAISPVI VTST ELD HI ET+++DSL
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
           YMLLRFF  CV DRDQA+E   +                          R RSNSLFQRD
Sbjct: 62  YMLLRFFGDCVGDRDQAHEC--TSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRD 119

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180
           +TQSQYIRFT+PL D++ + + NDMLFDYH+LE +L+N L LI+K+T+D TP++LLKKS+
Sbjct: 120 ATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSL 179

Query: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240
           YH FFSLAISST  LSPYE FNHPVVSLIA+DI +GQ Y++ RDLL  FKNLN +T NFP
Sbjct: 180 YHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFP 239

Query: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL 300
           +F+NTND+LPV LLCY+    EQ+E CQ+LTKK+KKQLFVE I LPLWKD+Y +  QV L
Sbjct: 240 VFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVIL 299

Query: 301 HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ 360
           HQP+M+SL+E++YFL +P  + L  ELI SIY++L+ L+  LMIPFM+RKI+FW+ETILQ
Sbjct: 300 HQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQ 359

Query: 361 PRKSLFHGAKFLKKFMTKTALT---HQENLLTKDAQGNEYFTSASSEFLMRKLADWSMML 417
           PR+SLFHG+KFLK+FM+KT      HQ+  + KDA G EYF S+S+EFLMRKLADWSMML
Sbjct: 360 PRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMML 419

Query: 418 SDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKAL 477
           SD+KTAY+TY+SL+HDLE +PKY ASCLEWC+VS+LMGAQNIVT KMLK DI+PLI++A+
Sbjct: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479

Query: 478 STYENCA---TVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISY 534
            TYENCA   T L  + K N+    + PVRSYETRCM LASELFLSLSDTWTSTPYA+  
Sbjct: 480 ETYENCALYDTQLSGSKKSNS----MAPVRSYETRCMFLASELFLSLSDTWTSTPYALRN 535

Query: 535 LETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAA-GTIANTSSPKKSSESDMQGH 593
           LETIL EC+LG CSQIMIWERLS+CY+ R+D RI+HK   G ++N               
Sbjct: 536 LETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSN--------------- 580

Query: 594 VMTPSPLTKEDVSNDANND---TDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650
                   +E V N+ +++   T  DIV++G TR RKAAFF+L+AA KWAEQK+WRQ SW
Sbjct: 581 --------EEKVENEDDSEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASW 632

Query: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETET 686
           CL+  +D Y+ I   +R DL L K++  LK  E ++
Sbjct: 633 CLKDTEDAYAGIEFVNRKDLALAKLKETLKNVEIDS 668

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/694 (58%), Positives = 510/694 (73%), Gaps = 47/694 (6%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           + FSYE+YMNL++HLD   E VP +I+KRIVSNAI+PVI V STSELD H+ ++YNIDSL
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 61  YMLLRFFSGCVSDRDQANE------LEKSQKDKIXXXXXXXXXXXXXXX--KVRTRGRSR 112
           Y+L+R+F GC+SDRDQANE      +E + ++ +                 K     RSR
Sbjct: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123

Query: 113 SNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTP 172
           SNSLFQRDSTQS YIRFTKP+ D+I +++++DMLFDYHSLE+YL+  L LI KNT+D T 
Sbjct: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183

Query: 173 YELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNL 232
           ++ LK S++H FFS AISSTT LSPYE FNHP++SL+A+DIS GQNY+D RDLL+ FKN 
Sbjct: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243

Query: 233 NSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY 292
           N++   FP FM+TND+L V LLCYD    EQ E CQ + KK+KKQLF E + LPLW  S+
Sbjct: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303

Query: 293 PSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352
             D QV LHQP MSSL+EM+YF  +P    LP  LI +IY++++ LV +LMIPFM+RKI+
Sbjct: 304 SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKIS 363

Query: 353 FWDETILQPRKSLFHGAKFLKKFMTKTA--LTHQENLLTKDAQGNEYFTSASSEFLMRKL 410
           FW+ETILQPRKSLFHG K  +KFM +++    +Q N + KD++GNEYFTS+S EFL+RKL
Sbjct: 364 FWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKL 423

Query: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470
           ADWSMM+SDFKTAY+TYE+L  DLE+ PKY ASCLEWCA+S+LMGAQNIVT KM+KND+N
Sbjct: 424 ADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVN 483

Query: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530
           PLIE++L TYE C ++L +    N DEL+  PVRSYETRCM+L SELFLSL+DTWTSTPY
Sbjct: 484 PLIERSLDTYEQC-SILAQNSLEN-DELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPY 541

Query: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590
           A+S LETIL ECKLG CSQIMIWERLSDCY +R DPRI+H+                   
Sbjct: 542 ALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV------------------ 583

Query: 591 QGHVMTPSPLTKEDVSNDANNDTDQ-----DIVSKGFTRKRKAAFFRLMAAKKWAEQKRW 645
                       E V+   NN+  Q     DIVSKG  RKRKAAFFRL+AAKKWAEQK+W
Sbjct: 584 ------------ETVTKIENNEGGQQLQTDDIVSKGLARKRKAAFFRLLAAKKWAEQKQW 631

Query: 646 RQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKL 679
           RQVSWCL+ ++  Y  +  + R +LI +K++++L
Sbjct: 632 RQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDEL 665

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/691 (60%), Positives = 527/691 (76%), Gaps = 29/691 (4%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           +NFSYEHYMNLLFHL+   E +PSEIA+RIVS+AI+PVI VTST ELD HI +TY+IDSL
Sbjct: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
           YMLLRFF GCVSDRDQA+E + +                       TR RSRSNSLFQRD
Sbjct: 62  YMLLRFFGGCVSDRDQASESKANAPHS----------SSSLTTTKTTRARSRSNSLFQRD 111

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180
           STQSQYIRFT+PL D++   + NDMLFD+HSLE YL+ YL+L++K T D+T ++LLKKS+
Sbjct: 112 STQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSL 171

Query: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240
           YH+FFSLAISSTT LSP+E FNHP++SLIA+DI+  Q+Y+D + LL+ FKNL+++   FP
Sbjct: 172 YHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFP 231

Query: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL 300
           I++NT DMLPV LLCY+    E+ + C+ L+ KIKKQLFVE ISLPLWK+SY ++P + L
Sbjct: 232 IYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKL 291

Query: 301 HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ 360
           HQPVMSSL+EMIYFL   ++ TLP EL  + Y++L+ LVY L+IPFM+RKIAFW+ET+LQ
Sbjct: 292 HQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQ 351

Query: 361 PRKSLFHGAKFLKKFMTK--TALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLS 418
           P+KS+FHG+KFLKK M++  T+   Q+N+LTKD  GNEYF S+S E L+RKLADWS+MLS
Sbjct: 352 PKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLS 411

Query: 419 DFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALS 478
           DFKT YATYE L+HDLE FPKY ASCLEW AVSLLMGAQNIVTVKM+KNDI+PLI++AL 
Sbjct: 412 DFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALD 471

Query: 479 TYENCATVLPETDKR---NTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYL 535
            Y+ CA     ++K+     +   + PV SYETRC+IL+SELFLSLSDTWTSTPYAI+YL
Sbjct: 472 AYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAINYL 531

Query: 536 ETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVM 595
           E+IL E +LG CS+IMIWERLSDCY+LRVDPRIK K               +   Q ++ 
Sbjct: 532 ESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKV-------------EQVQKQDNLE 578

Query: 596 TPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSI 655
            P+   +  + N  ++    +IVS+G TRKRKAAFFRL+AAK WAEQ +W+QV WCL +I
Sbjct: 579 EPAD-NEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNI 637

Query: 656 DDTYSKIGLADRDDLILKKIQNKLKTAETET 686
            D YS++GL +RDDLIL +++ +   A +++
Sbjct: 638 TDIYSRVGLVNRDDLILTRLREEYNIAVSDS 668

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/686 (58%), Positives = 499/686 (72%), Gaps = 22/686 (3%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNL++HLD   ETVPS+IAKR+VSNA++PVI VTST  LD HI ETY IDSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKD-KIXXXXXXXXXXXXXXXKV--RTRGRSRSNSLF 117
           YMLLRFF GCVSDRDQANE++      K+                V  +TR RS SNSL+
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120

Query: 118 QRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLK 177
           QRD+TQSQY+RFTKPL D+I T++ANDMLFDYHSLE+YLQ YL ++ K    + P+ LLK
Sbjct: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK 180

Query: 178 KSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH 237
            SIYHSFF+LAISST+ LSP+ECFNHP+VSL+A+DI+  ++Y+   + L +FK++N++  
Sbjct: 181 TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP 240

Query: 238 NFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQ 297
           +FP F+NTND+LPV LLCY+     +FE CQ L  K+KKQLFVE I LPLW   +  +  
Sbjct: 241 SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLV 300

Query: 298 VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDET 357
           V LHQPVMSS+EE+++FL  P +  LP +L+  IY+ +D +VY+LM PFMKRK+ FW+ET
Sbjct: 301 VSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEET 360

Query: 358 ILQPRKSLFHGAKFLKKFMTK-TALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMM 416
           IL PRKSLFHGAKF KKFM K T    Q N L K+  G+ Y +S S EFLMRKLADWSMM
Sbjct: 361 ILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMM 420

Query: 417 LSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKA 476
           +SDFKTAY TYESL  D E  PKY ASC EWCAVSLLMGAQNIVT KMLKN+INP IE+A
Sbjct: 421 VSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERA 480

Query: 477 LSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLE 536
           L  YE CAT      K    + +  PVRSYETRCM LASELFLSLSDTWTSTP+AI+YLE
Sbjct: 481 LGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLE 540

Query: 537 TILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMT 596
           TIL ECKLG  S+IMIWERLSDCY +R+DPRIKH+    I N    +K  E+        
Sbjct: 541 TILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHR----IGNLELLQKKEEN-------- 588

Query: 597 PSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSID 656
                  D   +A+  T +DI+SKG TR RKAA F+L+AA+KW EQK+WR++SWCL  ++
Sbjct: 589 ------MDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLE 642

Query: 657 DTYSKIGLADRDDLILKKIQNKLKTA 682
            TYS +   ++++L+  +++N+L  A
Sbjct: 643 STYSDLKCFNKENLLYTRLRNELIAA 668

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/732 (54%), Positives = 494/732 (67%), Gaps = 77/732 (10%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAI+PVI VT+T ELD HI E Y IDS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRFFSGCVSDRDQANE-LEKSQKDKIXXXXXXXXXXXXXXXKVR------------- 106
           Y LLR+F GC+SDRDQ+NE ++K++ ++                KV+             
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 107 ----------------------------------TRGRSRSNSLFQRDSTQSQYIRFTKP 132
                                             TR RSRSNSLFQRDSTQSQ+IRFT+P
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 133 LGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSIYHSFFSLAISST 192
           + D++ +    DMLFDYH+LEI+L + L +++K T D+  ++ L+KS+YH FFS AISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 193 TILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFPIFMNTNDMLPVV 252
             LSPYE FNHP+VSLIA+DI+ GQNY+  RDLL+ FKN N++ +NFPIFM+TND+LPV 
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 253 LLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHLHQPVMSSLEEMI 312
           +LCY+    E+ E    L+KKIKKQLF ECI +PLW   Y  D  V LHQP MSSL+EM+
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360

Query: 313 YFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFL 372
           Y     K   LP  LI  IY+ L+ L  +LMIPFM+RKI FW+ETILQP+KSLF G K  
Sbjct: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420

Query: 373 KKFMTKTALTH--QENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESL 430
           +KFM + ++T+  QEN+  KD QGNEYF S S+ FL+RKLADWSMM+SDFKTAY T+ESL
Sbjct: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480

Query: 431 THDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVL--- 487
             D+E +PKY ASCLEWCAV +LMGAQNIVT KM+KND+NPLIE++L  Y NCA +L   
Sbjct: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI 540

Query: 488 PETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILVECKLGAC 547
            E+++    E    PVRSYETRCM++ SELFLSLSDTWTSTPYA+S LETIL ECKLGAC
Sbjct: 541 AESEESPDTE----PVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGAC 596

Query: 548 SQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSN 607
           SQIMIWERLSDCY LR DPR+KHK    I           S      ++   + K+DVS+
Sbjct: 597 SQIMIWERLSDCYNLRTDPRVKHKLRSNI-----------STSSVSEVSEEEIKKQDVSS 645

Query: 608 DANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADR 667
                    IV KG TR+RKA+FFRL+AAKKWAEQ +WRQVSWCL  I + Y       R
Sbjct: 646 ---------IVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKR 696

Query: 668 DDLILKKIQNKL 679
           + LI +K++  L
Sbjct: 697 ESLIYQKLKRNL 708

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/717 (50%), Positives = 476/717 (66%), Gaps = 62/717 (8%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M  SYE YMNL+ HLD   E VPSEI+++IVSNA+SPV+ VTS++ LD HI E+Y +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
           YMLLR+F  C+SDRDQA+  ++S  +                   ++R RSRS SLFQR 
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVEP-----------------NKSRARSRSGSLFQRQ 103

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180
           +  SQ++RFT+PL D+I T+   D+LFDYHSLE++LQ YL+L+   T  +TP+ LL+ SI
Sbjct: 104 A--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQHSI 161

Query: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240
           YH FF+ AISST  LSPYECFNHPV SL+A+DIS  + Y+D RDLLV FKN+++ T +FP
Sbjct: 162 YHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTPHFP 221

Query: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSD--PQV 298
            F+N ND+LPV LLCY++   EQFETCQ+L K +KKQLFVE + LP W  ++ +   P  
Sbjct: 222 SFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDTPTR 281

Query: 299 HLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETI 358
            LHQP+MSSLEE ++ + +     LP   I+ IY+ L  LV  LMIPFMKRKI+FW+E+I
Sbjct: 282 VLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWEESI 341

Query: 359 LQPRKSLFHGAKFLKKFMTKTALTHQEN-LLTKDAQGNEYFTSASSEFLMRKLADWSMML 417
           LQPR+S+F  +KF +K ++K       N   T   QG  YF + S+E L+RKLADWS ML
Sbjct: 342 LQPRRSIFPNSKFFRKLISKAPTPSTNNDSATHSEQGLAYFAATSNELLLRKLADWSFML 401

Query: 418 SDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKAL 477
           SDFKTAY+TYE L+ D E  P+Y A CLEWCA+S+LMGAQ+IVTVKM+KNDI+PLI +AL
Sbjct: 402 SDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRAL 461

Query: 478 STYENCATVLPETDK------RNTD-------------------------ELIVVP---V 503
            +YE CA+   E +       +N D                         E+   P    
Sbjct: 462 KSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTPSQSA 521

Query: 504 RSYETRCMILASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELR 563
           +SYETRCM+LA+ELFLSLSDTWT+TPYAI YLETIL +C +GA S+I+IWERL+ CY LR
Sbjct: 522 QSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCYALR 581

Query: 564 VDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQD-IVSKGF 622
           VDPR+K +   +   +S   +  + + +G     S     D S    +   Q  I S G 
Sbjct: 582 VDPRVKSRLTASEIQSSDQNEKLDEESEG-----SDNDSGDESQVCQHKMSQSCIASSGL 636

Query: 623 TRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKL 679
           TRKRKA  FRL+A KKW E K+WRQ  W  Q ++  YS +  A+R+DLILKK++ ++
Sbjct: 637 TRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEKRI 693

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/740 (50%), Positives = 489/740 (66%), Gaps = 84/740 (11%)

Query: 1   MNFSYEHYMNLLFHLDYGKE--TVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNID 58
           M  SYE+YMNLL+H+D+  E  TV SE+AK+IVSNA+SPV+AVTSTS LD H+ E Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQ 118
           S+YMLLRFF  CV+DRDQ NE E + K                       GR RSNSLFQ
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETNFK-----------------------GRPRSNSLFQ 97

Query: 119 RDSTQSQYIRFTKPLGDVIATKNAN-DMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLK 177
           R+S  S ++RFT+PL D++  + ++  MLFDYHSLE++L  YL L+      NTP+ LLK
Sbjct: 98  RES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLK 155

Query: 178 KSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH 237
            SIYH FF+ AISST  LSPYE FNHPV+SL+A+DIS G  Y++ RDLL+ FKN+NS+T 
Sbjct: 156 HSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATK 215

Query: 238 N---FPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPS 294
           +   FP F+N ND+LPV LLCY+D   EQFE CQ+L K +KKQLFVE I LPLW+DS   
Sbjct: 216 SAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDY 275

Query: 295 D---PQVHLHQPVMSSLEEMIYFL----------------NQPKEVTLPYELIQSIYNIL 335
           D   P+  LH P+MSSLEEM+YFL                N      LP  L+++IY+ L
Sbjct: 276 DAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRL 335

Query: 336 DSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQG- 394
           + L+  LMIPFMKRKI+FW+ETILQPRKS+F  AKFL++F++K+A       +   + G 
Sbjct: 336 NLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGA 395

Query: 395 ---NEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVS 451
              + +F ++S+EFL+RKLADWS MLSD++TAYATY++L+ DLE   +Y A CLEWCAVS
Sbjct: 396 VQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVS 455

Query: 452 LLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTDELI-VVPVRSYETRC 510
           +LMGAQ+IVTVKM+KNDI+PLI K+L  YE CA+ L        D  +   P +SYETRC
Sbjct: 456 VLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRC 515

Query: 511 MILASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKH 570
           M+L++ELFLSLSDTWT+TPYAI YLETIL  C LG  SQ+++WE+L+ CYELRVDPR+ H
Sbjct: 516 MLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSH 575

Query: 571 KAAG------------TIANTSSPKKSSES------DMQGHVMTPSPLTKED--VSNDAN 610
             A             + +N  +P+  SES      +  G+    S    +D  +SN   
Sbjct: 576 IHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREK 635

Query: 611 NDTD---------QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSK 661
              D         +DI   G TR+RKAAFFRL+AA KW EQK+W+Q SW L+ +D  YS 
Sbjct: 636 EHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSG 695

Query: 662 IGLADRDDLILKKIQNKLKT 681
           +  + R  LIL+++  +++ 
Sbjct: 696 LVFSYRKGLILERLVGEIEA 715

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/725 (50%), Positives = 474/725 (65%), Gaps = 72/725 (9%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M  S+  YMNL FHLD   E VP+EI+++IVS+A+SPV+ VTST+ LD HI E+Y +DSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
           YMLLR+F  CVSDRDQA                            + R R+RSNSLFQR 
Sbjct: 61  YMLLRYFGDCVSDRDQAE-----------------AGPELGTESGKNRNRARSNSLFQRQ 103

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180
           +  S Y+RFT+PL D+I  + + D+LFDYHSLE++L+ YL L++ NT  +TP+ LL+ SI
Sbjct: 104 A--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSI 161

Query: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240
           YH FF+ AISST  LSPYE FNHPV SL+A+DIS  Q Y++ RDLL+ FKN++++T +FP
Sbjct: 162 YHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFP 221

Query: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY--PSDPQV 298
            F+N ND+LPV LLCY++   EQFE CQ+L+K IKKQLFVE + LP W  +    + P  
Sbjct: 222 AFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSR 281

Query: 299 HLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETI 358
            LHQP+MSSLEE +Y + +   +TLP  LI  IY+ L +L+  LMIPFMKRKI+FWDE+I
Sbjct: 282 ILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESI 341

Query: 359 LQPRKSLFHGAKFLKKFMTKT-ALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMML 417
           LQPRKS+F  +KF +K ++KT A     +  T   QG  YF + S+EF++RKLADWS ML
Sbjct: 342 LQPRKSIFPNSKFFRKLISKTPAPPPASDSATHSQQGVAYFAATSNEFILRKLADWSFML 401

Query: 418 SDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKAL 477
           SDFK AY+TYE L+ D E  P+Y ASCLEWCA+S+LMGAQ+IVTVKM+KNDI+PLI +AL
Sbjct: 402 SDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRAL 461

Query: 478 STYENCA-------------------------TVLPET--DKRNTDEL-------IVVPV 503
            +YE  A                           LP T  D+ +  EL            
Sbjct: 462 KSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAPSQSA 521

Query: 504 RSYETRCMILASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELR 563
           +SYETRCM+LA+ELFLSLSDTWT+TPYAI YLETIL EC LG+ S+I++WERL+ CY LR
Sbjct: 522 QSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALR 581

Query: 564 VDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQDI-----V 618
           VDPR+K K       +   +K  E + +G           D S+D     D  I      
Sbjct: 582 VDPRVKGKLPSLDGQSGQNEKRGE-ESEG----------SDESDDETQKYDHKISQNCMA 630

Query: 619 SKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNK 678
           S G  R+RK+  FRL+A KKW E K+WRQ  W L+ I+  YS++  A+RDDLIL+K++ K
Sbjct: 631 SLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKK 690

Query: 679 LKTAE 683
           +   E
Sbjct: 691 IHEHE 695

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/718 (47%), Positives = 454/718 (63%), Gaps = 110/718 (15%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           M FSYEHYMNLL HL+   ETVP +IA+RIVS+A++PVI VTS+  LD HI+E+Y + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
           Y+L R F GC+SDRDQ  E                            R R RSNSLFQRD
Sbjct: 61  YLLFRLFGGCISDRDQLME-----------------HYTLDDSSTGGRTRKRSNSLFQRD 103

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNT-----------DD 169
           +TQSQ+IRF +PL D++ +      LFD  SLE YL +YL  IQK T           D+
Sbjct: 104 ATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDE 163

Query: 170 NTP-----------YELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQN 218
            TP           ++LL+ ++YH+FF+LA+SSTT +SP+E FN PV++LIA+D+S GQ+
Sbjct: 164 LTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQD 223

Query: 219 YDDVRDLLVDFKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQL 278
           Y+ VRDL+  FKNLN    +FP+F+N ND+LP+++LCYD     Q  TC+ L +KIKK L
Sbjct: 224 YEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCL 283

Query: 279 FVECISLPLWKDSYPSDPQVHLHQPVMSSLEEMIYFL-------------NQPKEVTLPY 325
           FV+ I L LW D  P  P V LH+P+MSSL+E++ F              +      LP 
Sbjct: 284 FVDSIPLALW-DEDPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPL 342

Query: 326 ELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAK-FLKKFMTKTALTHQ 384
            +I  +Y  LD LV  ++IPFM RK  +W+E ILQPRKS+FHG+  F KKF+ KT     
Sbjct: 343 NIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQ-- 400

Query: 385 ENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASC 444
                +D    ++F ++S+E L+RKLADWS+MLSDFKTAY TY+SL++DL++ P Y ASC
Sbjct: 401 -----RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASC 455

Query: 445 LEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTDELIVVPVR 504
           LEWCAVSLL+GAQNIVTVKM+K +I PLIE+A++TY                        
Sbjct: 456 LEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQQGR------------------S 497

Query: 505 SYETRCMILASELFLSLSDTWTSTPYAISYLETILVEC-KLGACSQIMIWERLSDCYELR 563
           SYETRCMIL++ELFL+L DTWTSTPYAI YLETIL +C +LGACSQ+MIWERLSDCY+ R
Sbjct: 498 SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSR 557

Query: 564 VDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFT 623
            DPR+    A  ++  +SP  +   +                          +I+++GFT
Sbjct: 558 TDPRV----ASALSTNTSPGSAQPGN--------------------------EILAQGFT 587

Query: 624 RKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKLKT 681
           RKRKAAFFRL+AAKKWAEQ +WRQV WCL  I D Y+   L D+  L++ ++  ++++
Sbjct: 588 RKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQS 645

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/635 (51%), Positives = 433/635 (68%), Gaps = 62/635 (9%)

Query: 106 RTRGRSRSNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQK 165
           R + R RSNSLFQRDSTQSQYIRFTKP+ D++ T++  D LFD+ SLE  L+ YL +I+ 
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 166 NTDDNTPYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDL 225
           NT  + P+  LKKS+YH FFS+ ++STT L P+E F+HP+VSL+++D++L QNYD  +++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 226 LVDFKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISL 285
           L+ FKN++S T NFP+++N ND+LPV LLCYD    EQ +  + ++ KIKKQLF E I L
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 286 PLWKDS-YPSDPQVHLHQPVMSSLEEMIYFLNQ-------PKEVTLPYELIQSIYNILDS 337
           PLW D  Y +D  V LH+P+MSS++E +YFL Q         +  LP  L++ IY ++ +
Sbjct: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420

Query: 338 LVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFLKKFMTKTALT--------------- 382
           L  NL+IPFM+RKI FWDETILQPRKS+F   K  K FM + +                 
Sbjct: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNSI 479

Query: 383 --HQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKY 440
             H  +LLTKD+ G+EYF++ S+EF +RKLADWSMM+SDFKTAY TYESL+ DLE+  KY
Sbjct: 480 SKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKY 539

Query: 441 SASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTD---- 496
            ASCLEW AVS+LMGAQNIVT KMLKND++PLIE AL +YE     +P +   + +    
Sbjct: 540 MASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSL 599

Query: 497 ------------ELIVVP----VRSYETRCMILASELFLSLSDTWTSTPYAISYLETILV 540
                       E+ ++     +RSYE RCM+L SELFLSLSDTWTSTPYA+ YLETIL 
Sbjct: 600 NSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILS 659

Query: 541 ECKLGACSQIMIWERLSDCYELRVDPRIKH-----------KAAGTIANTSSPKKSSESD 589
           + KLG CSQ ++WERLS CY+LRVDPRIK            KA G+ A+ SS K+ +E  
Sbjct: 660 DYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKY 719

Query: 590 MQGHVMTPSPLTKE-----DVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKR 644
                     + ++     DV+++   D   DI+S GFTRKRKAAFF+L+AAKKW+EQK+
Sbjct: 720 RNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQ 779

Query: 645 WRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKL 679
           WRQ+ WCL+ I++ Y ++G +DR DLIL K++++L
Sbjct: 780 WRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQL 814

 Score =  122 bits (305), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%)

Query: 1  MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
          M FSYE+YMNLLFHLD   E +P++IAKRIV N+I+P+I+VT+T ELD H+ ++YNIDSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRFFSGCVSDRDQANE 79
          YMLLR+F GC+SDRDQ +E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  516 bits (1329), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/692 (42%), Positives = 417/692 (60%), Gaps = 76/692 (10%)

Query: 3   FSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSLYM 62
            SYE YMNL+ + ++  + VP EI++R++ NA+SP ++V ST+ L+ H+ E ++  SLYM
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 63  LLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRDST 122
           LLR+F+  V  R++  E+                            G+ R  S++QR + 
Sbjct: 62  LLRYFADYV--RERGEEVGS------------------------VSGQRRPGSVYQRQT- 94

Query: 123 QSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSIYH 182
            S+Y+RF +PL +VI T        D+  LE  L  +L  I+  T + +P ELLK SI+H
Sbjct: 95  -SRYVRFQRPLEEVIET--VEQQAVDFEDLEEALGQHLRDIEARTTNESPSELLKHSIFH 151

Query: 183 SFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFPIF 242
            F ++   S+T LSPY   NHP+++L+A+D++ G+ Y   R+LLV FKNL S +  FP +
Sbjct: 152 KFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSSKFPSY 209

Query: 243 MNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHLHQ 302
           +NTND+LPV +LC+D+   EQ+ET QAL K IKKQLFVE + LP++ + Y SDP V LH 
Sbjct: 210 INTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTN-YESDPVV-LHP 267

Query: 303 PVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPR 362
           P+ +SL+E +Y  + P  + L  +L+  IY  ++++V +LMIPFM RKI+FWDETILQPR
Sbjct: 268 PITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDETILQPR 327

Query: 363 KSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKT 422
           KS+FHG KFLK+FM KT  +    L T     + YF ++S+EFL+RKLADWS MLSD+KT
Sbjct: 328 KSIFHGNKFLKRFMNKTNSSAAGTLSTS---SDGYFLASSNEFLLRKLADWSFMLSDYKT 384

Query: 423 AYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYEN 482
           AY+ Y  L  D E +P+Y +SC E+ A+SLLMGA +IVT KM+KNDI+PLI K + +   
Sbjct: 385 AYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDSTVA 444

Query: 483 CATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILV-- 540
               L                   + RC++  +ELFLSLSDTWTS P+AI YLE IL   
Sbjct: 445 SLNYLG------------------KFRCLVYMAELFLSLSDTWTSAPFAIKYLELILQNE 486

Query: 541 ECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPL 600
           + KLG  S+ M+WER+S  Y+LR+DPRI                + +  +  + M  +  
Sbjct: 487 QLKLGPLSRTMLWERISYAYQLRIDPRI---------------HTDDEYLSDNFMELT-- 529

Query: 601 TKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYS 660
           T++D   + N      I S G TR RK A FRL+AAKKW E    RQ +W L+  +  Y 
Sbjct: 530 TEDDFCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYR 589

Query: 661 KIGLADRDDLILKKIQNKLKTAETETIDAGAE 692
            +G A+ D  +L ++ + +     ET+ + AE
Sbjct: 590 NLGFANADGTLLSRLVDMV--VHEETVQSLAE 619

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  508 bits (1308), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 288/684 (42%), Positives = 419/684 (61%), Gaps = 71/684 (10%)

Query: 3   FSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSLYM 62
            SYE YMNLL + D   + VP EI+++++ NA+SP I+V ST  L+ H+ E + I SLY 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 63  LLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRDST 122
           LLR+F   + DRDQ +       DKI                     R R NSLFQR+S 
Sbjct: 62  LLRYFGDYIQDRDQLD-------DKISAKLQP------------NNRRQRQNSLFQRNS- 101

Query: 123 QSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSIYH 182
            S+YIRF  PL D+I+  + + +  +++ LE  L  +L  I+++T +++P ELLK SI+H
Sbjct: 102 -SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFH 158

Query: 183 SFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFPIF 242
            F ++ +SSTT LSPY  FNHP+++L+A+DI+ G+ Y+  R+LL++FKNL ++   FP F
Sbjct: 159 KFITM-LSSTT-LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAF 216

Query: 243 MNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHLHQ 302
           +NTND+LPV +LC+D    +Q+ET Q+L K IKKQLFVE + LP++ +    D  + LH 
Sbjct: 217 INTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNF--RDRSIVLHP 274

Query: 303 PVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPR 362
           P+ +SL+E +Y  + P  + L   L++ IY+ ++S+V +LMIPFM RKI+FWDETILQPR
Sbjct: 275 PITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPR 334

Query: 363 KSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKT 422
           KS+FH  K LK+F++K++ +   ++ T     + +F ++S+EFL+RKLADW  MLSD+KT
Sbjct: 335 KSIFHSNKLLKRFISKSSGSPTASMPTS---PDGHFLASSNEFLLRKLADWCFMLSDYKT 391

Query: 423 AYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYEN 482
           AY+ YE L  D E++P Y +SC E+ A+SLLMGA +IVT KM+KNDI+PLI K L    N
Sbjct: 392 AYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDYAVN 451

Query: 483 CATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILVE- 541
               L                   + RCMI  +ELFLSLSDTWTS P+AI YLE IL + 
Sbjct: 452 NIISLD------------------QIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKE 493

Query: 542 -CKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHV-MTPSP 599
             KLG   + +IWER+S  Y LR+DPRI      T           + D++  + + P  
Sbjct: 494 NLKLGPVCRNLIWERISFAYRLRIDPRIHADDDST--------SDCDHDLEEELYLNPHK 545

Query: 600 LTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTY 659
           L    + N            +GFTR RK A F+L+AAKKW +  + RQ +W L+  +  Y
Sbjct: 546 LHCGKIQN------------QGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVY 593

Query: 660 SKIGLADRDDLILKKIQNKLKTAE 683
             +  A+ +  +L ++ + +  +E
Sbjct: 594 RDLPFANAEGTLLSRLADAVVDSE 617

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  478 bits (1231), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 267/689 (38%), Positives = 414/689 (60%), Gaps = 55/689 (7%)

Query: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60
           + FSYE YMNL+ + ++    +P EI+K+++ N +SP I V S  ELD+H+ + YNIDS+
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIXXXXXXXXXXXXXXXKVRTRGRSRSNSLFQRD 120
            ML R+F   + DRDQ        KD                    + GR RS+SLFQR 
Sbjct: 63  SMLFRYFGDYIQDRDQIPS-TTDLKDPGSV----------------SSGRHRSDSLFQRQ 105

Query: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDN-TPYELLKKS 179
           +  S+ +RFT+ L D+I+  ++ D +     ++ +L  YL  ++   ++N TP +LLK S
Sbjct: 106 A--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHS 162

Query: 180 IYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNF 239
           IYH FF + +SS   LS Y  F+HPVV+L+ +DI+ GQ Y++ R++L+ FKNLN++  NF
Sbjct: 163 IYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENF 220

Query: 240 PIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQ-- 297
           P F+N ND+LPV +LCYD+   EQ+E+ QALTK +KKQLFVE +S+ L+    P D Q  
Sbjct: 221 PEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFT---PHDNQKS 277

Query: 298 VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDET 357
             LH P+  SL E ++ ++ P  + +P  L+  IY+ +  +V  +MIPFM RK+ FWDET
Sbjct: 278 TTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDET 337

Query: 358 ILQPRKSLFHGAKFLKKFMTKTA---LTHQENLLTKDAQGNEYFTSASSEFLMRKLADWS 414
           +LQPRKS+F   KF ++F++  +   + H+ N     A+G+  F ++S EFL+RKLADWS
Sbjct: 338 VLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWS 397

Query: 415 MMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIE 474
            MLSDFK AY+ Y+ LT D ES+P+Y A CLE+  +SLLMGAQNI+T K +K +++PL+ 
Sbjct: 398 FMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMT 457

Query: 475 KALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISY 534
           +A+  Y+       + D++++  +I          C++  S+L LSLSDTW S+P A++Y
Sbjct: 458 RAIEQYK-------KQDEKHSLRVI---------HCILTFSDLLLSLSDTWVSSPLAVNY 501

Query: 535 LETILVECKLGACSQIMIWERLSDCYELRVDPRIKHK--AAGTIANTSSPKKSSESDMQG 592
           L  I     LG  + ++I ER++  YE+ +D R+           N +   +++E+  +G
Sbjct: 502 LTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKG 561

Query: 593 HVMTPSPLTKEDVS--NDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650
                + L  +D+    + N     ++ S+G TR RK + ++L+AAKKW E  +  Q  W
Sbjct: 562 E----NGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKW 617

Query: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKL 679
           C+      Y K+ L+ R D +  ++  +L
Sbjct: 618 CIYHAAPAYEKLSLSKRPDGLFHRLSMEL 646

>TPHA0I01670 Chr9 complement(373263..375977) [2715 bp, 904 aa] {ON}
           Anc_8.587 YPL105C
          Length = 904

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 296 PQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFW 354
           PQ   HQ   ++  +M Y    P  VT+P  + +S++N +D++   +  PF  RK+ +W
Sbjct: 179 PQPQQHQ---ANAAQMAYAPGIPPGVTMPISVQESLWNYIDTM-GQIQGPFESRKMDYW 233

>TPHA0L00490 Chr12 complement(82007..82879) [873 bp, 290 aa] {ON} 
          Length = 290

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 69/169 (40%), Gaps = 32/169 (18%)

Query: 307 SLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMK--RKIAFWDETILQPRKS 364
           SLE+++  LN      L Y ++  +Y  + S VY+ ++PFM    K  FW  +++     
Sbjct: 38  SLEQLMQVLNILSLYLLTYTIVSILYWSVMSSVYSFLMPFMGTFSKNIFWLHSLMYINVC 97

Query: 365 LFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAY 424
             +  K L +F          +L  K  + N          L+ K  +   +  D   AY
Sbjct: 98  TMYLVKVLTRF----------SLFQKTLETNR-------LVLVHKCGEMCALQVDVDGAY 140

Query: 425 ATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLI 473
             Y++L +  +SF K             L+ A N++ + ML   + P I
Sbjct: 141 RLYKNLWYLSKSFIK-------------LVFAINLLVLSMLLPVLGPFI 176

>TBLA0D04760 Chr4 complement(1174113..1175261) [1149 bp, 382 aa]
           {ON} Anc_1.418 YCL001W-B
          Length = 382

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 631 FRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAG 690
            +L+  KKW  +K  R++    ++ +D +S   L  +DD+I+       K   + +++ G
Sbjct: 1   MKLLGLKKWNGKKNGREIKLLAENKEDLFSIYQLVKKDDVIV------FKKQVSSSVEGG 54

Query: 691 AEKN 694
            +KN
Sbjct: 55  KKKN 58

>Smik_4.424 Chr4 (770506..772614) [2109 bp, 702 aa] {ON} YDR176W
           (REAL)
          Length = 702

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 33  NAISPVIAVTSTSELDHHILETYNIDSLYMLLRFFSGCVSDRDQANELEKSQ 84
           N  S ++   S +ELD ++LET +I    +L R  S  + D +  +EL  S+
Sbjct: 372 NDASAILPKKSANELDENVLETESISCGPLLSRLLSAVLKDDNGKSELHSSK 423

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,810,663
Number of extensions: 3377895
Number of successful extensions: 12671
Number of sequences better than 10.0: 35
Number of HSP's gapped: 13031
Number of HSP's successfully gapped: 39
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)