Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038608.261ON58358329280.0
NDAI0J013908.261ON58358718680.0
YLR088W (GAA1)8.261ON61460318460.0
Skud_12.1568.261ON61261018130.0
Suva_10.1728.261ON61461217980.0
Smik_12.1478.261ON61361117900.0
SAKL0H17050g8.261ON58457317630.0
TDEL0F038808.261ON57958217390.0
Kpol_543.378.261ON57858117350.0
KLTH0G13706g8.261ON58456816990.0
KLLA0F19118g8.261ON57857616940.0
TBLA0F030808.261ON58358516940.0
ZYRO0C01672g8.261ON56958316740.0
Ecym_43098.261ON57757916670.0
Kwal_56.238048.261ON57858116480.0
AGR087C8.261ON57757916460.0
KAFR0B055508.261ON55555016300.0
KNAG0H032508.261ON58558716270.0
CAGL0L12232g8.261ON59157316190.0
TPHA0A018208.261ON58158315200.0
SAKL0G07018g5.614ON59299714.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03860
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...  1132   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   724   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   715   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   702   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   697   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   694   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   683   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   674   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   672   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   659   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   657   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   657   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   649   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   646   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   639   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   638   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   632   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   631   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   628   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   590   0.0  
SAKL0G07018g Chr7 complement(575361..577139) [1779 bp, 592 aa] {...    32   4.5  

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/583 (95%), Positives = 557/583 (95%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           MGLFERVQRQVIARGLIPKVISLLPLISTLC           PFEGQYRNTYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
           GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           ILLAVNIIICLYPAILKGNAFMKDLLSYRLRS               VNFPLAFGMGLLS
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS 540
           FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS
Sbjct: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS 540

Query: 541 RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ 583
           RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ
Sbjct: 541 RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ 583

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/587 (60%), Positives = 454/587 (77%), Gaps = 8/587 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           MGL ERVQR +++RGLIPK+++ LP IS +            P +GQYRNTYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRE+EWNIVRGYR+++V + N+++ ERN IM  WL +FG KT IY+N +  + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDN-EVL 119

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGVFHAPRGDGTE++VLA+PWFN DGEFN NGAA+GVALARYFSRWPVWSKNIIVVF+EN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P +ALRSWVEAY+TSLDLTGGSIEAAIVLD  GE D FDY+E+YYDGLNGELPNLD+VNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
           G++ AEHEGM+VSLHGTPFD+IKE+  ++RLKIL++SI++SA SG+ KT+GNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QS+TL+ +G +GP D+T FGRVPEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S V +S+ F +A ++SY NNP + LPFFS YTL+  + W V+LV  FI++ +F+  P P+
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           +LL +NI+I +   I++     K  +S RLRS               VNFPL+F +GL++
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNE----FSGLDVFERL 536
           FPMT+V++IT++T    + +++N +LL++SNPFIA  +++ +  N       GL V  RL
Sbjct: 480 FPMTKVRSITANTA--PQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537

Query: 537 VSASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ 583
           +SA +++ CWTW VLC+GW   W++VAIS ++  +    S D KK +
Sbjct: 538 ISAWKDMRCWTWFVLCLGWLPSWIMVAISVIENER-EPTSHDVKKNE 583

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/603 (57%), Positives = 436/603 (72%), Gaps = 35/603 (5%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L E++ R+++  GL+P++I+LLP+IS LC           P +GQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWNI+RGYRSQI E+ N +++ERN +M  WLQ+FGTKT IY+N + G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV HAPRGDGTE+MVLA+PWFN+D EFN+ GAALGV+LAR+FSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P+AALRSWVEAYHTSLDLTGGSIEAA+VLD++   D F+Y+EI YDGLNGELPNLD+VNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEGMKVSLHG P D++  +  +SRLKIL   I++ ALSGVKK +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QSVTL+A G +G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S VA+SI FA++SLN++ NN Y  +  FS Y L+++L WFVSLV++F+VS  F+  P   
Sbjct: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           +L+ +++  C  P IL     + + LSYRL++               +NF +A  +G L+
Sbjct: 420 LLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479

Query: 481 FPMTQVKTI----------------------------------TSDTPTISRTRVKNSVL 506
           FPMT VKTI                                  T  TP   + ++KN VL
Sbjct: 480 FPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVL 539

Query: 507 LLVSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISA 566
           L+++NPFI+  LF L  D+EF G D+  +LVSA  +L CW+W VLC+GW   WLL+  S+
Sbjct: 540 LILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599

Query: 567 LDT 569
            ++
Sbjct: 600 FES 602

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/610 (56%), Positives = 440/610 (72%), Gaps = 33/610 (5%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L E++ R+++  GL+P++I+LLP+ISTLC           P +GQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWN++RGYRSQI E+ N ++ ERN  M  WLQ+FGTKT IY++ + G+TL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV HAPRGDGTE+MVLAIPWFN+D EFNV GAALGV+LAR+FSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P+AALRSWVEAYHTSLDLTGGSIEAA+VLD++   D F+Y+EI YDGLNGELPNLD+VNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEGMKVSLHG P+D++  +  +SRLKIL   I++ ALSGVK  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QSVTL+A G  G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S VA S+ FA++SLN++ NN Y ++  FS Y L+++L WF+SLVV+FI+S IF+  P   
Sbjct: 360 SAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           +L+ +++  C  P +L     + + LSYRL++               +NF +A  +G L+
Sbjct: 420 LLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLA 479

Query: 481 FPMTQVKTIT------SDTPTISRTRVK------------NSVL--------------LL 508
           FPMT ++TI        +  T S T VK            ++VL              L+
Sbjct: 480 FPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLLV 539

Query: 509 VSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISALD 568
           ++NPFI+  LF+L+ DNEF G D+  +L+SA  +L CW W VLC+GW   WLL+  S+ +
Sbjct: 540 LTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFE 599

Query: 569 TVKLSNDSED 578
           +  +   S++
Sbjct: 600 SRSVVVKSKE 609

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/612 (54%), Positives = 438/612 (71%), Gaps = 35/612 (5%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L E++ R+V+  GL+P+VI+LLP+ISTLC           P +GQYR TYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRE+EWNI+RGYRSQI E  N ++ ERN +M  WLQ+FGTKT IY+N + G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV HAPRGDGTE+MVLAIPWFN++ EFNV GA+LGV+LAR+FSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P AALRSWVEAYHTSLDLTGGSIEAA+VLD++   D F+Y+E+ YDGLNGELPNLD+VN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEGMKVSLHG P++++ ++  FSRLKIL   I++ ALSGVK  +GNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QSVTL+A G  G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S VA+S+ FA++SLN++ NN Y ++  FS Y L+++L WF+++VV+F++S +F+      
Sbjct: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           +L+ +++ IC  P  L G   + + LSYRL++               +NF +A  +G L+
Sbjct: 420 LLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479

Query: 481 FPMTQVKTITSDTPTISRTRVKNSVLL--------------------------------- 507
           FPMT +KTI  + P    T  ++++ +                                 
Sbjct: 480 FPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLL 539

Query: 508 -LVSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISA 566
            +++NPFI+  +F LL D+EF G D+  +LVSA  +L CW+W +LC+GW   WLL+  S+
Sbjct: 540 LILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILASS 599

Query: 567 LDTVKLSNDSED 578
            ++  +   S++
Sbjct: 600 FESKSVVVKSKE 611

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/611 (54%), Positives = 438/611 (71%), Gaps = 34/611 (5%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L E++ R+++  GL+P++I+ LP++S +C           P +GQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWNI+RGYRSQI E+ N +++ERN IM  WLQ+FGTKT IY+N + G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV HAPRGDGTE+MVLA+PWFN+D +FNV GAALGV+LAR+FSRWPVWSKNII+VF+EN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P AALRSWVEAYHTSLDLTGGSIEAA+V+D++   D F+Y+EI YDGLNGELPNLD+VN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEGMKVSLHG P D++  +  +SRLK+L   I++ AL+GVK  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QSVTL+A G +G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S VA+S+ FA++SLN++ NN Y ++  FS Y L+++L WF+SLV++F+VS +F+  P   
Sbjct: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           +L+A+++I C  P IL     + + LSYRL++               +NF +A  +G L+
Sbjct: 420 LLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLA 479

Query: 481 FPMTQVKTI--------TSDTPTIS-RTRVKNSVLLL----------------------- 508
           FPMT VKTI         S  P IS +T  K    L+                       
Sbjct: 480 FPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLL 539

Query: 509 -VSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISAL 567
            ++NPFI+  +F    D+EF G DV  +LVSA  +L CW+W VLC+GW   WLLV  S+ 
Sbjct: 540 VLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599

Query: 568 DTVKLSNDSED 578
           ++ ++   S++
Sbjct: 600 ESKRVMLKSKE 610

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/573 (57%), Positives = 426/573 (74%), Gaps = 6/573 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXX-XXXXXPFEGQYRNTYISENALM 59
           M L E++ R+ I  GL+PK I+LLP +S  C            P +GQ+R TYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119
           PSQAYSYFRE+EWN++RGYR+QI   + +S  ERN  +S WLQQFG KT IY N E G+T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179
           LYG+ HAPRGDGTE+MVLA PW+N++ ++N  G AL V+L+R+FSRWPVWSKNII+V +E
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239
           +P+AALRSWVEAYHTSLDLTGGSIEAA+V+DF G  D F Y+EI++DGLNGELPNLD+VN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299
           + V   EHEGMKVSLHG   +++ ++  FSR+K ++  +KN ALSG+KK++GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359
           I SVTL+A G +GPFD+T+FGR+PEA+FRS+NNLLEKFHQSFFFYL+LAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419
           P+ VA+S+ FALASLN+  NN Y +LP  S Y + ++L + V+L V+FI +  F+Y+P P
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLL 479
            +LL++N+++ L P I      ++   SYRL+S               VNF LAFG+G L
Sbjct: 421 ELLLSLNVLLLLMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539
           +FPMT V+T + +     R R+KN VLLL+SNPFIA WLF++  D E  G+ VF  L SA
Sbjct: 480 AFPMTLVRTTSGNL----RARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535

Query: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKL 572
            ++LGCWTW V+C+GW   WLLVA S +D+V +
Sbjct: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSI 568

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/582 (56%), Positives = 424/582 (72%), Gaps = 3/582 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L  ++ R+VI  GL+PK+++ LPL+S L            P EG+YR TYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRE+EWN +RGYR+QI  L N+++ ERN  ++ WL++FG KT IYQ+ + GDTL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV HA RGDGTE+++LA PW NADG  N++G ++G+AL R+FSRWPVWSKNIIVV +EN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           PK ++RSWVEAYHTSLDLTGGSIEAA+VLD+ G  D FD++EI+YDGLNGE PNLD+VNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEGMKVSLHG   DKI ++  +SRL I+++ IKN+ALSG++K  GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           Q+VTL+A G  G  DVT+FGR+PEAMFRSINNLLEKFHQSFFFY++LAPR+FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
             V +SI FALASL++  NN Y  LP  S Y LLS+  W +SL+  F ++ +F+    PT
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           IL++ + +I   P +LK    + + L+YRL+S               VNF LAF MGL +
Sbjct: 421 ILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS 540
           FPMT V+T + +  ++ R ++KNS+LLL+SNPFIA+++F    + +  G  VF    +A 
Sbjct: 479 FPMTLVRTSSLNNYSL-RIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAW 537

Query: 541 RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQ 582
           +ELGCWTW V+C+GW   WL+VA+S L+T     D    K Q
Sbjct: 538 KELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKKFQ 579

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/581 (56%), Positives = 422/581 (72%), Gaps = 4/581 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M + E +QR++I  GL+PK ++ LP +S L            P +GQ+R TYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRE+EWNI+RGYR +I  L + S++ERNAIMS WL++FG KT +Y+N E GD+L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGVF+APRGDGTESMVLA+PW+NA+ EFNV+GAALGV+LAR+ SRWPVWSKNIIVVF+EN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P+ ALRSWVEAYHTSLDLTGGSIEAA+VLD+ G  D F+Y+E++Y+G NG LPNLD+VNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +  AEHEG+KVSLHG   D++     +SRLK++    KN AL+GV++ YGNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           Q++TL+ARG     DVT+FGRV EAMFRSINNLLEKFHQSFFFY +LAPR+FVSI SYLP
Sbjct: 301 QALTLKARGDTN-HDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           + V +SI FA+AS++S+ NN Y ++   S Y LLS +FW VS++V F + N F Y P P 
Sbjct: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419

Query: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLLS 480
           +LL  N++I   P     N  + + L+YRL++               VNFPLAFGMGL +
Sbjct: 420 LLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFA 479

Query: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSAS 540
           +PMT V    +D     R + +NS+LL +SNPFIA WLF  + +++  G++    LV A 
Sbjct: 480 YPMTLVMLNNTDN---LRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAW 536

Query: 541 RELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKK 581
            +LG WTW + C+GW+  W+LVAISAL   ++  +    K 
Sbjct: 537 NKLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKH 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/568 (54%), Positives = 418/568 (73%), Gaps = 7/568 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXX-XXXXXPFEGQYRNTYISENALM 59
           M L E++QR++I  GL+P+++  LP +S LC            P EGQYR+TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119
           PSQAYSYFRE+EWNI+RGYR+QI  L   S+ ERN +++ W Q+FG KT  Y++   G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179
           +YGV HAPRGDGTE+MVLA PW+N DGE+N+ GAAL  AL+R+FSRWPVWSKNII+VF++
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239
           +P+A+LRSWV AYHTSLDLTGGSIE+A+VLD+ G  D F Y+EIYY GLNGELPNLD+VN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299
           + V   EHEGMKVSL+G   +++++   FS++K +M  +K  ALSGV+  YGNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359
           IQ++ LRARG +GPFD+T+FGR+PEA FRS+NNLLEKFHQSFFFYL+LAPR+FVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419
           P+ VA S+ F +A+L+    +     P FS++ L +++ + V+L+++F +S +F +  + 
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLL 479
           ++L++ N +I + PAI  G   ++   SY+ +S               +NF LAFG+GLL
Sbjct: 421 SLLISCNAVIAVLPAIF-GRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539
           +FP+  VK      P  SR RVKN++LL++SNPFI+T LF    + + SGL +F RLV A
Sbjct: 480 AFPLILVK-----APMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQA 534

Query: 540 SRELGCWTWLVLCVGWWTPWLLVAISAL 567
            ++LGCWTW V+C+GW   WLLVA S +
Sbjct: 535 WQKLGCWTWSVVCIGWLPSWLLVACSGI 562

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/576 (54%), Positives = 412/576 (71%), Gaps = 5/576 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXX-XXXXXPFEGQYRNTYISENALM 59
           M L E++ R++I+ GLIPK IS L  +S LC            P +GQ+R TYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAV-ERNAIMSEWLQQFGTKTDIYQNHETGD 118
           PSQAYSYFRESEWNI+RGYR+Q+   +  S   + NA +S+WLQ+FG KT IY + + G+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFT 178
           TLYG+FHAPRGDGTE+MV+A PW+N + E+N  GAAL ++L R+FSRWPVWSKNII+V +
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMV 238
           E+PKA+LRSWV AYHTSLDLTGGSIE+AIVLD+ G  D FDYMEI+YDGLNGE PNLD+V
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGW 298
           N+ V  AEHEG+KVSLHG PF ++  +   SRLK ++  IK+S LSG+K  YGNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSY 358
           RIQS+TL+A+G +GP D+T+FGRVPEA+ RS+NNLLEKFHQSFFFYL+LAPR+F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 359 LPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPF 418
           L + VA+S+ F  A+LN   NN Y  LP  S+Y + SIL + +SLV  F  S +F+Y P 
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 419 PTILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGL 478
           P +LL ++ I  + P + +    +++  SYR ++               +NF LA  MGL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538
           L+FPMT+  TI        R  +KN VLL++SNPFIATW      +   SG  VF  L+ 
Sbjct: 481 LAFPMTRTTTIIESN---LRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIE 537

Query: 539 ASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSN 574
           AS++LGCWTW ++C+GW+  WLLV  +++D +++  
Sbjct: 538 ASQQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQT 573

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/585 (53%), Positives = 421/585 (71%), Gaps = 5/585 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L   + R+VI  GL+PK++  LPL+S              P +GQYR+TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWNI+RGYR++I    +  + +RN +M++WL++FGTKT +Y N E GDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YG+F+APRGDGTE++VLAIPW+NADGEFN  GAALG+AL+R+FSRWP+WSKNIIVVF+EN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P  ALRSWV+AYH SLDLTGGSIEAAIV+D+    D FDY+EIYY G+NGELPNLD++NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEGM+VSLHG P + + ++  FSRL+ L+   K++ LSG+K  +GNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTLRAR--GQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSY 358
           Q++TL+A+    N   D+TSFGR+ EA FRS+NNLLEKFHQSFFFYL+LAP++FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 359 LPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPF 418
           LPS V  S+ FA++SL+SY NN Y TLP FS Y LL+ L + +S+  +F V+ + +    
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 419 PTILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGL 478
           P +L+  ++ + + P +L     + + LSYRL+S               +NF LAFG+G+
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538
           L F MT VKTIT  +    R RV+N++ LL+SNPF +  LF+ + D +  G+ +F   + 
Sbjct: 481 LGFAMTAVKTITIHSSM--RVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIH 538

Query: 539 ASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ 583
           +   L CWTW ++CVGW  PW+LV+IS++ T  +   S D+ K+Q
Sbjct: 539 SWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVM-QSPDYGKKQ 582

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/583 (54%), Positives = 413/583 (70%), Gaps = 15/583 (2%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L E++QR+V+  GL+PK+I+LLPL+S +C           P EGQ+R TYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWNI+RGYRSQI      S  ERN  M+EWLQ+FG KT IY N E GD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YG+ HA RGDGTE+++LA+PW+NA+G+ NV GA+LG++L+R+FSRWPVWSKNII+VF+EN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAAIVLD+ G  D FDY EI Y GLNGELPNLD+VNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            V   EHEG+ VSLHG   + I +++ +SRLKIL+  I   A +G++   GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTLRARG-QNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359
           QSVT++A G + G  D+T+FGR+PEAMFRSINNLLEKFHQS+FFY+++APR+FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419
           P+TV ++ GFALASLNS   N Y  L F+S Y L ++LFW VS++V+F+ S +F+Y P  
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLL 479
            +L+A  +++ L P        + + LS+RL+                VNF LAF +G+L
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539
           +FPMT V T  S T        K   LL++SNP ++ ++             + ++L+SA
Sbjct: 481 AFPMTAVGTQRSLT-------FKKYALLIISNPLVSFFIVK-------PHPQLLQKLISA 526

Query: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQ 582
            ++LGCWTW VLC+GW   W L+A+SA  +  L   +   K+Q
Sbjct: 527 WQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/579 (51%), Positives = 412/579 (71%), Gaps = 5/579 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXX-XXXXXPFEGQYRNTYISENALM 59
           M + E++ R+++  GL+P++I+ LP IS  C            P EGQYR TYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119
           PSQAYSYFRESEWNI+RGYR ++  L++    ERN I++ W++++G KT I  N++ G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179
           LYG+ H  RGDGTE+MVLA PW   DG +N  GAAL ++LARYF+RWPVWSKNIIVV + 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239
           +P+A+LR+WV+AYHT LDLTGGSIE+A+VLD+ G  D F Y+EI Y+GLNG LPNLD++N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299
             V  +EHEGMKVSLHG PF ++ +DT   RLK L+S IK+  L+G+K T G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359
           IQSVTL+A GQ+GPFDVT+FGRVPEA+FRS+NNLLEKFHQSFFFYL+L+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419
           P+ +A+S  FA+AS +S  NN Y  LP  S+Y + ++  + V+L+++F+ +  F Y P P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLL 479
           ++LLA N+ +      +      K   SYR ++               VNF LA  +G+L
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKP-FSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539
           +FPM+  KT T+ T    + +++NS+LL+ SNPFIA+W+   L + + +G  +F  L+ A
Sbjct: 480 AFPMSLTKTTTNAT---MQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDA 536

Query: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSED 578
             +LGCWTW VLC+GW+  W+LVA S++D++ +   S+ 
Sbjct: 537 WTQLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/581 (55%), Positives = 418/581 (71%), Gaps = 9/581 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXX-XXXXXPFEGQYRNTYISENALM 59
           M L ER+QR+VI  GL+P+++  LP +S LC            P EGQYR+TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119
           PSQAYSYFRE+EWNI+RGYR+QI  L N S++ERN I+  WLQ+FG KT +Y++   G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179
           LYGV HAPRGDGTE+MVL+ PWFN DGEFN  G AL VALARYFSRWPVWSKNIIVVF++
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239
           +PKA+LRSWV+AYHTSLDLTGGSIE+A+VLD+ G  D F Y+EIYY GLNGELPNLD+VN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299
           + +   EHEGMKVSL+G P D+++    F+R+K ++  IK  ALSGV++ YGNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359
           IQ+V LRARG +GPFD+T+FGRVPEA+FRS+NNLLEKFHQSFFFYL+LAPR+FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419
           P+ VA S+ F +A+L++       T     L  + +++ + V+L+ +F VS  F     P
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLL 479
            IL++ +++  L P IL     ++   ++RL++               VNF LAFG+GLL
Sbjct: 421 VILISWSVMTALAP-ILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLL 479

Query: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539
           +FP+  VK   S TP   R   KNS+LLL+SNPFI+T LF+   +    GL + E+LV A
Sbjct: 480 AFPLILVK--NSTTP---RLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQA 534

Query: 540 SRELGCWTWLVLCVGWWTPWLLVAISAL--DTVKLSNDSED 578
             E GCWTW V+C+GW   WLL+A S++  D   L N +E 
Sbjct: 535 WNEFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEK 575

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/579 (53%), Positives = 417/579 (72%), Gaps = 5/579 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXX-XXXXXPFEGQYRNTYISENALM 59
           M + E++ R+V+  GL+PK+I  L  IS +             P EGQYR TYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119
           PSQAYSYFRESEWNI+RGYRS+I  +R  +A ERN I++ W++++G K  +Y +   G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179
           LY V HA RGDGTE+MVLA PW   +G++N  G AL VA+ RYFSRWPVWSKNII+V +E
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239
           +P A+LRSWV+AYHT LDLTGGSIEAAIVLD+ G  D F ++EI Y+GLNG +PNLD++N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299
           + V   EHEGMKV+LHGTP++++  DT FSR+++L+  IK+ ALSG+K+T GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359
           IQSVTL+ARG NG FD+T+FGRVPEAMFRS+NNLLEKFHQSFFFYL+LAPR+FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419
           P+ V +SI FA+ + +S  NN + +LP  S+Y + ++L + V+L+V+ I + +F Y P P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGLL 479
            +LLA N+++   P  L      K   S+R ++               +NF LAF +GLL
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKP-FSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539
           +FPMT V+T    +    R ++KNS+LLL+SNPFI+  +F  L + E +G  VF  L+ A
Sbjct: 480 AFPMTFVRTTVHAS---VRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDA 536

Query: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSED 578
             +LGCWTW VLC+GW+  W++VA S++D+V ++  ++ 
Sbjct: 537 WNDLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKK 575

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/550 (56%), Positives = 408/550 (74%), Gaps = 9/550 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           MGL ERV+RQV   GL+PK+   LPL S +            P +GQYRNTYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRE+EWNI+RGYR+Q+  + +    ERN IM  WL   G KTD + N     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNN----STI 116

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YG+FH+PRGDGTE++VLAIPW N++G+FN  GAALGV+LAR+F RWP+WSKNIIVVF+E+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
             A+LRSWVEAYHTSLDLTGGSIEAA++LD+A E D FDY+EI+YDGLNGELPNLD+VNI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            V   EHEGMKVSLHG P ++++E +L+SR K+L+ SIK+S+L+G+KK +GNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           Q++TL+A G+ G  D+T+FGR+PEAMFRSINNLLEKFHQSFF+YL+LAPR+FVSISSYLP
Sbjct: 297 QALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLP 355

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           + V +S+ FA +SL  + N+   ++PF S YTL +I+ WF+S+  +F  +  ++   FP 
Sbjct: 356 AAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPV 415

Query: 421 ILLAVNIIICLYPAILKG--NAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGL 478
           +L+ + I+    P I +G   A  K  +++R+++               +NFPLA  +G+
Sbjct: 416 MLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538
           L+FPMT VK I++  PT S+  +KNS+LLLVSNP+I+   FS + D+E +GL   +RL+ 
Sbjct: 476 LAFPMTLVK-ISNTLPTSSQA-LKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIP 533

Query: 539 ASRELGCWTW 548
           A  ++ CWTW
Sbjct: 534 AWNDMNCWTW 543

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/587 (54%), Positives = 429/587 (73%), Gaps = 7/587 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           MGLFE +QR+ +  GL+PK+++ LPL+S L            P  GQYRNTYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVEL--RNASAVERNAIMSEWLQQFGTKTDIYQNHETGD 118
           SQAYSYFRE+EWNI+RGYR++I  L  R  SA +R  I++ WL +FG KT +Y+N E GD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFT 178
           TLYGV HAPRGDGTE+MVL  PW N++GEFN+ G+AL +AL+RYFSRWPVWSKNIIVVF+
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMV 238
           +NP  ALRSWVEAYHTSLDLTGGSIEAA++LD+    D F+Y EI+++GLNGELPNLD+V
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NIGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGW 298
           N+ V   +HEGMKVSLHG P  +++++  +SRLK+L   +K+S L+G+KK +GNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSY 358
           RIQ+VTL+ARG+ G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFY +L+P +FVSISSY
Sbjct: 301 RIQAVTLKARGE-GQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSY 359

Query: 359 LPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPF 418
           LPS V +SI FA+A++++  NN Y +    + YTLL+ L   +SL+V+F+V++ F+YS  
Sbjct: 360 LPSAVLLSITFAIAAVDATVNNAYASALHIT-YTLLAALASVISLLVSFLVAHWFLYSTT 418

Query: 419 -PTILLAVNIIICLYPAIL-KGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGM 476
            P  L+  ++++ + P ++ + N  +++ + YR+R+               +NFPLAF +
Sbjct: 419 SPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSI 478

Query: 477 GLLSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDN-EFSGLDVFER 535
           GL  +PMT VK +   + +    +++NSVLL++SNPF+ATWL   + +N EF  LDVF  
Sbjct: 479 GLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAA 538

Query: 536 LVSASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQ 582
           L SA ++L CWTW VLC+GW   WLLV  S+  ++  +  + + K  
Sbjct: 539 LFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/573 (53%), Positives = 409/573 (71%), Gaps = 6/573 (1%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L ++V R++  RG I K++  LP +S L            P +GQYR TYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRE+EWNI+RGYRSQI  L ++S  +RN +++EWLQ+ G KT +Y++ + G TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV HA RGDGTE+MVLAIPW N D +FN+ GAALGV+L+++F RWPVWSKNIIVVF+E+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
             AALR+WV+AYHTSLDLT GSIEAA+VLD+  + D F+Y+EI YDGLNGELPNLD+VNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            V   EHEGMKVSLHG P +++     F+RLKI+   IKN ALSGVK+ +GNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           QSVTLRA G  G  D+T FGR+PEAMFRS+NNLLEKFHQS+FFYL+LAPR+FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S V IS+ FA+ SL+S  NN Y ++PF S+ TL+  +    S+ V+F++S + I  P   
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 421 ILLAVNIIICLYPAIL--KGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGL 478
            LL  ++ +   P ++  K    +   ++YRL+S               VNF L F +GL
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 479 LSFPMTQVKTITSDT--PTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSG--LDVFE 534
           L+FP+T++  I++ T      ++ +KN+ +L ++NPFI+ WLF+   D +F+G    ++ 
Sbjct: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540

Query: 535 RLVSASRELGCWTWLVLCVGWWTPWLLVAISAL 567
           R++++   LGCWTW ++C+GW   WL+  IS++
Sbjct: 541 RMITSWDTLGCWTWFIICLGWLPYWLISVISSI 573

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/583 (49%), Positives = 403/583 (69%), Gaps = 5/583 (0%)

Query: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCXXXXXXXXXXXPFEGQYRNTYISENALMP 60
           M L E + R+    GL+PKVI  L ++S +            P +GQYR TYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120
           SQAYSYFRESEWNI+RGYR+ I  L +  A  RN ++S WL  FG K  +Y N   GDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180
           YGV+++ RGDGTE++VLA+PW+N D E N+ GAALG++L+RYFSRWP+WSKNII+V +EN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240
           P  A++SWV+AYH SLDLTGGS+EAAIVLDF  + + F+++E+Y++G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300
            +   EHEG+KVSL G    ++   + F+RLK L+  +KNSALSG +K YGNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360
           Q++TL+A G  G  D+T+FGR+PEA+FRS+NNLLEKFHQSFFFY ++APRHFVSI SYLP
Sbjct: 301 QALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359

Query: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420
           S V +SI F +++ +SY NN Y T+P     ++L+++ +F S+ ++FI   I      P 
Sbjct: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPH 419

Query: 421 ILLAVNIIICLYPA--ILKGNAFMKDLLSYRLRSXXXXXXXXXXXXXXXVNFPLAFGMGL 478
           +++   ++I   P   I +    ++  LSYRL+S               +NF LAFGMGL
Sbjct: 420 LMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGL 479

Query: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538
           L+FP+T  K+  S+  T  +++V N   L +SNPFIA ++F  + +++ +  +VF  L+S
Sbjct: 480 LAFPLTFTKS-CSEMITF-KSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLIS 537

Query: 539 ASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKK 581
           + + +G WTW + C+GW+T W +V I+ LDT + + D +  K 
Sbjct: 538 SFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580

>SAKL0G07018g Chr7 complement(575361..577139) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q03370 Saccharomyces cerevisiae
           YDR479C PEX29 Peroxisomal integral membrane protein
           involved in regulation of peroxisome size and number
           genetic interactions suggest that Pex28p and Pex29p act
           at steps upstream of those mediated by Pex30p Pex31p and
           Pex32p
          Length = 592

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 17/99 (17%)

Query: 350 RHFVSISSYLPSTVAISIGFALAS-LNSYFN--NPYYTLPFFSLYT--LLSILFWFVSLV 404
           R+FV ++S L      SI F L   L   FN  NP YTL   SLYT  +L  +  F+++ 
Sbjct: 110 RNFVQMNSRL------SIPFMLVDELIKVFNWQNPSYTLSIMSLYTYMVLKPVPTFMAVP 163

Query: 405 VTFIVSNIF------IYSPFPTILLAVNIIICLYPAILK 437
           + +++  I       I+ P P   L VN +    P ++K
Sbjct: 164 IFYLLFGIMVPNYLKIHKPEPVSTLEVNPVPAQGPPLVK 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,455,945
Number of extensions: 2364160
Number of successful extensions: 8747
Number of sequences better than 10.0: 31
Number of HSP's gapped: 8936
Number of HSP's successfully gapped: 31
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 69 (31.2 bits)