Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038708.257ON59659632130.0
NDAI0J014008.257ON58858418480.0
Kpol_392.98.257ON59458718300.0
YDR109C8.257ON71552318030.0
SAKL0H17160g8.257ON73953417870.0
Kwal_56.236078.257ON72551817830.0
KLTH0G13794g8.257ON72551817780.0
Skud_4.3708.257ON71451917690.0
Smik_4.3558.257ON70452117600.0
Suva_2.2698.257ON72552417610.0
CAGL0B01727g8.257ON57758117440.0
KAFR0B055608.257ON60558317450.0
KLLA0F19041g8.257ON76351717440.0
TDEL0F038408.257ON72652417220.0
TBLA0E044008.257ON58959217000.0
ZYRO0C01782g8.257ON73053017130.0
KNAG0H032608.257ON58058216960.0
Ecym_43138.257ON59759516560.0
TPHA0B032408.257ON58558315500.0
AGR092W8.257ON59660215460.0
Skud_14.891.111ON5696045453e-61
Suva_14.931.111ON5435945416e-61
TDEL0C059001.111ON5435935223e-58
Smik_14.861.111ON5435985162e-57
YNL249C (MPA43)1.111ON5426074873e-53
Kwal_33.135301.111ON5345974802e-52
KLTH0F03080g1.111ON5335904627e-50
ZYRO0F16016g1.111ON5425994602e-49
SAKL0C03432g1.111ON5476034401e-46
KNAG0F006601.111ON5356014031e-41
KLLA0C02937g1.111ON5165032924e-27
NCAS0A007801.111ON5495241813e-13
KNAG0D030303.581ON484127860.077
SAKL0F00462g3.581ON484127830.19
AFR279C3.581ON488136830.20
KLLA0D11352g3.581ON485127820.25
Suva_7.83.581ON486121820.27
KNAG0A048608.370ON689108800.46
KLTH0G00440g3.581ON48596790.51
Suva_12.43.581ON485120780.67
Smik_4.4208.370ON681108761.3
NDAI0H002204.9ON810137761.4
YDR172W (SUP35)8.370ON685108761.5
Ecym_60013.581ON486122751.6
SAKL0H14432g8.370ON697101751.7
ZYRO0F14520g8.370ON653105751.8
TBLA0A042508.370ON708113742.1
KAFR0K012805.659ON15176702.5
Smik_4.4058.343ON38784697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03870
         (596 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257   1242   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   716   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   709   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   699   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   692   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   691   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   689   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   686   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   682   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   682   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   676   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   676   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   676   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   667   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   659   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   664   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   657   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   642   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   601   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   600   0.0  
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   214   3e-61
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   213   6e-61
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   205   3e-58
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   203   2e-57
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   192   3e-53
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   189   2e-52
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   182   7e-50
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   181   2e-49
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   174   1e-46
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   159   1e-41
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   117   4e-27
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    74   3e-13
KNAG0D03030 Chr4 complement(543401..544855) [1455 bp, 484 aa] {O...    38   0.077
SAKL0F00462g Chr6 (41362..42816) [1455 bp, 484 aa] {ON} highly s...    37   0.19 
AFR279C Chr6 complement(936284..937750) [1467 bp, 488 aa] {ON} S...    37   0.20 
KLLA0D11352g Chr4 (973371..974828) [1458 bp, 485 aa] {ON} highly...    36   0.25 
Suva_7.8 Chr7 (18332..19792) [1461 bp, 486 aa] {ON} YGL253W (REAL)     36   0.27 
KNAG0A04860 Chr1 complement(697592..699661) [2070 bp, 689 aa] {O...    35   0.46 
KLTH0G00440g Chr7 (28632..30089) [1458 bp, 485 aa] {ON} similar ...    35   0.51 
Suva_12.4 Chr12 (4435..5892) [1458 bp, 485 aa] {ON} YFR053C (REAL)     35   0.67 
Smik_4.420 Chr4 (764410..766455) [2046 bp, 681 aa] {ON} YDR172W ...    34   1.3  
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    34   1.4  
YDR172W Chr4 (808324..810381) [2058 bp, 685 aa] {ON}  SUP35Trans...    34   1.5  
Ecym_6001 Chr6 (4872..6332) [1461 bp, 486 aa] {ON} similar to As...    33   1.6  
SAKL0H14432g Chr8 complement(1250592..1252685) [2094 bp, 697 aa]...    33   1.7  
ZYRO0F14520g Chr6 (1195935..1197896) [1962 bp, 653 aa] {ON} unip...    33   1.8  
TBLA0A04250 Chr1 (1051056..1053182) [2127 bp, 708 aa] {ON} Anc_8...    33   2.1  
KAFR0K01280 Chr11 (266813..267268) [456 bp, 151 aa] {ON} Anc_5.6...    32   2.5  
Smik_4.405 Chr4 (737005..738168) [1164 bp, 387 aa] {ON} YDR161W ...    31   7.9  

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/596 (100%), Positives = 596/596 (100%)

Query: 1   MSVFTEKKNTDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQST 60
           MSVFTEKKNTDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQST
Sbjct: 1   MSVFTEKKNTDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQST 60

Query: 61  REIWQACCFCVKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNV 120
           REIWQACCFCVKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNV
Sbjct: 61  REIWQACCFCVKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNV 120

Query: 121 ILWMDHRAVKEANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELA 180
           ILWMDHRAVKEANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELA
Sbjct: 121 ILWMDHRAVKEANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELA 180

Query: 181 DYLTFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGA 240
           DYLTFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGA
Sbjct: 181 DYLTFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGA 240

Query: 241 LKNDSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQI 300
           LKNDSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQI
Sbjct: 241 LKNDSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQI 300

Query: 301 KNDSSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCT 360
           KNDSSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCT
Sbjct: 301 KNDSSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCT 360

Query: 361 GELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGD 420
           GELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGD
Sbjct: 361 GELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGD 420

Query: 421 YRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSY 480
           YRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSY
Sbjct: 421 YRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSY 480

Query: 481 IYMSGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFG 540
           IYMSGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFG
Sbjct: 481 IYMSGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFG 540

Query: 541 FMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDIDI 596
           FMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDIDI
Sbjct: 541 FMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDIDI 596

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/584 (57%), Positives = 441/584 (75%), Gaps = 7/584 (1%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YY+G+DVGTGSVRAC++D  G + S  E SI+R+ELK + ITQS++EIW+A CFCVK  +
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
            +    +  V GIGFDATCSLV ++K T++ V VGP+F + + ++ILWMDHRA+KE  EI
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           N+TND+CLKYVGG MS+EM++PKIKWLK +M  ++F +CEF++LADYLTFKATG++TRSF
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255
           CSVVCKQG +P GVEGS  GWSK+FL +I LE+L  N Y  LGG++      NF ++G+ 
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246

Query: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAIGRL 315
           + PL+++A+ EL LS+ C+VG+GIIDAYAG +GT+ +   G+  ++    +G+ NAIGRL
Sbjct: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS---GTVDLEQLFRVGMANAIGRL 303

Query: 316 ASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAFK 375
           A+VAGTSTCH++LSKDP+FVPGVWGPY+D +  GYWC EGGQ+CTG LL +VL  HP++K
Sbjct: 304 AAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYK 363

Query: 376 ELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMSA 435
           EL   S    ++KF YLN  L E+  +    S L LAKHIFFYGD  GNRSP ADP M  
Sbjct: 364 ELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKG 423

Query: 436 AIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLMK 495
           AI+G SM+ +L+NLA TYLAACEFIAQQ RQI+E +  AG  +S IYMSGGQCRN LLMK
Sbjct: 424 AIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMK 483

Query: 496 LLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFGF----MLWETMDRMT 551
           LL+DC+GL +++P+Y+D+AVVFGAAILGA+A    +    E D       +LW TM++MT
Sbjct: 484 LLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMT 543

Query: 552 PHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
             G+ + P   +HPDR LLD KY+IFLDMA+ Q++YR +VD ++
Sbjct: 544 KVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/587 (56%), Positives = 441/587 (75%), Gaps = 7/587 (1%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           +Y+G+DVGTGSVRACV++  G +LSL  K I +EELKPN+ITQS+REIWQ  C CV   +
Sbjct: 3   HYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVL 62

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
           ++ ++  S VLGIGFDATCSLV I+K T ++VGVGPNFE+ + N+ILWMDHRAVKE +EI
Sbjct: 63  QESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEI 122

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           NAT DKCLKYVGG MSVEM++PKIKWLKNN+   +F  C+FF+L DYLT+KAT K  RSF
Sbjct: 123 NATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSF 182

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDS-QDNFQSSGK 254
            S VCKQG LP GVEGS  GWSKEF + I L++L+ +++ ++GG++ ++  ++N +S G+
Sbjct: 183 SSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGE 242

Query: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKN--DSSIGLQNAI 312
            +G LS  +  ELGL   C+VG+GIIDAYAG +GT+AA  E    I N  D+S  L ++I
Sbjct: 243 YVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSSI 302

Query: 313 GRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHP 372
           G LA +AGTSTCH+ LS  P+FV G+WGPYRDV++  +WCAEGGQ+CTG LL ++L+ HP
Sbjct: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362

Query: 373 AFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPM 432
           A+ EL        +  F++LNN L EL  ++   S + L KH F YGDY GNRSP +D  
Sbjct: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422

Query: 433 MSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKL 492
           M AAIIGQSM+ ++++LA+ YL+ACEFI+QQ+RQI+  + KAG  +  IYMSGGQ RN+L
Sbjct: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482

Query: 493 LMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIE----CDFGFMLWETMD 548
           LM+LL+DCTGLP+++P+Y+DA+V+FG+AILGA A  +     ++     D G  LW  M 
Sbjct: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKMC 542

Query: 549 RMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
           ++TP GT++ PN VNHPDR LL+ KY+IFLDMAETQRKYR+ +D+I+
Sbjct: 543 KLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 408/523 (78%), Gaps = 13/523 (2%)

Query: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70
           D +  +YVG+DVGTGS RACV+D  GNMLSL EK I RE+L  NFITQS+REIW A C+C
Sbjct: 34  DPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYC 93

Query: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130
           V+T +E+  VD   V GIGFDATCSLV +     +++ VGP+F N D N+ILWMDHRA+K
Sbjct: 94  VRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMK 153

Query: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190
           E  EIN++ DKCLKYVGG MSVEM+IPKIKWLKNN++  +F+ C+FF+L DYLTFKATGK
Sbjct: 154 ETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGK 213

Query: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250
             RSFCS VCKQGFLP GVEGS  GWSKEFL+SIGL +L  N ++ LGG+L+   + NF 
Sbjct: 214 ENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLRE--KKNFL 271

Query: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEG-------SHQIKND 303
           ++G+C+ PL  +A  +LGL+E+CVV +GIIDAYAG +GT+AA  E        +   K D
Sbjct: 272 TAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKD 331

Query: 304 SSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGEL 363
                  AIGRLA+VAGTSTCH+LLSK+P+FV GVWGPYRDV+A G+W AEGGQ+CTG L
Sbjct: 332 ----FNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVL 387

Query: 364 LSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRG 423
           L ++++ HPAF EL + + +A + KF+YLN +L+ L  K KV S + LAKH+FFYGDY G
Sbjct: 388 LDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHG 447

Query: 424 NRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYM 483
           NRSP ADP M A IIGQSM++++E+LAV YL+ACEFI+QQTRQI+E + K+G  ++ I+M
Sbjct: 448 NRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFM 507

Query: 484 SGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA 526
           SGGQCRN LLM+LL+DCTGLPI++P+YVDAAVVFG+A+LGA A
Sbjct: 508 SGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAA 550

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%)

Query: 542 MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
            LW+ M  +T +  ++ PN+  HPDR LLD KYQIFLDM ETQRKYR+MVD ++
Sbjct: 657 FLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/534 (60%), Positives = 417/534 (78%), Gaps = 8/534 (1%)

Query: 1   MSVFTEKKNTDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQST 60
           MS  + ++N   +  YYVG+DVGTGS RAC++D+ GN+LSL E+ I R+ELKP++ITQS+
Sbjct: 22  MSALSMEQN---KMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSS 78

Query: 61  REIWQACCFCVKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNV 120
           +EIW A C+CVK+ ++   V    + GIGFDATCSLV +E  +DK+V VGP+F N + N+
Sbjct: 79  QEIWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNI 138

Query: 121 ILWMDHRAVKEANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELA 180
           ILWMDHRA+ E  EINATNDKCLKYVGG MSVEM+IPKIKWLKNN+    F+KC+FF+LA
Sbjct: 139 ILWMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLA 198

Query: 181 DYLTFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGA 240
           DYLTFKATG  TRS+CS VCKQG LP GVE S +GWSKEFL++IGLEDL  + +  LGG+
Sbjct: 199 DYLTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGS 258

Query: 241 LKNDSQ--DNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEG-- 296
           +K+D      F S+G+C+G L   A  ELGL  +CVVG+G+IDAYAG +GT+AA ++   
Sbjct: 259 IKSDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDI 318

Query: 297 SHQIKNDSS-IGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEG 355
              ++ D+   G+ +A GRLA+VAGTSTCH+ +SKDP+FV GVWGPYRDV+A G+WCAEG
Sbjct: 319 PELVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEG 378

Query: 356 GQTCTGELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHI 415
           GQ+CTG LL++VL+IHPA+ EL + S  A + KF YLN+ L+ LT +    S + LAKH+
Sbjct: 379 GQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHL 438

Query: 416 FFYGDYRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAG 475
           FFYGDY GNRSP ADP M AA+IGQSM++++++LA+ YL ACEFIAQQTRQIVE +  +G
Sbjct: 439 FFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSG 498

Query: 476 THVSYIYMSGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529
             ++ I+MSGGQCRN LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 499 HRIAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 552

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (62%)

Query: 508 PKYVDAAVVFGAAILGATADASRKSVEIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDR 567
           P+  +AA+ FG+    A    + +  +     G  LW+ M  MT  G +++P+  +HPDR
Sbjct: 641 PEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDR 700

Query: 568 KLLDVKYQIFLDMAETQRKYRQMVDDID 595
            LLD KY+IFLDMAETQR+YR+ VD ++
Sbjct: 701 VLLDAKYKIFLDMAETQRRYREAVDKVE 728

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/518 (60%), Positives = 408/518 (78%), Gaps = 4/518 (0%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YY+G+DVGTGS RAC++DS GN+LSL E+ I RE+LKPNFITQS++EIWQA C CVK+ +
Sbjct: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
               V    + GIGFDATCSLV +E+G++K+V VGP+F+N + N+ILWMDHRA++E  +I
Sbjct: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           NAT DKCLKYVGG MSVEM+IPKIKWLKN++  N F +C+FF+LADYLTFKA+GK TRSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKN-DSQDNFQSSGK 254
           CS VCKQG LP GVEGS EGWS+EFL+ IGLED   + +  +GG++KN D   NF S+G+
Sbjct: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273

Query: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGS--HQIKNDSS-IGLQNA 311
            +G +      ELGLS +CVVG+G+IDAYAG +GT+AA ++ S    +K D   +G+  A
Sbjct: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333

Query: 312 IGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIH 371
            GRLA+VAGTSTCH+ +S+DP+FV GVWGPYRD +A  +WCAEGGQ+CTG LL++V++ H
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393

Query: 372 PAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADP 431
           PA+ EL   +  A + KF YLN+ L+ L  + K  S + LA+H+FFYGDY GNRSP ADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453

Query: 432 MMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNK 491
            M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIVE +  +G  ++ I+MSGGQCRN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513

Query: 492 LLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529
           LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (75%)

Query: 538 DFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
           D G  +W  M  MT  G +++P   ++PDRKLLDVKY+IFLDMAETQRKYR +V++++
Sbjct: 666 DNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/518 (61%), Positives = 406/518 (78%), Gaps = 4/518 (0%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YYVG+DVGTGS RAC++DS GN+LSL E+ I RE+LK NFITQS++EIWQA C CVK+ +
Sbjct: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
               V    + GIGFDATCSLV +E+ T+K+V VGP+F N D N+ILWMDHRA++E   I
Sbjct: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           NAT DKCLKYVGG MSVEM+IPKIKWLKN++  N F +C+FF+LADYLTFKA+GK TRSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKN-DSQDNFQSSGK 254
           CS VCKQG LP GVEGS+EGWS+EFL+ IGLE+L  + +  +GG++KN D   NF S+G+
Sbjct: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273

Query: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGS--HQIKNDSS-IGLQNA 311
            +G +      ELGLS +CVVG+G+IDAYAG +GT+AA ++ S    +K D   +G+  A
Sbjct: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333

Query: 312 IGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIH 371
            GRLA+VAGTSTCH+ +S+DP+FV GVWGPYRD +A  +WCAEGGQ+CTG LL++VL+ H
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393

Query: 372 PAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADP 431
           PA+ EL   +  A + KF YLN+ L+ L  + K  S + LAKH+FFYGDY GNRSP ADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453

Query: 432 MMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNK 491
            M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIV+ +  +G  +S I+MSGGQCRN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513

Query: 492 LLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529
           LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%)

Query: 538 DFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593
           D G  +W  M  MT  G +++P    + DR LL+ KY+IFLDMAETQRKYR +VDD
Sbjct: 666 DNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/519 (60%), Positives = 402/519 (77%), Gaps = 5/519 (0%)

Query: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70
           D +  +YVG+DVGTGS RAC++D  GNMLSL EK I REEL+PNFITQS+REIW A C C
Sbjct: 34  DPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHC 93

Query: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130
           VK  I++ +VD   V G+GFDATCSLV +     K V VGP+F   D N+ILWMDHRA+K
Sbjct: 94  VKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMK 153

Query: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190
           E  EIN++ DKCLKYVGG MSVEM+IPKIKWLKNN+   +F+ C+FF+L DYLTFKATGK
Sbjct: 154 ETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGK 213

Query: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250
             RSF S VCKQGFLP GVEGS+ GWS+EFL++IGL +L  + ++ LGG+L++  + NF 
Sbjct: 214 ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRH--KKNFL 271

Query: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQ---IKNDSSIG 307
           S+G+C+G L  +A  ELGL+ENCVV +G+IDAYAG +GT+AA  E   +      D++  
Sbjct: 272 SAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYN 331

Query: 308 LQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYV 367
              AIGRLA+VAGTSTCH+LLSKDP+FV G+WGPYRDV+A G+W AEGGQ+CTG LL +V
Sbjct: 332 YNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHV 391

Query: 368 LSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSP 427
           + IHPA+ EL   +  A + KF+YLN+ML+ +  K    S + LA+H+FFYGDY GNRSP
Sbjct: 392 IKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSP 451

Query: 428 YADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQ 487
            AD  M A IIGQSM++++E+LA+TYL+ACEFI+QQTRQIVE + K+G  +  I+MSGGQ
Sbjct: 452 IADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQ 511

Query: 488 CRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA 526
           CRN LL +LL+DC+GLPI++P+Y+D AVVFG+A+LGA A
Sbjct: 512 CRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAA 550

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 39/54 (72%)

Query: 542 MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
           +LW+ M  +T     + PN   HPDR LLD KYQIFLDMAETQ++YR MVD+++
Sbjct: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/521 (60%), Positives = 404/521 (77%), Gaps = 9/521 (1%)

Query: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70
           + +T +YVG+DVGTGS RAC++D  GN+LSL EK I REEL  NFITQS+REIW A C+C
Sbjct: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84

Query: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130
           V+  I++  VD + + GIGFDATCSLV +     K++ VGP+F N D N+ILWMDHRA+K
Sbjct: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144

Query: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190
           E  EIN + + CLKYVGG MSVEM+IPKIKWLKNN++  +F+ C+FF+L DYLTF+ATGK
Sbjct: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204

Query: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250
             RSF SVVCKQGFLP GVEGS+ GWSK+FL SIGL +L  N ++ LGG+L+N  Q NF 
Sbjct: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRN--QKNFL 262

Query: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIK-----NDSS 305
           S+G+C+GPL  +A  +LGL+E CVV +GIIDAYAG +GT+AA  E   +IK      D  
Sbjct: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPES--EIKGLTENEDYK 320

Query: 306 IGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLS 365
                AIGRLA+VAGTSTCH+LLSK  +FV G+WGPYRDV+A G+W AEGGQ+CTG LL 
Sbjct: 321 HDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLD 380

Query: 366 YVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNR 425
           +V++ HPAF +L   +  A + KF+YLN++L+ L  K K  S + LAKH+FFYGDYRGNR
Sbjct: 381 HVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNR 440

Query: 426 SPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSG 485
           SP ADP M A IIGQSM++++++LAV YL ACEFI+QQTRQI+E + K+G  ++ ++MSG
Sbjct: 441 SPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSG 500

Query: 486 GQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA 526
           GQCRN LLM+LL+DCTGLPI++P+Y+D AVVFG+A+LGA A
Sbjct: 501 GQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAA 541

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 523 GATADASRKSVEIECDFGF-MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMA 581
           G + D  R+++E E D    +LW+ M  +T +  ++ PN   HPDR LLD KYQIFLDM 
Sbjct: 626 GISLDKGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMV 685

Query: 582 ETQRKYRQMVDDID 595
           ETQR YR+MVD ++
Sbjct: 686 ETQRNYRRMVDKVE 699

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/524 (61%), Positives = 401/524 (76%), Gaps = 15/524 (2%)

Query: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70
           D Q  ++VG+DVGTGS RAC++D  G +LSL EK I REE++ NFITQS++EIW A C C
Sbjct: 38  DSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHC 97

Query: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130
           VK  +++ +VD   V GIGFDATCSLV +     K + VGP+F N D N+ILWMDHRA+K
Sbjct: 98  VKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMK 157

Query: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190
           E  EIN+T DKCLKYVGG MSVEMDIPKIKWLKNN++  +FK C+FF L DYLTFKATGK
Sbjct: 158 ETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGK 217

Query: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250
             RSF S VCKQGFLP GVE S  GWS+EFL+SIGL +L  N ++ LGG+L++  + NF 
Sbjct: 218 ENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRD--KKNFL 275

Query: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAAT--------SEGSHQIKN 302
           S+G+C+G L   +  ELGL+++C+VG+GIIDAYAG +GT+AA         SE  H+ KN
Sbjct: 276 SAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHE-KN 334

Query: 303 DSSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGE 362
           D    + +AIGRLA+VAGTSTCH+LLSKDP+FV GVWGPYRDV+A  +W AEGGQ+CTG 
Sbjct: 335 D----INSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGA 390

Query: 363 LLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYR 422
           LL++V+  HPAF EL   +  A I  F+YLN+ML+ L  K    S + LAKH FFYGDY 
Sbjct: 391 LLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYH 450

Query: 423 GNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIY 482
           GNRSP ADP M A IIGQSM++++E+LAVTYL ACEFI+QQTRQI+E + + G  +  I+
Sbjct: 451 GNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIF 510

Query: 483 MSGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA 526
           MSGGQCRN LLM+LL+DCTGLPIM+P+Y+DAAVVFG+A+LGA A
Sbjct: 511 MSGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAA 554

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%)

Query: 524 ATADASRKSVEIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAET 583
           +T+  +R   +  C+ G +LW+ M  +T    ++ PND  HPDR LLD KYQIFLDMAE 
Sbjct: 646 STSTVTRGLQKERCNSGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAEN 705

Query: 584 QRKYRQMVDDIDI 596
           QRKYR MVD ++I
Sbjct: 706 QRKYRNMVDRVEI 718

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/581 (55%), Positives = 427/581 (73%), Gaps = 10/581 (1%)

Query: 15  GYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTA 74
           GYY+G+DVG+GSVRACVVD  G MLS+  + I++EE  P  +TQS+ EIW A C+CVK+A
Sbjct: 2   GYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSA 61

Query: 75  IEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANE 134
           I    V+   +LGIGFDATCSLV + K + + V  GPNF+N + N+I+WMDHRA++E  E
Sbjct: 62  IGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKE 121

Query: 135 INATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRS 194
           IN + D CLKYVGG MSVEM+IPKIKWLKN+M P  FKK  F +L DYLTF A+G  TRS
Sbjct: 122 INRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRS 181

Query: 195 FCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGK 254
           +CS VCKQGFLP GVEGSS+GWS EFL+ IGLE+++ +++++LGG    +   NF  +G 
Sbjct: 182 YCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP---NESGNFTYAGN 238

Query: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAIGR 314
            L  +S   +    ++  C+VG+GIIDAYAG IGT+A+++       N   + ++   GR
Sbjct: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST--IEVPNNKEVVDIEECAGR 296

Query: 315 LASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAF 374
           LA+VAGTSTCH++LSK  +FVPGVWGPYRDV+   YWCAEGGQ+ TG LL+++LSIHP+ 
Sbjct: 297 LAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSA 356

Query: 375 KELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMS 434
            EL N      +DKF +LNN + EL+ K+ + + L L K  F YGDY GNRSP ADP M 
Sbjct: 357 NELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMR 416

Query: 435 AAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLM 494
           AAIIGQSM+ ++++LA TYLAACEFIA QT+ I++T+  AG  +  IYMSGGQCRN +LM
Sbjct: 417 AAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILM 476

Query: 495 KLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFGF--MLWETMDRMTP 552
           +L+++CTGLP+++PKY+D+AVVFG+AILGA A +S K+     D G   +LW TM  MTP
Sbjct: 477 QLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKN---NSDKGGADLLWSTMSNMTP 533

Query: 553 HGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593
            GT + P   +  +RKL++VK++IFLDMA+TQ+ YRQ+V++
Sbjct: 534 DGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/583 (55%), Positives = 429/583 (73%), Gaps = 7/583 (1%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           +++G+DVGTGSVRACV+D  G++L+LV+K I+REELKP FITQS+ EIW + CFCV+  I
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
              K+  + V+GIGFDATCSL  ++K T + + VGP F   D N+I+WMDHRA +E +EI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           N+  D  LKYVGG MS+EM++PKIKWLKN+M    F+K  FF+L DYLTFKATG + RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255
           CS VCKQG LP GVEGS+EGWS+ FLS+ GL +L  N ++ +GG   N    NF S+G+ 
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSR--NFLSAGEY 257

Query: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSS-IGLQNAIGR 314
           +  LS  +  +LGL+E+CVVG+G+IDAYAGLIGTIAA  + S + ++D++   LQNAIGR
Sbjct: 258 VSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR 317

Query: 315 LASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAF 374
           LA+VAGTSTCH+ LS  P+FV GVWGPY+D++A  YWCAEGGQ+CTGELL +V++ HPA+
Sbjct: 318 LAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAY 377

Query: 375 KELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMS 434
           +EL   +  +K+D F+ LN ++ +L  +    + L+L K +F YGDY GNRSP ADP M 
Sbjct: 378 EELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMR 437

Query: 435 AAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLM 494
           A+IIGQSM+  +E+LA+ YLAACEFIA QTR I+  + +AG  +  IYMSGGQCRN +LM
Sbjct: 438 ASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILM 497

Query: 495 KLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECD----FGFMLWETMDRM 550
           +LL+D TGLP+++PKY+DAAVVFGAA++GATA       E   D        LW  M +M
Sbjct: 498 ELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKM 557

Query: 551 TPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593
           T +GT + P    H  + LL+ KY+I++DMA+TQ+KYR ++DD
Sbjct: 558 TGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/517 (60%), Positives = 401/517 (77%), Gaps = 7/517 (1%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YYVG+DVGTGS RACV+D+ GN+LSL E+ I R ELKPN+ITQS++EIW A C+CVK  +
Sbjct: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
               VD   + GIGFDATCSLV ++   ++ VGVGP+F +   N+ILWMDHRA++E  EI
Sbjct: 96  RDSGVDPRTIHGIGFDATCSLVVVDN-NNEDVGVGPDFTDNLQNIILWMDHRAIEETEEI 154

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           NAT DKCLKYVGG MSVEM+IPKIKWLKNN+    F +C+FF+LADYLTFKATG   RS+
Sbjct: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255
           CS VCKQG LP GVEGS  GWSKEFL  IGLE+L  + +  LGG++   ++  F S+G+C
Sbjct: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV---TETTFLSAGEC 271

Query: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATS--EGSHQIKNDS-SIGLQNAI 312
           +G L+ E+  ELGLS +CVVG+G+IDAYAG +GT+AA +  E    +K+D    G+  A 
Sbjct: 272 IGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRAT 331

Query: 313 GRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHP 372
           GRLA+VAGTSTCH+ +SKDP+FV GVWGPYRDV+A G+W AEGGQ+CTG LL++VL+ HP
Sbjct: 332 GRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHP 391

Query: 373 AFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPM 432
           A+ EL   S  A + KF YLN+ L+ L  + K +S + LAKH+FFYGDY GNRSP ADP 
Sbjct: 392 AYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPS 451

Query: 433 MSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKL 492
           M AAIIGQSM++++++L++ YL ACEFIAQQTRQIVE +  +G  ++ I+MSGGQCRN L
Sbjct: 452 MRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGL 511

Query: 493 LMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529
           LM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 512 LMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 548

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 39/52 (75%)

Query: 543 LWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594
           LWE M  MT  G ++ P + + PDR LL+ KY+IFLDMA TQ+KYR++VD++
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/524 (60%), Positives = 397/524 (75%), Gaps = 8/524 (1%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YYVG+DVGTGS RAC++D+ GN+LSL EK I REELKPN+ITQS++EIWQ+ C CVK+ +
Sbjct: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
               V    + GIGFDATCSLV ++   DK+VGVGP F N D N++LWMDHRA+ E NEI
Sbjct: 94  RDSGVPVERIHGIGFDATCSLVVVDD-EDKEVGVGPVFANNDQNIVLWMDHRAIAETNEI 152

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           NATNDKCLKYVGG MSVEM+IPKIKWLKNN+    F KC+FF+LADYLTFKAT K TRSF
Sbjct: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDS----LGGALKNDSQDNFQS 251
           CS VCKQG +P GVEGS EGWSK+FL++I L +L  N +            + +  +F S
Sbjct: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272

Query: 252 SGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSE---GSHQIKNDSSIGL 308
           +G+ +G L  EA  ELGL  +CVVG+G+IDAYAG +GT+AA ++         + +  G+
Sbjct: 273 AGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332

Query: 309 QNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVL 368
             A GRLA+VAGTSTCH+ LS+DPVFV GVWGPYRDV+A G+W AEGGQ+CTG LL++V+
Sbjct: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392

Query: 369 SIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPY 428
           S HPAF EL + S  A I KF YLN+ L+ L  +    S + LAKH++FYGDY GNRSP 
Sbjct: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452

Query: 429 ADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQC 488
           ADP M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIVE +  AG  +S I+MSGGQC
Sbjct: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512

Query: 489 RNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKS 532
           RN LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S  S
Sbjct: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNS 556

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 41/56 (73%)

Query: 540 GFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
           G  LW+ M +MT  G ++ P+  + PDR LL+ KY+IFLDMA++QR+YR+ +D ++
Sbjct: 666 GDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/592 (54%), Positives = 428/592 (72%), Gaps = 22/592 (3%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YY+G+DVGTGS RAC++D  G++LS+ E +I+R+ELKP +ITQST +IW   C C++  +
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 76  EQCKVD--KSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEAN 133
           ++  VD   S + GIGFDATCSLV +   TD++V VGPNFE+ D NVILWMDHRA+ E  
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 134 EINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTR 193
           EIN+T+ KCLKYVGG MSVEM+IPKIKWLKNNM+P ++K C+F +L D+LT+KATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 194 SFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQD--NFQS 251
           SFCS VCKQG LP GVEGS++GW++EFL +IGLEDL  +++  LGG +K DSQ   +F +
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 252 SGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAA-TSEGSHQIKN--DSSIGL 308
           +G+ +G LS+++   +G+S  C V +GIIDAYAG IGTIAA T E   Q+ N  D+  G+
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302

Query: 309 QNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVL 368
             + GRLA VAGTSTCH+ L+  P+FVPGVWGPYRDV+   +WCAEGGQ+CTG LL +VL
Sbjct: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362

Query: 369 SIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPY 428
             HPA+KEL   S    I  F+ LNN + ELT +  +  ++ L K++FFYGD+ GNRSP 
Sbjct: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422

Query: 429 ADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQC 488
           AD  M   IIG SM+ +L +L   YL ACEFIAQQTR IV+ + K+G ++  +YMSGGQC
Sbjct: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482

Query: 489 RNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA--------DASRKSVEIECDFG 540
           RN+LLM+L+S+C GLP+++PK +D AVVFG+A++GA A        D ++K  +I     
Sbjct: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQI----- 537

Query: 541 FMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVD 592
             LW+ M +MT  G ++ P D +    KLL VKYQI+LDM  TQ++YR MV+
Sbjct: 538 --LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/530 (59%), Positives = 402/530 (75%), Gaps = 6/530 (1%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           YY+G+DVGTGS RAC++DS GN++SL EK I REELKP +ITQS++EIW A C+CVKT +
Sbjct: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
               VD   + GIGFDATCSLVA+       V VGP+FEN D N+ILWMDHRAV+E  EI
Sbjct: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           N+TN   LKYVGG MS+EM+IPKIKWLKN+M    F    FF+LAD+LT+KATG  TRSF
Sbjct: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALK---NDSQDNFQSS 252
            S VCKQG LP GVEGS+ GWS EFL+ I L +L  N +  LGG++K   +D + NF S+
Sbjct: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272

Query: 253 GKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAA-TSEGSHQIKN--DSSIGLQ 309
           G+ +G LS EA  +LGL+++CVVG+G+IDAYAG +GT+AA T E   ++       +G+ 
Sbjct: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332

Query: 310 NAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLS 369
            A GRLA+VAGTSTCH+ LS+DP+FVPGVWGPYRDV+A G+WCAEGGQ+CTG LL++VLS
Sbjct: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392

Query: 370 IHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYA 429
            HPA+ +L + S  A + KF YLN+ L+ L    K  S + LAKH+FFYGDY GNRSP A
Sbjct: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452

Query: 430 DPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCR 489
           D  M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIVE + K+G ++S I+MSGGQCR
Sbjct: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512

Query: 490 NKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDF 539
           N LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S  +   + D 
Sbjct: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDL 562

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%)

Query: 540 GFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595
           G  LW+ M  MT  G ++ PN   +PDR LL+ KY+IFLDMA TQR+YR  +D ++
Sbjct: 666 GEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/582 (54%), Positives = 412/582 (70%), Gaps = 9/582 (1%)

Query: 13  QTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVK 72
           + GYY+G+DVGTGS RA ++   G  L+L E  I R+EL+ +FITQS+ EIW A C CV+
Sbjct: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62

Query: 73  TAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEA 132
             + +  V+  LV GIGFDATCSLVA++  T   V VGPNF++   N+ILWMDHRA +E 
Sbjct: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122

Query: 133 NEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRT 192
           + INAT D+CLKYVGG MSVEM++PKIKWLK +M    F KC+FF+L DYLTF AT K  
Sbjct: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182

Query: 193 RSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSS 252
           RSFCS VCKQG LP GV+GS   WS EFL ++GL +L   ++  LGG   ++S+  F ++
Sbjct: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGT--SESKPKFLTA 240

Query: 253 GKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAI 312
           G+ +G L+ EA  + GLS +C+V +G+IDAYAG IG++ A  + SH+     S GL  AI
Sbjct: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHK-----SSGLDVAI 295

Query: 313 GRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHP 372
            RLA +AGTSTCH++LSK P FVPGVWGPYRDV+  GYWCAEGGQ+CTG LL+++L  HP
Sbjct: 296 TRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHP 355

Query: 373 AFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPM 432
           A +EL+  +   ++  F+YL  MLD L +K +V + L+L++  F YGD+ GNRSP ADP 
Sbjct: 356 AHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPS 415

Query: 433 MSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKL 492
           M A +IGQSM+ ++E+LAV YLAACEFIA QTRQIVET+ + G  V  +YMSGGQCRN L
Sbjct: 416 MRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSL 475

Query: 493 LMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFGFMLWETMDRMTP 552
           LM+L++D  G+P++LPKY D  VVFGAA+L     AS+    IE D    LW+ M  MTP
Sbjct: 476 LMQLIADSVGVPVVLPKYTDCCVVFGAALLACC--ASKGCDGIEADQSTRLWDIMTAMTP 533

Query: 553 HGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594
            GT + PND +  +RK +D KY IFLDM E Q+ YR  +D +
Sbjct: 534 MGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/595 (52%), Positives = 420/595 (70%), Gaps = 27/595 (4%)

Query: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75
           +Y+G+DVGT SVRACVVD  G +LSL  K I+R+E++PN++TQS+ EIW+A CFC++  I
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135
              +V K  ++GIGFDATCSLV +E+ T+K V VGPNF++ + ++ILWMDHRA+ E NEI
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195
           N+T  +CLKYVGG MS+EM IPKIKWLKNN+    F KCEF++L D+LT++ATG + RSF
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255
           CS VCK G LP GV+GS++GW ++    IGL +L    +  LGG + + +  NF S+G  
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSS-TASNFLSAGDY 242

Query: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAA-TSEGSHQIKNDSSIGLQNAIGR 314
           +G LS+EA  +LGL+  C+V +G+IDAYAG +GTIAA  + GS   +++       A  R
Sbjct: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESEL------ASSR 296

Query: 315 LASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAF 374
           LA+VAGTSTCH+ +SK P F+ GVWGPYRD +  GYW  EGGQ+CTG LL++VL  HPA+
Sbjct: 297 LATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAY 356

Query: 375 KELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMS 434
             L   +    I KF ++NN L+EL  +    S   L KH+FFYGDY GNRSP ADP M 
Sbjct: 357 DTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMR 416

Query: 435 AAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLM 494
           A IIGQSM+ ++++LA+  L ACEFIAQQTRQIVE I+++G  ++ IYMSGGQCRN +L+
Sbjct: 417 ATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLI 476

Query: 495 KLLSDCTGLPIMLPKYVDAAVVFGAAILGATA------------------DASRKSVEIE 536
           KLL++CT LPI+LPKY+DAAVVFG+A+LG  A                  D  R + E++
Sbjct: 477 KLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELK 536

Query: 537 CDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMV 591
                +LW  M  +T  G ++EP+++   + +LLD KY+IFLDM ETQ++YR +V
Sbjct: 537 PKQS-ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLV 590

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/583 (49%), Positives = 405/583 (69%), Gaps = 8/583 (1%)

Query: 17  YVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAIE 76
           Y+G+DVGTGS RAC+ +  G +L++  K I+++EL+  FITQS+ EIW A    +K  I+
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 77  QCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEIN 136
              VD S + GI FDATCSLV  +K + + + VGPNF++ + N+ILWMDHRA  E + IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 137 ATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSFC 196
           +TNDK LKYVGG MSVE ++PKIKWLK+++ P  F +C F +LAD+LT+KATGK   SF 
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 197 SVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKCL 256
           S VCKQG LP GVEGS  GWSKEFL  IGLE+L+ N+++ LGG++ N  + NF   G  +
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSI-NLKEGNFLIPGDLV 242

Query: 257 GPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGL---QNAIG 313
           G +  +      L  +CVVG G+IDAY+G +GT+A  S+ S ++ +DS   L   + ++G
Sbjct: 243 GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIEGSLG 300

Query: 314 RLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPA 373
           R+A V+GTSTCH++LSK P+F+ GVWGPYRDV+A+  W  EGGQ+ TG LL  ++  HPA
Sbjct: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360

Query: 374 FKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMM 433
           ++EL   +     + F YL+  L+EL +  K++S   L K++F YGDY GNRSP ADP+M
Sbjct: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420

Query: 434 SAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLL 493
           S  IIGQ+M+ ++ +LA+ YLAACEFIA QTR I++T+   G  ++ IYMSGG C+NKLL
Sbjct: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480

Query: 494 MKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADA--SRKSVEIECDFGFMLWETMDRMT 551
           M+L+S+C  LP++L KY+D++VVFGAAILG+ A    S K  ++E     +LW  M  MT
Sbjct: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT 540

Query: 552 PHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594
           P GTL+ P       RK L  KY+++LDM +T  KYR+ ++++
Sbjct: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/602 (48%), Positives = 400/602 (66%), Gaps = 31/602 (5%)

Query: 12  EQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCV 71
           E   YYVG+DVGT   RAC++D  G +L+  +  I+R + K + ITQS+ EIW A C  V
Sbjct: 5   EMKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSV 64

Query: 72  KTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKE 131
           + A+ + +V    V GI FDATCSLV +++ +D +V VGP+F +   NVILWMDHRAV E
Sbjct: 65  RAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAE 124

Query: 132 ANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKR 191
           A+EIN+T    L+YVGG MSVEM +PKIKWL+ +M    F KC+F++L D+LT++ATG  
Sbjct: 125 ASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIE 184

Query: 192 TRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQS 251
           +RSFCS VCK G +PNGV+ S+ GWS+EFL  IGLE+L  + +  LGGAL ++    F+S
Sbjct: 185 SRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGAL-DEPGSEFRS 243

Query: 252 SGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNA 311
           +G+ +G LS  A   LGL+  CVVG+G+IDAYAG +GT+ A+ +G+ +     S G++  
Sbjct: 244 AGEPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARE-----SGGVEEL 298

Query: 312 IGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIH 371
            GRLA+VAGTSTC ++LS+ P FV GVWGPYRDV+A GYWC EGGQ+CTG LL++ L  H
Sbjct: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358

Query: 372 PAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADP 431
           PA+ EL  A+    +  F Y+N  LD+L  +    S   LAKH F YGDY GNRSP ADP
Sbjct: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418

Query: 432 MMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNK 491
            M AA++G SM+ + ++LA+  L A EFIA Q R I++ +  AG HV  +Y+SGGQ RN 
Sbjct: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478

Query: 492 LLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA------------------DASRKSV 533
           LL +LL+D    P++ P++V AAVVFG+A+L A A                   ASR  +
Sbjct: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPM 538

Query: 534 EIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593
                    LW+ M R+T  G ++ P+    PD +LL+ KY++FL+MAE Q+ YR++VDD
Sbjct: 539 H-------RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591

Query: 594 ID 595
           ++
Sbjct: 592 VE 593

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  214 bits (545), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 169/604 (27%), Positives = 291/604 (48%), Gaps = 77/604 (12%)

Query: 6   EKKNTDEQTGYYVGIDVGTGSVRACVVDSCGN-MLSLVEKSINREELKPNFITQSTREIW 64
           E K T +     +GIDVG+ S R  + +   + +L + ++ +   +      ++++ + W
Sbjct: 22  EIKMTKDSARIGIGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDS----SRTSWKFW 77

Query: 65  QACCFCVKTAIEQC----KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNV 120
           Q     +K A+++C    K+ +  V   G  ATCSL   EK  DK+ G    + N D NV
Sbjct: 78  QRSTEIIK-ALQKCLQKLKITEYNVKSCGVSATCSLAIFEK--DKRNGSLIPYPNED-NV 133

Query: 121 ILWMDHRAVKEANEINAT-NDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFEL 179
           I WMD  A+ E  ++NA  + + L ++GG+   EM IPK+K+  N    N  K+   F+L
Sbjct: 134 IFWMDSSAIDECKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDL 193

Query: 180 ADYLTFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGG 239
             Y+ ++ +     +   ++ ++     GV+G + GWS  F  +I               
Sbjct: 194 HQYIAYELSHLYQWNNEVLLKRENNKMVGVDGEASGWSPSFYENI--------------- 238

Query: 240 ALKNDSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQ 299
            +   S     S+G     +++ A++      +C      ID+YA      +   E S  
Sbjct: 239 -MHLPSNVIIGSNGATCKKIASSAIVR-----SC------IDSYASWFAVSSPHLETS-- 284

Query: 300 IKNDSSIGLQNAIGRLASVAGTSTCHLLLSK-DPVFVPGVWGPYRDVVADG--YWCAEGG 356
                          L  +AGTSTC++  +    + +PGVWGP+  ++     +     G
Sbjct: 285 ---------------LFMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAG 329

Query: 357 QTCTGELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIF 416
           Q+CTG+L+ ++   HP  KE++        D +Q L   + ++  K    S     K IF
Sbjct: 330 QSCTGKLIEHLFVTHPCAKEILKRGA----DIYQVLERTIHDIE-KQNGQSVHVFTKDIF 384

Query: 417 FYGDYRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKA-- 474
           FYGDY GNR+P+ADP M  + IG++ + ++ NL   Y+   EF++ QTR I++T ++   
Sbjct: 385 FYGDYEGNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNI 444

Query: 475 GTHVSYIYMSGGQCRNKLLMKLLSDC-TGLPIMLPK-YVDAAVVFGAAILGATADASRKS 532
           G  +  + +SG Q +NK L+ L+S    G+ I  PK  VD   V GA +L  +A+  ++ 
Sbjct: 445 GMCIQELRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQI 504

Query: 533 VEIECDFGFMLWETMDRMTPHGTLLEPNDVNHPD--RKLLDVKYQIFLDMAETQRKYRQM 590
           +++         +T D       L E   +N     R+LL  KY+I LDMA+ Q++Y ++
Sbjct: 505 IDV-----IRERDTSDDNEKFEPLPEYQLLNDSSLLRRLLWAKYRIHLDMAKQQQRYHKL 559

Query: 591 VDDI 594
           +D++
Sbjct: 560 IDEV 563

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  213 bits (541), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 177/594 (29%), Positives = 284/594 (47%), Gaps = 83/594 (13%)

Query: 18  VGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTR--EIWQACCFCVKTAI 75
           +GID+G+ S R  + D   ++L  +      +E  P +   S +  + WQ     +K A+
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMA-----QEPVPYYHDSSKKSWKFWQKSTEIIK-AL 62

Query: 76  EQC----KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKE 131
           + C    K+ +  V   G  ATCSL   +K  D   G    + N D NVI WMD  AV E
Sbjct: 63  QNCFQELKITQYNVRSCGVSATCSLAIFQK--DLTNGNLIPYPNED-NVIFWMDSSAVDE 119

Query: 132 ANEINAT-NDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190
              +N   + + L Y+GG    EM IPK+K+  N    N  K+   F+L  Y+ ++    
Sbjct: 120 CEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRL 179

Query: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250
              +   +  ++     G +G + GWS  F + I    L  N    L G L +++  +  
Sbjct: 180 YRWNTDELSARENINGIGNDGEASGWSSSFYNDI--MKLPSNVTIGLTG-LNSNNSSSTT 236

Query: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQN 310
           +   C                        ID+YA      +   E S             
Sbjct: 237 TVCSC------------------------IDSYASWFAVSSPNLEAS------------- 259

Query: 311 AIGRLASVAGTSTCHLLLSKDPVF---VPGVWGPYRDVVADG--YWCAEGGQTCTGELLS 365
               L  +AGTSTC++  S  PV    +PGVWGP+  ++     Y     GQ+CTG+L+ 
Sbjct: 260 ----LFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGKLIE 313

Query: 366 YVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNR 425
           ++   HPA ++ I  SG    D ++ L N + ++  K++ +  + LAKH+FFYGDY GNR
Sbjct: 314 HLFKSHPAARK-IQRSGE---DIYEVLENSIQDIEKKNRKSIHI-LAKHMFFYGDYEGNR 368

Query: 426 SPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETI--RKAGTHVSYIYM 483
           +P+AD  M  + IG+S + ++ NL   Y++  EF++ QT+ I++T   + +G  +  + +
Sbjct: 369 TPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELRV 428

Query: 484 SGGQCRNKLLMKLLSDCT-GLPIMLP-KYVDAAVVFGAAILGATADASRKSVEI--ECDF 539
           SG Q +N  L+ L+S    G+ I  P + +D   V GA +LG +A+  ++ ++I  E D 
Sbjct: 429 SGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKKQIIDIIRERDA 488

Query: 540 GFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593
                   +   P GT    ND     R LL VKY+I LDMA+ Q++Y ++VD+
Sbjct: 489 N----ADSEEFEPFGTYQLGNDCILLKR-LLSVKYRIHLDMAKQQQQYHRLVDE 537

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  205 bits (522), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 172/593 (29%), Positives = 280/593 (47%), Gaps = 77/593 (12%)

Query: 18  VGIDVGTGSVRACVVDSCGN-MLSLVEKSINREELKPNFI---TQSTREIWQACCFCVKT 73
           +GID+G+ SVR  +     + M+  V++ I+      + +   TQST EI +     ++ 
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQKISYYYHGDSALWEYTQSTDEIMKV----IER 61

Query: 74  AIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEAN 133
            +   K+D+  +   G  ATCS+    K  +          +   NVI WMD+ +  E  
Sbjct: 62  CLHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTECK 121

Query: 134 EINATNDKCLK-YVGGAMSVEMDIPKIKWLKNNM---DPNMFKKCEFFELADYLTFKATG 189
            +N   +K L+ ++GG    EM IPKI  L N +   D          +L  YL ++   
Sbjct: 122 LLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEIAK 181

Query: 190 KRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNF 249
           +   +F  ++    F   G +G   GWS +F     ++ L   S  ++G   +   +D+F
Sbjct: 182 RFKWNFDRLLNTTNFNEIGHDGELSGWSSKFY----IDTLKIPSNITIGP--EPPLEDDF 235

Query: 250 QSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQ 309
           +    C G                 + A  ID Y+  +   + T E S            
Sbjct: 236 EY---CKG-----------------IVASCIDCYSSWLSLCSPTPEES------------ 263

Query: 310 NAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVV--ADGYWCAEGGQTCTGELLSYV 367
                L  V GTSTC+L  +     +PGVWGP+ D++  ++ Y   EGGQ+CTG+L+ ++
Sbjct: 264 -----LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTGKLIEHL 318

Query: 368 LSIHPAFKELINASGVAKIDKFQYLNNMLDELT-IKHKVNSKLQL-AKHIFFYGDYRGNR 425
           L  HPA      +S +AK D    L  +  E++ I+ +    +    KH+FFYGD++GNR
Sbjct: 319 LQTHPA------SSSIAKDDWPLLLEKIEQEISAIEEQTGRSIHFKTKHMFFYGDFQGNR 372

Query: 426 SPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTH--VSYIYM 483
           +PYADP MS   IG++ + +  NL + Y+   EF+A Q + ++    KA     ++ I +
Sbjct: 373 TPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKITEIRI 432

Query: 484 SGGQCRNKLLMKLLSDC-TGLPIMLPKY-VDAAVVFGAAILGATADASRKSVEIECDFGF 541
            G Q +NK L+ L+S    G  I LPK  V+ + V GA +LG +A  ++  ++       
Sbjct: 433 CGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSALLNKSPLD------- 485

Query: 542 MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594
            L +  D          P+ +N P   LL+ KY+I LDMA+ Q  YR+M++ I
Sbjct: 486 -LIQEKDDQKQVDIFETPSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 165/598 (27%), Positives = 285/598 (47%), Gaps = 89/598 (14%)

Query: 18  VGIDVGTGSVRACVVDSCGN-MLSLVEKSINREELKPNF--ITQSTREIWQACCFCVKTA 74
           +GID+G+ S R  +     + +L + ++ +      P +   T+ + + WQ     ++ A
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPV------PYYQDFTKKSWKFWQKSTEIIE-A 61

Query: 75  IEQC----KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130
           +++C    K+ +  V   G  ATCSL   E+    +  +    EN   NVI WMD  A  
Sbjct: 62  LQKCFQKLKITEYNVKSCGVSATCSLAIFERVHTSEALIPYPNEN---NVIFWMDSSATD 118

Query: 131 EANEINAT-NDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATG 189
           E   +NA  + + L Y+GG    EM IPK+K+  N       K+   F+L  Y+ ++   
Sbjct: 119 ECEWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGR 178

Query: 190 KRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNF 249
               +   ++  +     G +G + GWS  F  +I   ++  N                 
Sbjct: 179 LYQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI--MNIPSNV---------------- 220

Query: 250 QSSGKCLGP--LSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIG 307
                 +GP  L ++ VI   +  +C      ID+YA          E S          
Sbjct: 221 -----IIGPVGLVSKKVISTTVVRSC------IDSYASWFAVSPPFLERS---------- 259

Query: 308 LQNAIGRLASVAGTSTCHLLLSKDPVF---VPGVWGPYRDVVAD--GYWCAEGGQTCTGE 362
                  L  +AGTS+C++  +  PV    +PGVWGP+ +++ D   +     GQ+CTG+
Sbjct: 260 -------LFMIAGTSSCYMYGT--PVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGK 310

Query: 363 LLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYR 422
           L+ ++   HP  ++++ +      D +Q L   +  +  K  ++  + LAK +FFYGDY 
Sbjct: 311 LIEHLFESHPCARKILKSGA----DIYQVLEQTIHGIEKKKGLSIHI-LAKDMFFYGDYE 365

Query: 423 GNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETI--RKAGTHVSY 480
           GNR+P+ADP M  + IG++ + ++ NL   Y++  EF++ QT+ I++T   +KA   +  
Sbjct: 366 GNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQE 425

Query: 481 IYMSGGQCRNKLLMKLLSDC-TGLPIMLPK-YVDAAVVFGAAILGATADASRKSVEI--E 536
           + +SG Q RN+ L+ L+S    G+ I  P+  VD   + GA IL  +A+  ++ V++  E
Sbjct: 426 LRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRE 485

Query: 537 CDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594
            D G    +  ++  P       ND     + LL VKY+I LDMA+ Q+ Y ++VD++
Sbjct: 486 RDVG----DDNEKFQPLSEYCLGNDSTLL-KNLLCVKYRIHLDMAKQQKYYYKLVDEV 538

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  192 bits (487), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 166/607 (27%), Positives = 286/607 (47%), Gaps = 91/607 (14%)

Query: 9   NTDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTR--EIWQA 66
           N+  Q G  +GIDVG+ S R  V +   +  +L+E +   +E  P +   S +  + WQ 
Sbjct: 2   NSSLQVG--IGIDVGSSSARIGVYNYYND--ALLEMA---QEPVPYYQDSSKKSWKFWQK 54

Query: 67  CCFCVKTAIEQC----KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVIL 122
               +K A+++C     + +  V   G  ATCSL   E+  D+   +   + N D NVI 
Sbjct: 55  STEIIK-ALQKCLQKLNIREYEVKSCGVSATCSLAIFER--DRTSNMLIPYPNED-NVIF 110

Query: 123 WMDHRAVKEANEINAT-NDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELAD 181
           WMD  AV E   +N     + L Y+GG    EM +PK+K+  +       K    F+L  
Sbjct: 111 WMDSSAVNECQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQ 170

Query: 182 YLTFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGAL 241
           Y+ ++ +     +   ++ ++     G +G   GWS  F  +I   +L  N   S+G   
Sbjct: 171 YIAYELSRLYEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNII--NLPSNV--SIGTT- 225

Query: 242 KNDSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIK 301
                            ++N+ +       +  V    ID+YA      +   E S    
Sbjct: 226 ---------------SLVANKHI-------STTVVRSCIDSYASWFAVASPHLETS---- 259

Query: 302 NDSSIGLQNAIGRLASVAGTSTCHLL-LSKDPVFVPGVWGPYRDVVADG---YWCAEGGQ 357
                        L  +AGTS+C++   +     +PGVWGP+ D + D    +     GQ
Sbjct: 260 -------------LFMIAGTSSCYMYGTTISDTRIPGVWGPF-DTILDNRGDFSVYAAGQ 305

Query: 358 TCTGELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFF 417
           +CTG+L+ ++   HP  ++++        D +Q L   + ++   + ++  + L K +FF
Sbjct: 306 SCTGKLIEHLFESHPCARKILKDGA----DIYQVLEQTIRDIEKNNGLSIHI-LTKDMFF 360

Query: 418 YGDYRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIR--KAG 475
           YGDY GNR+P+ADP +  + IG+S + ++ NL   Y+   EF++ QT+ I++T +   + 
Sbjct: 361 YGDYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSN 420

Query: 476 THVSYIYMSGGQCRNKLLMKLLSDC-TGLPIMLPKY-VDAAVVFGAAILGATADASRKSV 533
            H+  + +SG Q +N+ L+ L+S    G+ I+ PK  VD   + GA +L  +A   ++  
Sbjct: 421 IHIKELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLA 480

Query: 534 EI--ECDFG--FMLWETMD--RMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKY 587
           ++  E D       +E++   R+     LL         RKLL VKY I LDMA+ Q++Y
Sbjct: 481 DVITERDISNDSEKFESLAEYRLGNDSILL---------RKLLCVKYHIHLDMAKQQKRY 531

Query: 588 RQMVDDI 594
            ++VD++
Sbjct: 532 HKLVDEV 538

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  189 bits (480), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 166/597 (27%), Positives = 271/597 (45%), Gaps = 96/597 (16%)

Query: 18  VGIDVGTGSVRACVVD-SCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAIE 76
           +GID+G+  VR    +      +++V +++N  E +    TQS+ EI +A   C     E
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVEC----FE 63

Query: 77  QCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFEN----RDMNVILWMDHRAVKEA 132
              +D   V   G  ATCSL    + + K +     +E+     D NV+ WMD  A++E 
Sbjct: 64  SLNIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 133 NEIN--ATNDKCLKYVGGAMSVEMDIPKIKWL-----KNNMDPNMFKKCEFFELADYLTF 185
           + IN  A N+K   Y GG+   EM +PK+        KNN D       E F+L  Y+ +
Sbjct: 124 SNINDLAINEKA--YFGGSFIPEMGVPKLASFLKSCSKNNSD------FEVFDLHTYVAY 175

Query: 186 KATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDS 245
               +       ++ +      G +G  +GW  EF             Y+       N  
Sbjct: 176 DLANRYGWDASFLINRPNHNGIGHDGEIKGWKDEF-------------YEKTLKLPPNVR 222

Query: 246 QDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSS 305
                     +GPL       +    + V  A  ID Y+      ++T E S        
Sbjct: 223 ----------IGPLC------INRRFSPVKVASCIDCYSSWFSMFSSTPERS-------- 258

Query: 306 IGLQNAIGRLASVAGTSTCHLLLSKDPV-FVPGVWGPYRDVV----ADGYWCAEGGQTCT 360
                    L   AGTSTC+L  +  P   +PG+WGP+ D++       +   E GQ+ T
Sbjct: 259 ---------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTT 309

Query: 361 GELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGD 420
           G+L+ ++   HPA K  +    V   ++ +   N++++ + +  V+ K    KH+F YG+
Sbjct: 310 GKLIEHLFESHPAAKPYLEDRNVL-FNRLETEINLIEQQSAE-SVHFK---TKHMFNYGE 364

Query: 421 YRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSY 480
            +GNR+PY DP MS   IG+S + +  +L + Y+   EF+A Q R I E +   G  ++ 
Sbjct: 365 LQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPIND 421

Query: 481 IYMSGGQCRNKLLMKLLSDCT-GLPIMLP-KYVDAAVVFGAAILGATADASRKSVEIECD 538
           I ++G Q +N  L+ L+S    G  + +P    D   V GA +LG         VE    
Sbjct: 422 IRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKAKHLGLNVVE---- 477

Query: 539 FGFMLWETMDRMTPHGTL---LEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVD 592
              ++ +     +P   +   +E N+ N   R L ++KY+I+L+MA+TQR+YR+MV+
Sbjct: 478 ---LITQENGGESPMKDIEVRIEKNEENKL-RALFEIKYKIYLNMAQTQRQYREMVN 530

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  182 bits (462), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 160/590 (27%), Positives = 268/590 (45%), Gaps = 80/590 (13%)

Query: 18  VGIDVGTGSVRACVVD-SCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAIE 76
           +GID+G+ +VR  + D     ++ +V K +       N +TQS+ +I  A   C    I+
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGC----IQ 66

Query: 77  QCKVDKSLVLGIGFDATCSLVAIEKGTD--KQVGVGPNFENRDMNVILWMDHRAVKEANE 134
               D   VL  G  ATCSL    +  +  K + +    +    NV+ WMD  A  E   
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 135 INATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRS 194
           +N T  +  +++GG+   EM IPK+  +    +     K E F+L  Y+ ++   K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAEG-HKLEVFDLHSYIAYELAIKYGWD 185

Query: 195 FCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGK 254
              ++ K      G +G  +GW   F           N    L   +K            
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVK------------ 223

Query: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAIGR 314
            +GP      I    +E+ V  A  ID Y+      +++   S                 
Sbjct: 224 -IGP------IHALNTESPVRVASCIDCYSNWFSMCSSSPNNS----------------- 259

Query: 315 LASVAGTSTCHLLL-SKDPVFVPGVWGPYRDVV----ADGYWCAEGGQTCTGELLSYVLS 369
           L   AGTSTC+L   +++   +PGVWGP+ +++    A  +   E GQ+ TG+L+ ++  
Sbjct: 260 LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFE 319

Query: 370 IHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYA 429
            HPA +    A  + K   F  + + +++L      +   + +KH+F YG+ +GNR+PY 
Sbjct: 320 THPAAR----AYSMDKSKLFSAIESAIEKLEQDFGESVHFR-SKHMFTYGELQGNRTPYC 374

Query: 430 DPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCR 489
           D  MS   IG++ + + ++L + Y+   EF+A Q + I E  +     +  I ++G Q +
Sbjct: 375 DSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFK---AEIKDIRIAGSQAK 431

Query: 490 NKLLMKLLSDCTG-LPIMLP-KYVDAAVVFGAAILGATADASRKSVEIECDFGFMLWETM 547
           N  L+ L S     + + +P +  D   V GA +LG    A+ K++ I       L +  
Sbjct: 432 NTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGK---AAHKNINI-----IDLIDKR 483

Query: 548 DRMTPHGTLLEPNDV-NHPD--RKLLDVKYQIFLDMAETQRKYRQMVDDI 594
           DR+  H   L P  + NH    ++LL+ KY+I+LDMA+TQ +YR MVD +
Sbjct: 484 DRLQSHILELGPMKLGNHNTKLKQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  181 bits (460), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 162/599 (27%), Positives = 270/599 (45%), Gaps = 98/599 (16%)

Query: 18  VGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFI----TQSTREIWQACCFCVKT 73
           +GID+G+ SVR  + +   + +   +         P       TQS+REI         T
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREIL--------T 61

Query: 74  AIEQC----KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAV 129
           AI+QC     +DK  +   G  ATCSL   +  T     +  N ++ D NV+ WMD  A+
Sbjct: 62  AIDQCFQELNIDKHEIKSCGVGATCSLAIFQ--TKDNALIPWNLDDPDKNVVFWMDSIAI 119

Query: 130 KEANEINA-TNDKCLKYVGGAMSVEMDIPKIKW----LKNNMDPNMFKKCEFFELADYLT 184
           KE  E+N     +   ++GG+   EM +PK++     LKN  + + F   E  +L  Y+ 
Sbjct: 120 KETQEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTF---EIIDLHRYIA 176

Query: 185 FKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKND 244
                +    + +V         G +G   GWS  F  ++    L  N            
Sbjct: 177 MSLAQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV--LQLPPNI----------- 223

Query: 245 SQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDS 304
                      +GP  +        S+  +  +  ID Y+     + +            
Sbjct: 224 ----------VIGPTKHSQ----HSSKQGLKVSSCIDCYSNWFALLPS------------ 257

Query: 305 SIGLQNAIGRLASVAGTSTCHLLLSKD-PVFVPGVWGPYRDVV--ADGYWCAEGGQTCTG 361
              LQN+   L  V GTSTC+L  S +    +PGVWGP+ ++   +D +   E GQ+CTG
Sbjct: 258 --NLQNS---LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTG 312

Query: 362 ELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDY 421
           +L+ ++   HPA    I+      +  F  +N+ ++++    + +  +Q  KH+FFYGD 
Sbjct: 313 KLIEHLFKTHPA-SSHIDTRDWPHL--FSQINDFIEKVEQNTQDSIHMQ-TKHMFFYGDL 368

Query: 422 RGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIR--KAGTHVS 479
            GNR+PYADP MS   IG++ + +  NL   Y++  EFIA Q + ++           +S
Sbjct: 369 DGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDIS 428

Query: 480 YIYMSGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVV--FGAAILGATADASRKSVEIEC 537
            +   G   +NK L+ LL+       +    +D A++  +G+ ++G  + + +  VE+  
Sbjct: 429 NLQFCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKASTSDKSIVEVAH 488

Query: 538 D--FGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594
           +  + +   E  D     G L+E          LL+VKYQI+ +MAE QRKYR+ V+++
Sbjct: 489 NQTYSYRPPEKTD-----GLLVE----------LLEVKYQIYFNMAEQQRKYRKQVNNV 532

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 161/603 (26%), Positives = 263/603 (43%), Gaps = 97/603 (16%)

Query: 18  VGIDVGTGSVRACVVD-SCGNMLSLVEKSINREEL-KPNFITQSTREIWQACCFCVKTAI 75
           VG+D+G+ SVR  +      ++L +VE+ +           TQST EI  A   C+    
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL- 71

Query: 76  EQCKVDKSLVLGIGFDATCSL----VAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKE 131
              +     ++  G  ATCS+    V    G+   + +     + D NV+ WMD  A + 
Sbjct: 72  -GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASEA 130

Query: 132 ANEINATNDKCLKY-VGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190
            + ++      +K  + G    EM +PK+  L     P   +  E F+L  Y+ +    +
Sbjct: 131 CDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQF-PG--RSLEVFDLHKYIAYDLARR 187

Query: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250
                 ++  +      G +G   GW +EF  ++                LK  +     
Sbjct: 188 YGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------------LKLPAT---- 227

Query: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQN 310
                +GP S      +G+       A  ID YA   G  +   E S             
Sbjct: 228 ---VAVGPASTFKGQRVGV-------ASCIDCYASWFGVCSTQPEQS------------- 264

Query: 311 AIGRLASVAGTSTCHLLLSK-DPVFVPGVWGPYRDVV--ADGYWCA-EGGQTCTGELLSY 366
               L  VAGTSTC+L  S      +PG+WGP+ +++   +  W   E GQ+ TG LL +
Sbjct: 265 ----LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLLEH 320

Query: 367 VLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRS 426
           +   HPA ++    +G      F+ L + + ++       S   LA+H+F YG+ +GNR+
Sbjct: 321 LFETHPAARDYAGDTG----RLFKDLEDRIADMEADSGC-SIHHLARHMFLYGELQGNRT 375

Query: 427 PYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRK-AGTHVSYIYMSG 485
           PYADP M    +G++ + +  NLA+ Y+   EF+A QTRQIVE  R  A   +  + ++G
Sbjct: 376 PYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGELRVAG 435

Query: 486 GQCRNKLLMKLLSDCTG-LPIMLP-KYVDAAVVFGAAILGATADASRKSVEIECDFGFML 543
            Q RN+ L+ L+S   G +P+ +P +    A V GA +LG                 ++ 
Sbjct: 436 SQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKAR--------------YLD 481

Query: 544 WETMDRMTPHGTLLEPNDV----NHPD--------RKLLDVKYQIFLDMAETQRKYRQMV 591
              +D +   G  +   +V    N+P         R+LL+ KY I LDMA+ Q++YR  +
Sbjct: 482 VSLLDVVRKPGATIPTVEVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEI 541

Query: 592 DDI 594
           D +
Sbjct: 542 DAV 544

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  159 bits (403), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 166/601 (27%), Positives = 264/601 (43%), Gaps = 105/601 (17%)

Query: 18  VGIDVGTGSVRACVVD-SCGNMLSLVEKSI------NREELKPNFITQSTREIWQACCFC 70
           +GID+G+ SVR  +      ++L +  K +      NR  L     TQ + EI  A    
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWE--YTQDSAEILTA---- 61

Query: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130
           +K   +   + K  V   G  ATCSLV  E+  D       + E    NV+ WMD  A +
Sbjct: 62  IKECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTF---QHCEGDSRNVVFWMDSMAKE 118

Query: 131 EANEINAT-NDKCLKYVGGAMSVEMDIPKI-KWLKNNMD-PNMFKKCEFFELADYLTFKA 187
           E N +NA      L ++GG    EM IPK+ ++LK+  D P    + E F+L  Y+ +K 
Sbjct: 119 ETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKL 178

Query: 188 TGKRTRSFCSVVCKQGFLPN----GVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKN 243
                + +C    +    PN    G +G   GWSK F             YD +     N
Sbjct: 179 A----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSF-------------YDKIVRLPPN 221

Query: 244 DSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKND 303
                   +  C   + NE        ++ V+    ID Y+     + + ++ +      
Sbjct: 222 -------VTIGCPKTIENE--------DSLVIVDSCIDCYSSWFSPLQSLNKNT------ 260

Query: 304 SSIGLQNAIGRLASVAGTSTCHLL---LSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCT 360
                      L  VAGTSTC++      K    V G+WGP+ D++       E G +C+
Sbjct: 261 -----------LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCS 309

Query: 361 GELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVN-SKLQL-AKHIFFY 418
           G+L+ ++ + HP+   L  ++G       Q ++ + +E+ I    N + +   A + F Y
Sbjct: 310 GKLIEHLFTSHPSAISLNLSTG-------QLISKLEEEINIWETQNATSIHFEACNNFLY 362

Query: 419 GDYRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHV 478
           GD  GNR+P+ DP M    IG+S + +  +L V Y+   E +A QT+ +V+   K  + +
Sbjct: 363 GDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKLNS-I 421

Query: 479 SYIYMSGGQCRNKLLMKLLSDCT-GLPIMLPKY------VDAAVVFG-AAILGATADASR 530
           + +++ G Q +N  L+KL+S       I++PK       V+ A + G A  LG + D   
Sbjct: 422 NELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYLGTSVDLVP 481

Query: 531 KSVEIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQM 590
            S   E      +  T D      T L          KLL  KY I L+MAE Q+++R+M
Sbjct: 482 VSEPREY---ISVKYTNDSDKIQQTKL---------YKLLLTKYIIHLEMAEQQQRFRKM 529

Query: 591 V 591
           V
Sbjct: 530 V 530

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  117 bits (292), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 128/503 (25%), Positives = 210/503 (41%), Gaps = 96/503 (19%)

Query: 18  VGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNF------ITQSTREIWQACCFCV 71
           +G+D+G+   R  + D   +  SLV+++   +E  P F      ITQ T +I  A    V
Sbjct: 6   IGVDLGSTEFRIGIFDYYTD--SLVKET---KEKVPYFRHGNGIITQCTSDILTA----V 56

Query: 72  KTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGP-----NFENRDMNVILWMDH 126
           + A     + +  +  +G  ATCS+V    G  K   + P     +   R  ++I WM  
Sbjct: 57  EKAFNTLYIQEYNICSLGVGATCSMVV---GKQKDENLIPFNLIHDKNGRYHDIIFWMHS 113

Query: 127 RAVKEANEIN-ATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKK--CEFFELADYL 183
            A++E   +N  T++  L + GG    EM IPK+  L       ++K       +L  +L
Sbjct: 114 AAIEETEYLNNITDESILCHFGGKFFPEMAIPKLLHLNK-----LYKDDGLTVLDLHIWL 168

Query: 184 TFKATGKRTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKN 243
            +K + K        V +      G +G   GWSKEF   + L  +              
Sbjct: 169 LWKISLKLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIF------------- 215

Query: 244 DSQDNFQSSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKND 303
                          + N AVI+    +N   G   ID YA                   
Sbjct: 216 ---------------IGNNAVIK----KNEQFGDSCIDCYASWFQCW------------- 243

Query: 304 SSIGLQNAIGRLASVAGTSTCHLLLSK-DPVFVPGVWGPYRDVVA--------DGYWCAE 354
            S  + N    L  VAGTSTC L  S     F+PG+WGP++D++         D Y   E
Sbjct: 244 -STAMLNR--TLFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYE 300

Query: 355 GGQTCTGELLSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKH 414
            G + TG LL  +LS HPA K+       + ++  + + + +D L  +    S   + K+
Sbjct: 301 AGISRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKN 352

Query: 415 IFFYGDYRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKA 474
            FF+ DY    S +     S +I+ +  N  L++LA+ Y+   E +A Q   ++    + 
Sbjct: 353 TFFHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEG 412

Query: 475 GTHVSYIYMSGGQCRNKLLMKLL 497
              +S + ++G Q +N  L+++L
Sbjct: 413 HITISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 121/524 (23%), Positives = 206/524 (39%), Gaps = 109/524 (20%)

Query: 18  VGIDVGTGSVRACVVD-SCGNMLSLVEKSINREELKPNFITQSTREIWQAC--CFCVK-- 72
           +GIDVG+ SVR  + +   G  +    K+I +E L   +  +   ++W      F ++  
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTI----KTIVKEML---YKHEPDSKLWHYTQNAFVMRDS 57

Query: 73  --TAIEQCKVDKSLVLGIGFDATCSLVAIEKGTD----KQVGVGPNFENRDMNVILWMDH 126
             TA+E+  V+  +V   G  ATCS+V +++ +     + + +     N   ++I W DH
Sbjct: 58  IFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDH 117

Query: 127 RAVKEANEIN-----------ATNDKCLKYVGGAMSV--EMDIPKIKWLKNNMDPNMFKK 173
            A  EA  +N              +K L  +G       EM IPK+  L N +    ++ 
Sbjct: 118 TAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYET 177

Query: 174 CEFFELADYLTFKATGKRTRSFCSVVCKQGFLPN----GVEGSSEGWSKEFLSSIGLEDL 229
               E+ D   + A     +   + V  Q   PN    G++G  +GW   F     +  L
Sbjct: 178 PHILEVYDLHVYIAQTLAQKYDWNTVHLQN-KPNVNGIGIDGELQGWDLSFY----VWAL 232

Query: 230 AGNSYDSLGGALKNDSQDNFQSSGKCLGP--LSNEAVIELGLSENCVVGAGIIDAYAGLI 287
              S+                    C+GP  + NE  I        V     ID YA   
Sbjct: 233 PETSFPI------------------CIGPSKVINETSI--------VRPKSCIDCYASWF 266

Query: 288 GTIAATSEGSHQIKNDSSIGLQNAIGRLASVAGTSTCHLLL-----------SKDPVFVP 336
            T A T       K+D+          L   AGTSTC L              + P+ + 
Sbjct: 267 STDACT-------KDDT----------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSL- 308

Query: 337 GVWGPYRDVV-ADGYWCAEGGQTCTGELLSYVLSIHPAFKELINASGVAKIDKFQYLNNM 395
             WGP+ +V+  D     E G + TG LL  + + H    ++  +  VA  +   Y+ N 
Sbjct: 309 -FWGPFTNVLDKDKKSSFEIGFSETGILLEKLFNKH----QITASWSVA--ESINYVENQ 361

Query: 396 LDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYA-DPMMSAAIIGQS-MNHNLENLAVTY 453
           +     + K +  + L   I+ +  Y     P   D   +  + G   +  +   L   Y
Sbjct: 362 I--AIYERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKY 419

Query: 454 LAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLMKLL 497
           +A  E++A Q   ++   +K    ++++ +SG Q +NK L+ L+
Sbjct: 420 IAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>KNAG0D03030 Chr4 complement(543401..544855) [1455 bp, 484 aa] {ON}
           Anc_3.581 YGL253W
          Length = 484

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 23/127 (18%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGN-----------MLSLVEKSINREELKPNFITQ 58
           T ++ G Y+ ID+G  ++R  +V   GN           +   +  + NR+EL  +FI Q
Sbjct: 75  TGKEKGDYLAIDLGGTNLRVVLVKLSGNGTFDTTQSKYKLPKHIRTTQNRDELF-SFIAQ 133

Query: 59  STREIWQACCFCVKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVG---PNFEN 115
           S ++      F V+T  + CK  ++L LG  F    S   I  G  ++   G   PN E 
Sbjct: 134 SLKD------FIVETFPDGCK--ENLPLGFTFSYPASQTRINSGVLQRWTKGFDIPNVEG 185

Query: 116 RDMNVIL 122
            D+  +L
Sbjct: 186 HDVVPLL 192

>SAKL0F00462g Chr6 (41362..42816) [1455 bp, 484 aa] {ON} highly
           similar to uniprot|P04807 Saccharomyces cerevisiae
           YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
           phosphorylation of glucose in the cytosol predominate
           hexokinase during growth on glucose functions in the
           nucleus to repress expression of HXK1 and GLK1 and to
           induce expression of its own gene
          Length = 484

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCF 69
           T +++G Y+ ID+G  ++R  +V   GN     + + ++ +L  +  T S  E+W     
Sbjct: 75  TGKESGDYLAIDLGGTNLRVVLVKLGGN--RDFDTTQSKYKLPDHIRTSSADELWSFIAD 132

Query: 70  CVKTAIEQC---KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDH 126
           C+K  +++     V + L LG  F    S   I +G  ++   G + E  +   ++ M  
Sbjct: 133 CLKIFVDEQYPEGVTEPLPLGFTFSYPASQDKINEGVLQRWTKGFDIEGVEGKDVVPMLQ 192

Query: 127 RAVKEAN 133
             +K+ N
Sbjct: 193 EQLKKRN 199

>AFR279C Chr6 complement(936284..937750) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL253W
           (HXK2) and YFR053C (HXK1)
          Length = 488

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 58/136 (42%), Gaps = 11/136 (8%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFI--TQSTREIWQAC 67
           T  +TG Y+ ID+G  ++R  +V   GN      +S  R    PN +  TQ+  E+W   
Sbjct: 75  TGNETGDYLAIDLGGTNLRVVLVKLLGNHQFDTTQSKYR---LPNRMRTTQNASELWDFI 131

Query: 68  CFCVKTAIEQC---KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVG---PNFENRDMNVI 121
              +K  +E+     V ++L LG  F    S   I  G  ++   G   P  E  D+  +
Sbjct: 132 AESLKDFLEEQFPEGVHQTLPLGFTFSYPASQDKINMGILQRWTKGFDIPGVEGHDVVPM 191

Query: 122 LWMDHRAVKEANEINA 137
           L    R V    E+ A
Sbjct: 192 LQESLRKVNVPIEVVA 207

>KLLA0D11352g Chr4 (973371..974828) [1458 bp, 485 aa] {ON} highly
           similar to uniprot|P04807 Saccharomyces cerevisiae
           YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
           phosphorylation of glucose in the cytosol predominate
           hexokinase during growth on glucose functions in the
           nucleus to repress expression of HXK1 and GLK1 and to
           induce expression of its own gene
          Length = 485

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCF 69
           T ++TG ++ +D+G  ++R  +V   GN     + + N+  L  +  T ++ ++W     
Sbjct: 75  TGKETGDFLALDLGGTNLRVVLVKLGGN--HDFDTTQNKYRLPDHLRTGTSEQLWSFIAK 132

Query: 70  CVKTAIEQCKVD---KSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDH 126
           C+K  +++   D   + L LG  F    S   I  G  ++   G + E  + + ++ M  
Sbjct: 133 CLKEFVDEWYPDGVSEPLPLGFTFSYPASQKKINSGVLQRWTKGFDIEGVEGHDVVPMLQ 192

Query: 127 RAVKEAN 133
             +++ N
Sbjct: 193 EQIEKLN 199

>Suva_7.8 Chr7 (18332..19792) [1461 bp, 486 aa] {ON} YGL253W (REAL)
          Length = 486

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFI--TQSTREIWQAC 67
           T +++G ++ ID+G  ++R  +V   G+      +S  R    P+ +  TQ++ E+W+  
Sbjct: 75  TGKESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYR---LPDAMRTTQNSEELWEFI 131

Query: 68  CFCVKTAIEQC---KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVG---PNFENRDMNVI 121
              +KT I++     + + + LG  F    S   I +G  ++   G   PN EN D+  +
Sbjct: 132 ADSLKTFIDEQFPEGISEPIPLGFTFSFPASQNKINEGVLQRWTKGFDIPNIENHDVVPM 191

Query: 122 L 122
           L
Sbjct: 192 L 192

>KNAG0A04860 Chr1 complement(697592..699661) [2070 bp, 689 aa] {ON}
           Anc_8.370 YDR172W
          Length = 689

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 45/108 (41%), Gaps = 18/108 (16%)

Query: 35  CGNMLSLVEKSINREELKPNFITQSTRE-IWQACCFCVKTAIEQCKVDKSLVLGIGFD-- 91
           CG  + L  K +  E++ P F+  S +  I  A  F  + AI + K     ++  GF   
Sbjct: 551 CGEQVKLKIKGVEEEDVTPGFVLTSPKNPIKSATKFVAQIAIVELKS----IMSAGFSCV 606

Query: 92  -----------ATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRA 128
                       T  L  +EKGT+++    P F  + M +I  ++  A
Sbjct: 607 MHVHTAIEEVTVTQLLHKLEKGTNRKSRKPPAFAKKGMKIIAVLETEA 654

>KLTH0G00440g Chr7 (28632..30089) [1458 bp, 485 aa] {ON} similar to
           uniprot|P04807 Saccharomyces cerevisiae YGL253W HXK2
           Hexokinase isoenzyme 2 catalyzes phosphorylation of
           glucose in the cytosol predominate hexokinase during
           growth on glucose functions in the nucleus to repress
           expression of HXK1 and GLK1 and to induce expression of
           its own gene
          Length = 485

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCF 69
           T ++TG Y+ ID+G  ++R  +V   GN     + + ++ +L  +  T S+ E++     
Sbjct: 75  TGQETGDYLAIDLGGTNLRVVLVRLLGN--HKFDTTQSKYKLPDHIRTSSSEELFSFIAD 132

Query: 70  CVKTAIEQ---CKVDKSLVLGIGFDATCSLVAIEKG 102
            +KT +++     V + L LG  F   CS   + +G
Sbjct: 133 SLKTFVDEEFPEGVTEPLPLGFTFSYPCSQDKVNEG 168

>Suva_12.4 Chr12 (4435..5892) [1458 bp, 485 aa] {ON} YFR053C (REAL)
          Length = 485

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 9/120 (7%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNF-ITQSTREIWQACC 68
           T +++G Y+ ID+G  ++R  +V   GN     + + ++ +L  +   TQ   E+W    
Sbjct: 75  TGKESGDYLAIDLGGTNLRVVLVKLSGN--HTFDTTQSKYKLPHDMRTTQHQEELWSFIA 132

Query: 69  FCVKTAI---EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVG---PNFENRDMNVIL 122
            C++  +   E      +L LG  F    S   I +G  ++   G   PN E  D+  +L
Sbjct: 133 DCLRDFMVEQELLNTKDTLPLGFTFSYPASQNKINEGILQRWTKGFDIPNVEGHDVVPLL 192

>Smik_4.420 Chr4 (764410..766455) [2046 bp, 681 aa] {ON} YDR172W
           (REAL)
          Length = 681

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 43/108 (39%), Gaps = 18/108 (16%)

Query: 35  CGNMLSLVEKSINREELKPNFITQSTRE-IWQACCFCVKTAIEQCKVDKSLVLGIGFDAT 93
           CG  + L  K +  E++ P F+  S +  I     F  + AI + K     ++  GF   
Sbjct: 543 CGEQVKLRIKGVEEEDISPGFVLTSPKNPIKSVTKFVAQIAIVELKS----IIAAGFSCV 598

Query: 94  CS-------------LVAIEKGTDKQVGVGPNFENRDMNVILWMDHRA 128
                          L  +EKGT+++    P F  + M VI  ++  A
Sbjct: 599 MHVHTAIEEVHIVKLLHKLEKGTNRKSKKPPAFAKKGMKVIAVLETEA 646

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (11%)

Query: 407 SKLQLAKHIFFYGDYRGNRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQ 466
           S+++ +  + F   + G  +PY DP   A I+G S +    ++A    AA E +  Q R 
Sbjct: 602 SRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRA 658

Query: 467 IVETIR--------KAGTHVSYIYMSGGQCRNKLLMKLLSDCTGLPIMLPKY-VDAAVVF 517
           I++ +         + GT V+ + + GG  ++  +M++ +D  G  I L +  +      
Sbjct: 659 ILKAMSGDKIEDGYEKGTVVT-LSVDGGMSKSDEVMQIQADILGPCIKLRRSPIVECTAL 717

Query: 518 GAAILGATADASRKSVE 534
           GAAI    A+ + K+VE
Sbjct: 718 GAAI---AANMAYKNVE 731

>YDR172W Chr4 (808324..810381) [2058 bp, 685 aa] {ON}
           SUP35Translation termination factor eRF3, has a role in
           mRNA deadenylation and decay; altered protein
           conformation creates the [PSI(+)] prion that alters
           translational fidelity and results in a nonsense
           suppressor phenotype
          Length = 685

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 43/108 (39%), Gaps = 18/108 (16%)

Query: 35  CGNMLSLVEKSINREELKPNFITQSTRE-IWQACCFCVKTAIEQCKVDKSLVLGIGFDAT 93
           CG  + L  K +  E++ P F+  S +  I     F  + AI + K     ++  GF   
Sbjct: 547 CGEQVKLRIKGVEEEDISPGFVLTSPKNPIKSVTKFVAQIAIVELKS----IIAAGFSCV 602

Query: 94  CS-------------LVAIEKGTDKQVGVGPNFENRDMNVILWMDHRA 128
                          L  +EKGT+++    P F  + M VI  ++  A
Sbjct: 603 MHVHTAIEEVHIVKLLHKLEKGTNRKSKKPPAFAKKGMKVIAVLETEA 650

>Ecym_6001 Chr6 (4872..6332) [1461 bp, 486 aa] {ON} similar to
           Ashbya gossypii AFR279C
          Length = 486

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 13/122 (10%)

Query: 10  TDEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELK-PNFI--TQSTREIWQA 66
           T ++TG Y+ ID+G  ++R  +V   GN     +    + + K P+ I  TQ+  E+W  
Sbjct: 75  TGKETGNYLAIDLGGTNLRVVLVTLGGNH----DFDTTQSKYKIPSHIRTTQNHEELWMF 130

Query: 67  CCFCVKTAIEQC---KVDKSLVLGIGFDATCSLVAIEKGTDKQVGVG---PNFENRDMNV 120
               +K  +E      V ++  LG  F    S   I +G  ++   G   PN E +D+  
Sbjct: 131 VAESLKAFLEDQFPDGVKENFPLGFTFSYPASQDKINEGILQRWTKGFDIPNVEGQDVVP 190

Query: 121 IL 122
           +L
Sbjct: 191 ML 192

>SAKL0H14432g Chr8 complement(1250592..1252685) [2094 bp, 697 aa]
           {ON} similar to uniprot|P05453 Saccharomyces cerevisiae
           YDR172W SUP35 Translation termination factor eRF3
           altered protein conformation creates the [PSI( )] prion
           a dominant cytoplasmically inherited protein aggregate
           that alters translational fidelity and creates a
           nonsense suppressor phenotype
          Length = 697

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 18/101 (17%)

Query: 35  CGNMLSLVEKSINREELKPNFITQSTRE-IWQACCFCVKTAIEQCKVDKSLVLGIGFD-- 91
           CG  + L  K +  E++ P F+  S +  +     F  + AI + K     ++  GF   
Sbjct: 559 CGEQVRLKIKGVEEEDISPGFVLTSPKNPVKNVSKFVAQIAIVELKS----IMSAGFSCV 614

Query: 92  -----------ATCSLVAIEKGTDKQVGVGPNFENRDMNVI 121
                       T  L  +EKGT+++    P F  R M +I
Sbjct: 615 MHIHTAIEEVTITQLLHKLEKGTNRKSKKPPAFAKRGMKII 655

>ZYRO0F14520g Chr6 (1195935..1197896) [1962 bp, 653 aa] {ON}
           uniprot|Q9HGI4 Zygosaccharomyces rouxii SUP35 Eukaryotic
           peptide chain release factor GTP-binding subunit
          Length = 653

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 18/105 (17%)

Query: 35  CGNMLSLVEKSINREELKPNFITQSTRE-IWQACCFCVKTAIEQCKVDKSLVLGIGFD-- 91
           CG  + L  K +  E++ P F+  S +  +     F  + AI + K     +L  GF   
Sbjct: 515 CGEQVKLKIKGVEEEDIAPGFVLTSPKNPVKNVTKFVAQVAIVELKS----ILSSGFSCV 570

Query: 92  -----------ATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMD 125
                       T  L  +EKGT+++    P F  + M +I  ++
Sbjct: 571 MHVHTAIEEVRITRLLHKLEKGTNRKSKKPPAFAKKGMKIIALLE 615

>TBLA0A04250 Chr1 (1051056..1053182) [2127 bp, 708 aa] {ON}
           Anc_8.370 YDR172W
          Length = 708

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 44/113 (38%), Gaps = 34/113 (30%)

Query: 35  CGNMLSLVEKSINREELKPNFITQS--------TREIWQ--------------ACCFCVK 72
           CG  + L  K +  E++ P F+  S        TR + Q              +C   V 
Sbjct: 570 CGEQVKLRIKGVEEEDISPGFVLTSPKNPIKNVTRFVAQIAIVELKSIMSAGFSCVMHVH 629

Query: 73  TAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMD 125
           TAIE+  +            T  L  +EKGT+++    P F  + M +I  ++
Sbjct: 630 TAIEEVTI------------TRLLHKLEKGTNRKSKKPPAFAKKGMKIIALLE 670

>KAFR0K01280 Chr11 (266813..267268) [456 bp, 151 aa] {ON} Anc_5.659
           YKR074W
          Length = 151

 Score = 31.6 bits (70), Expect = 2.5,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 16/76 (21%)

Query: 128 AVKEANEINATNDKCLKYVGGAMSVEM------DIPKIKWLKNNMDPNMFKKCEF----- 176
           A +    +N    K   +  G+ +V +      D P+  W+ +  DPN  K C++     
Sbjct: 69  AYRPYRNVNYDTMKIYTHAHGSKTVNLVINFTHDNPEDNWVLDTKDPNGKKLCQYDIENE 128

Query: 177 -----FELADYLTFKA 187
                F L DYL FKA
Sbjct: 129 TEISLFNLEDYLEFKA 144

>Smik_4.405 Chr4 (737005..738168) [1164 bp, 387 aa] {ON} YDR161W
           (REAL)
          Length = 387

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNN-MDPNMFKKC-EFFELADYLTFKATGKRTR 193
           N TND+  K VGG +S+ ++I    W+ +  M+PN  K+C E  + A  LT   + +   
Sbjct: 113 NLTNDQVEKIVGGLLSM-IEI----WMTDLCMEPNAEKQCEELIQKAMELTEGKSPETWS 167

Query: 194 SFCSVVCKQGFLPNGVEGSSEGWS 217
           +  S+   Q       E  S+ W+
Sbjct: 168 TLGSIKISQQKFGEAYEAFSQAWN 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,298,452
Number of extensions: 2650376
Number of successful extensions: 6226
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6274
Number of HSP's successfully gapped: 76
Length of query: 596
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 481
Effective length of database: 40,294,809
Effective search space: 19381803129
Effective search space used: 19381803129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)