Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038508.262ON58858828490.0
NDAI0J013808.262ON62440711271e-146
KAFR0B055408.262ON5194079571e-122
TDEL0F038908.262ON4763668501e-107
Smik_4.3568.262ON5763677811e-95
Skud_4.3718.262ON5803737698e-94
Suva_2.2708.262ON6323737693e-93
YDR110W (FOB1)8.262ON5663677627e-93
ZYRO0C01650g8.262ON5864137402e-89
SAKL0H17028g8.262ON5503697144e-86
KLTH0G13684g8.262ON5083936765e-81
Kwal_56.237998.262ON4883936652e-79
Kpol_543.388.262ON4423636499e-78
Ecym_43088.262ON5293776569e-78
KNAG0H032408.262ON5194646365e-75
AGR086C8.262ON5344476332e-74
KLLA0F19140g8.262ON5273656001e-69
Kpol_392.68.262ON4573835696e-66
CAGL0B01771g8.262ON5363885371e-60
TPHA0A018108.262ON4574045015e-56
TBLA0E044308.262ON4813844613e-50
TBLA0F030708.262ON4453783962e-41
TPHA0J007408.262ON4083783633e-37
NDAI0D03010na 1ON778169890.043
NDAI0B06160singletonON140389810.33
NCAS0A06040na 1ON588224780.77
NDAI0G00550singletonON41289751.7
NDAI0D03060singletonON130394751.9
NDAI0D00680singletonON23463713.4
CAGL0J00429g5.280ON15299684.9
NCAS0A153007.546ON139843715.1
NDAI0G00600singletonON48886715.2
Ecym_73675.280ON153102668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03850
         (588 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...  1102   0.0  
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   438   e-146
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   373   e-122
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   332   e-107
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   305   1e-95
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   300   8e-94
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   300   3e-93
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   298   7e-93
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   289   2e-89
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   279   4e-86
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   265   5e-81
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   260   2e-79
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   254   9e-78
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   257   9e-78
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   249   5e-75
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   248   2e-74
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   235   1e-69
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   223   6e-66
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   211   1e-60
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   197   5e-56
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   182   3e-50
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   157   2e-41
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   144   3e-37
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    39   0.043
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            36   0.33 
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    35   0.77 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    33   1.7  
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}              33   1.9  
NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON}                32   3.4  
CAGL0J00429g Chr10 (34645..35103) [459 bp, 152 aa] {ON} highly s...    31   4.9  
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            32   5.1  
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    32   5.2  
Ecym_7367 Chr7 complement(765199..765660) [462 bp, 153 aa] {ON} ...    30   8.4  

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score = 1102 bits (2849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/588 (91%), Positives = 537/588 (91%)

Query: 1   MEPSEHESSALRGRANLFFNDDESHEYTKENHEKLKXXXXXXXXSAADNQHIHKEVEEED 60
           MEPSEHESSALRGRANLFFNDDESHEYTKENHEKLK        SAADNQHIHKEVEEED
Sbjct: 1   MEPSEHESSALRGRANLFFNDDESHEYTKENHEKLKDDGEEGDESAADNQHIHKEVEEED 60

Query: 61  GLYDYDYSKRDKPIKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTING 120
           GLYDYDYSKRDKPIKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTING
Sbjct: 61  GLYDYDYSKRDKPIKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTING 120

Query: 121 QLNESTYELIKTNSLTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRM 180
           QLNESTYELIKTNSLTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRM
Sbjct: 121 QLNESTYELIKTNSLTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRM 180

Query: 181 VCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIP 240
           VCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIP
Sbjct: 181 VCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIP 240

Query: 241 FKKYKHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKF 300
           FKKYKHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKF
Sbjct: 241 FKKYKHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKF 300

Query: 301 GHLVDLISKMIFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXX 360
           GHLVDLISKMIFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINI              
Sbjct: 301 GHLVDLISKMIFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNG 360

Query: 361 XPQIRKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDK 420
            PQIRKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDK
Sbjct: 361 LPQIRKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDK 420

Query: 421 IEQILQDLPTENIVKIGRGCIYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQEDEEDIG 480
           IEQILQDLPTENIVKIGRGCIYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQEDEEDIG
Sbjct: 421 IEQILQDLPTENIVKIGRGCIYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQEDEEDIG 480

Query: 481 AMMSPMIDNTRTEDELENGEKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLNNKNVTNX 540
           AMMSPMIDNTRTEDELENGEKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLNNKNVTN 
Sbjct: 481 AMMSPMIDNTRTEDELENGEKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLNNKNVTNT 540

Query: 541 XXXXXXXXXXXXXXXXXXXXXXXXXXXMKHDDSGDDVEWNKLGYSREI 588
                                      MKHDDSGDDVEWNKLGYSREI
Sbjct: 541 QETESPEITEPSTSYYQTYQETTSQPTMKHDDSGDDVEWNKLGYSREI 588

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  438 bits (1127), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/407 (50%), Positives = 284/407 (69%), Gaps = 5/407 (1%)

Query: 75  KRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNS 134
           KR     YLIPN+GE Y DYVD ++D+  ++RGE  F  FQ++I+GQL+E  YELI+T S
Sbjct: 84  KRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKS 143

Query: 135 LTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTW 194
           LT+ETL+A       F A +R     RRY  D +G VRD+LR NR+VC+PV +Y+M+MT 
Sbjct: 144 LTEETLAAN---FPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTC 200

Query: 195 HLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLL 254
           HL+NDH + R+CH  L  +Y+NITR F+ +  QFCSVCNPSK   P  K+KH+N++KG+L
Sbjct: 201 HLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGML 260

Query: 255 PLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSM 314
           PLERV +E+FEPF G+K+ GKY  ++Y RDYRSR+I + PL+N+KF +LV  I+K++F++
Sbjct: 261 PLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNL 320

Query: 315 IRIPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEE 374
            RIPIF ET ++  QD FDIFE IVEKYQIN+                Q++ LL  H++E
Sbjct: 321 PRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKE 380

Query: 375 CLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIV 434
           CL DW MCLKYGPH +N K NDRACGVP DLLT ++ D+  KS +K EQI++ LP +NIV
Sbjct: 381 CLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIV 440

Query: 435 KIGRGCIYLEDRNPEDPEAE-YEANTDDESDTEDNVEHRQEDEEDIG 480
           +IG G IYLE++  +DP  + Y+A   +E D+E    + +  ++D+ 
Sbjct: 441 QIGNGSIYLEEK-VKDPNIDNYDAMLGEEYDSEQEDNNNKNTDQDLA 486

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  373 bits (957), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 187/407 (45%), Positives = 257/407 (63%), Gaps = 8/407 (1%)

Query: 80  KGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQET 139
           + Y++P +GE Y  Y D  M+L  ++RGERE F+FQ++ING L E TY+LI+T+SLT ET
Sbjct: 45  ESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPET 104

Query: 140 LSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLIND 199
           L++T  K  K  A  R +FL RRY  D  G + D LR++++VCEPV+++DMIM  HL+N+
Sbjct: 105 LASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNN 164

Query: 200 HGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERV 259
           HG  +K H  L   YSNITR    +  +FCSVCNP ++    +K+KH N +  L+PLERV
Sbjct: 165 HGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERV 224

Query: 260 QVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPI 319
            +E+FEPFP EK+  KY  ILY RDY SR+IWM+PL+N+KF HLV  ++ +  S IR PI
Sbjct: 225 HIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPI 284

Query: 320 FFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADW 379
           F ET +++ QD FDI EKI  +Y + I                Q++  L  H+EECL  W
Sbjct: 285 FIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSW 344

Query: 380 IMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRG 439
            +CLKYG +  N + NDRA GVPGDLL+  I +   K  +KI QIL++  +E+++++  G
Sbjct: 345 NLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNG 404

Query: 440 CIYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQE-DEEDIGAMMSP 485
            I+LE   P D          DE   E   E  Q  DEED+GA+M P
Sbjct: 405 LIFLEVDEPHD-------EPHDEPYDEFQFEGDQSIDEEDMGAVMPP 444

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 156/366 (42%), Positives = 233/366 (63%), Gaps = 1/366 (0%)

Query: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141
           +L P++GE YK+Y +  M++  ++RGE++  ++Q++INGQ+    YELI+TNSLT ETL+
Sbjct: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98

Query: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201
           + + K DK  A S+ +FL RRY   E G VRD+ + +++VCEP+ I+D+IM  HL+NDH 
Sbjct: 99  SNSDKWDKDSAESKYMFLMRRY-YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261
             R  +  L  +YSNITR FV+   ++CS CNP     P +KY+H N FKGLLPLERV +
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217

Query: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321
           E+FE F  E +  K+  +LY RDY +RF+W+ PL+N+KF HLV  +  ++  M  +PIF 
Sbjct: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277

Query: 322 ETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIM 381
           E++T++ QD FDI E++  KY + +                +++KLL   K +C++DW M
Sbjct: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337

Query: 382 CLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGCI 441
           CL+YGP+  N + N  A G+P DLL             K E I+ +LP +N+V + +G +
Sbjct: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLL 397

Query: 442 YLEDRN 447
           YLED N
Sbjct: 398 YLEDEN 403

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  305 bits (781), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 151/367 (41%), Positives = 224/367 (61%), Gaps = 2/367 (0%)

Query: 83  LIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSA 142
           ++P++GE Y +YVD  ++L  ++RGERE   F +++  QL +  YELIKT SLT +TL  
Sbjct: 49  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108

Query: 143 TALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGR 202
            + K D   A ++L+FL R+Y +D++GNVRD    +++ CEP  IYDM+M  HLIN H R
Sbjct: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 203 PRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVE 262
            +  H  L   ++NI+   ++ + QFCS CN   +  P K+YK  + +  LLP+ER+ +E
Sbjct: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228

Query: 263 VFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFE 322
           VFEPF GE + GKY  +L  RDYRS F+W++PL+++KF HL+ +IS +  S  R+PIF  
Sbjct: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288

Query: 323 TTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMC 382
           ++T++  D +DI E+I  KY + I                 I   L  +KEECLADW  C
Sbjct: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348

Query: 383 LKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGC 440
           L+YGP+ FN + N R    P  +L  +IP    K   K E+++++  + N+ K   G+G 
Sbjct: 349 LRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGL 408

Query: 441 IYLEDRN 447
           IYLED N
Sbjct: 409 IYLEDVN 415

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  300 bits (769), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 150/373 (40%), Positives = 226/373 (60%), Gaps = 2/373 (0%)

Query: 77  LKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLT 136
           LK +  ++P++GE Y  YVD  ++L  ++RGERE   F +++  QL +  YELIKT SLT
Sbjct: 44  LKDRLLILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLT 103

Query: 137 QETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHL 196
            +TL   + K D   A ++L+FL R+Y +D +GNVRD    +++ CEP  IYDM+M  HL
Sbjct: 104 ADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHL 163

Query: 197 INDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPL 256
           +N H R +  H  L   ++N +   ++ + QFCS CN   +  P K+YK  + +  LLP+
Sbjct: 164 MNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPM 223

Query: 257 ERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIR 316
           ER+ +EVFEPF G  + GKYP +L  RDYRS F+W++PL+++KF HL+ +IS +  S  R
Sbjct: 224 ERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283

Query: 317 IPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECL 376
           +PIF  ++T++  D +DI E+I  KY + I                 I+  L  +KEECL
Sbjct: 284 VPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECL 343

Query: 377 ADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI 436
           ADW  CL+YGP+ FN + N R    P  +L  ++P    K   K E+++++  + N+ K+
Sbjct: 344 ADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKM 403

Query: 437 --GRGCIYLEDRN 447
             G+G IYLED N
Sbjct: 404 AGGKGLIYLEDVN 416

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  300 bits (769), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 149/373 (39%), Positives = 226/373 (60%), Gaps = 2/373 (0%)

Query: 77  LKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLT 136
           LK +  ++P +GE Y +YVD  ++L  ++RGERE   F +++  QL +  YELIKT SLT
Sbjct: 94  LKDRLLILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLT 153

Query: 137 QETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHL 196
            ETL   + K D   A ++L+FL R+Y +D +GNVRD+   +++ CEP  IYDM+M  HL
Sbjct: 154 AETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHL 213

Query: 197 INDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPL 256
           +N H R +  H  L   ++N +   ++ + QFCS CN   +  P K+YK  + +  LLP+
Sbjct: 214 MNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPM 273

Query: 257 ERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIR 316
           ER+ +EVFEP+ G+ + GKYP +L  RDYRS F+W++PL+++KF HL+ ++S +  S  R
Sbjct: 274 ERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFAR 333

Query: 317 IPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECL 376
           IPIF  ++T++  D +DI E+I  KY + I                 I+  L  +KEECL
Sbjct: 334 IPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECL 393

Query: 377 ADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI 436
           ADW  CL+YGP+ FN + N R    P  +L  ++P    K   K E+++++    N+  +
Sbjct: 394 ADWGKCLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTM 453

Query: 437 --GRGCIYLEDRN 447
             G+G IYLED N
Sbjct: 454 AGGKGLIYLEDVN 466

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  298 bits (762), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 226/367 (61%), Gaps = 2/367 (0%)

Query: 83  LIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSA 142
           ++P++GE Y +YVD  ++L  ++RGERE   F +++  QL +  YELIKT SLT +TL  
Sbjct: 47  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106

Query: 143 TALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGR 202
            + K D   A ++L+FL R+Y +D++GNVRD    +++ CEP  +YDM+M  HL+N H R
Sbjct: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166

Query: 203 PRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVE 262
            +  H  L   ++NI+   ++ + QFCS CN   +  P K+YK  + +  LLP+ER+ +E
Sbjct: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226

Query: 263 VFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFE 322
           VFEPF GE + GKY  +L  RDYRS F+W++PL+++KF HL+ ++S +  +  R+PIF  
Sbjct: 227 VFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286

Query: 323 TTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMC 382
           ++T++  D +DI E+I  KY + I                 I+  L  +K+ECLADW  C
Sbjct: 287 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKC 346

Query: 383 LKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGC 440
           L+YGP+ FN + N R    P  +L  ++P    K   K E+++++  + N+ K+  G+G 
Sbjct: 347 LRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 406

Query: 441 IYLEDRN 447
           IYLED N
Sbjct: 407 IYLEDVN 413

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  289 bits (740), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 148/413 (35%), Positives = 234/413 (56%), Gaps = 17/413 (4%)

Query: 69  KRDKPIKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYE 128
           KR K  K+ +   +++P + +K+   +   M+L  +++G  E  +FQ T+ GQL +  YE
Sbjct: 25  KRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYE 84

Query: 129 LIKTNSLTQETLSATALKMDKFRAASRLV---FLNRRYGLDEQ-GNVRDKLRQNRMVCEP 184
           LI++++L+   L     +  K++  S  +   +L  RY + E+ G V D+ R +R+VCEP
Sbjct: 85  LIRSDTLSIANLE----RCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEP 140

Query: 185 VFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKY 244
             ++ ++M  HL N+H      H+ L   Y+NITR ++     +CS CNP  +  PF+K 
Sbjct: 141 ASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKK 200

Query: 245 KHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLV 304
           +H N +  LLPLERV +EVFEPF GEK+ G++  +LYFRDY SR++W++PL+N K  H++
Sbjct: 201 RHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMI 260

Query: 305 DLISKMIFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQI 364
             +S  +  + RIPIF E+TTI+ +  FD+  +I E Y + +                 +
Sbjct: 261 RAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDM 320

Query: 365 RKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQI 424
           ++LLG HKEECL DW +CLKYGP   N  +N  + G PGDLL   +PD   K   K   +
Sbjct: 321 KELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDV 380

Query: 425 LQDLPTENIVKIGRGCIYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQEDEE 477
           + D P++ +V +G G ++LE+   E    E           ++N+ H   DEE
Sbjct: 381 ILDTPSQQVVHLGEGVLFLENNKEEHKTVEA---------VKENITHSDPDEE 424

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  279 bits (714), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 222/369 (60%), Gaps = 4/369 (1%)

Query: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141
           Y+ P +GE    Y   D+++  ++RG R+F ++ +++ GQL ++ YELIKT++LT ETL 
Sbjct: 26  YVTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84

Query: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201
           A    +    A ++ +FL RRY +D    VRD  R + +VCEP  +Y++I++ HL+N+H 
Sbjct: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144

Query: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261
             RK H+ L   YSNITR FV+   ++CS CNP +E  PF K+KH N ++GLLPLER+ V
Sbjct: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204

Query: 262 EVFEPFPGEKL-GGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIF 320
           E+F+PF  ++L   KY  +LY RDY SRF+W+ PL    F  LV  +++ + S+ R+PIF
Sbjct: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264

Query: 321 FETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWI 380
            ETTT++ QD FD+ E I  KYQ+ I                +++ LL  +K++C  DW 
Sbjct: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324

Query: 381 MCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GR 438
           MCLKYG +  N   N R  G   DLL  ++     K   K E+I+ +L   N+V +    
Sbjct: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384

Query: 439 GCIYLEDRN 447
           G +Y+E+ N
Sbjct: 385 GMVYVENEN 393

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  265 bits (676), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 223/393 (56%), Gaps = 12/393 (3%)

Query: 84  IPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSAT 143
           +P +GE  + Y    ++L  ++RG  +F ++Q+++ GQL +  ++L+++ SLT++ L  T
Sbjct: 21  MPAVGEPIEKY-HNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTT 79

Query: 144 ALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRP 203
           + K+      ++ + L RRY +D  G VRD    + +VCEP  ++D+IM  HL N H   
Sbjct: 80  SDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHW 139

Query: 204 RKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEV 263
           R+ H  L   Y+N TR F +   ++CS CNP +E  P+KK++H N + GLLPLERV VE+
Sbjct: 140 RRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEI 199

Query: 264 FEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFET 323
             PF  E + G Y  +L+FRDY SRF+WM PL+      +   +   +  + RIPIF ET
Sbjct: 200 ISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPIFIET 258

Query: 324 TTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMCL 383
           +TI+ QD F+  E +  +Y + I                ++R LL  ++E+CL  W MCL
Sbjct: 259 STIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCL 318

Query: 384 KYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYD-KIEQILQDLPTENIVKIG----- 437
           KYG    N   N R  GVPG+LL   + D Y + ++ K E +++ L   N+V+I      
Sbjct: 319 KYGATNHNLNYNARILGVPGNLLHSTVCD-YGRQFELKREDLIEKLFARNVVEIKVSGRR 377

Query: 438 RGCIYLEDRNP--EDPEAEYEANTDDESDTEDN 468
           RG IYLED     + P+ EY  + ++E+D  D+
Sbjct: 378 RGIIYLEDETSAFKMPDEEY-ISAENETDMNDD 409

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  260 bits (665), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 135/393 (34%), Positives = 225/393 (57%), Gaps = 12/393 (3%)

Query: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141
           + +P +GE  + Y    ++   + RG  +F ++Q+++ GQL +  ++L+++++LT E L 
Sbjct: 19  FRMPKVGETLEKY-GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77

Query: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201
           +T+ K+      ++ + L RR+ +D  G VRD    + +VCEP  ++D+IM  HL N H 
Sbjct: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137

Query: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261
             R+ H  L   Y+N TR F +   ++CS CNP +   P++K++H N + GLLPLERV V
Sbjct: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197

Query: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321
           E+  PFP + + G Y  +LY RDY SRF+WM PL + +   +       + S+ R+PIF 
Sbjct: 198 EIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFV 256

Query: 322 ETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIM 381
           ET+T++ QD F++ E I  +Y ++I                ++R LL  ++E CL  W M
Sbjct: 257 ETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHM 316

Query: 382 CLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYD-KIEQILQDLPTENIVKI---- 436
           CLK+G    N   N R  G+PG+LL   + D Y + ++ K E++++ L   N+V++    
Sbjct: 317 CLKFGVTNHNMTYNARVLGLPGNLLHSTVSD-YGRQFELKREELIEKLFASNVVELRNEG 375

Query: 437 -GRGCIYLEDRNP--EDPEAEYEANTDDESDTE 466
             RG IYLED +   + P+ EY  + ++E++ E
Sbjct: 376 RRRGMIYLEDESSAFKMPDEEY-ISAENETENE 407

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  254 bits (649), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 130/363 (35%), Positives = 210/363 (57%), Gaps = 3/363 (0%)

Query: 85  PNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATA 144
           P +G    +Y+D    + F++ G     E+  +I G L+++ YELI+ + L  +TLS   
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105

Query: 145 LKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPR 204
            +  +  A ++ ++L RRY L ++G V D  R+N++V EP   YD I++ H++N H   +
Sbjct: 106 -RWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 205 KCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVF 264
             H+ L  +YSN++R +++ +  FCS CNP K     +K  H+N ++  LPLERVQ+++F
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224

Query: 265 EPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETT 324
           EPF  EK+  +Y  I+Y RDYRSRF+W+ PL+N+KF  L   I  ++  + RIPI+ +TT
Sbjct: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284

Query: 325 TIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMCLK 384
           TIE +D   I ++I EKY+I++                +++ LL  +K++CL DW MCLK
Sbjct: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344

Query: 385 YGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIG--RGCIY 442
            G + +N K    A GVP +L   ++    T    K  +I+  LP +N  K    +G +Y
Sbjct: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404

Query: 443 LED 445
            +D
Sbjct: 405 AQD 407

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  257 bits (656), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 206/377 (54%), Gaps = 11/377 (2%)

Query: 98  DMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAASRLV 157
           ++D  ++  G  E  +   T+ GQL +  YELI +N+L+ +TL     K+      ++ V
Sbjct: 50  ELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFV 109

Query: 158 FLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNI 217
            L RRY +  QGNV D  R++  V EP  ++D+IM  HLIN H   RK HQ L  +Y+N+
Sbjct: 110 LLKRRYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANV 168

Query: 218 TRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPF---PGEKLGG 274
           TR F   +  +CS CN  +    F +YKH N +  ++PLER  VE+F PF     EK+  
Sbjct: 169 TRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIED 228

Query: 275 KYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETTTIENQDFFDI 334
           KY  +LY RDY SRF+WM+PL    F  LV  +++++ SMIR+PIF ET T++ QD FD+
Sbjct: 229 KYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDV 288

Query: 335 FEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMCLKYGPHTFNNKM 394
            E I  KY++ I                +I+ L   HKE+C+ +W MCL+      N   
Sbjct: 289 CEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNY 348

Query: 395 NDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGCIYLEDRNPEDPE 452
           +DR  G+P DLL  +I ++  K   K  +I+ +L   ++V+     G IYLED N     
Sbjct: 349 SDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDN----- 403

Query: 453 AEYEANTDDESDTEDNV 469
           + +  + D+     DNV
Sbjct: 404 SAFVVDEDEHGPENDNV 420

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  249 bits (636), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 155/464 (33%), Positives = 242/464 (52%), Gaps = 44/464 (9%)

Query: 83  LIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSA 142
           L+P IG+K+ +Y DE +D+ F +RGER+   +  T  G++++  Y L K + +T+E + A
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENI-A 93

Query: 143 TALKMDKFRAASR-LVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201
                D+    SR ++++ RRY  D  G +RD    NR+V +P+  +D+IM+ HL+N H 
Sbjct: 94  RLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHL 153

Query: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261
              + ++ L   Y+N     ++R  ++CSVCNPS +  P  + K    F+  LPLER+ +
Sbjct: 154 GSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY-LFEKALPLERITI 212

Query: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321
           E+ EPFP EK+ GKY  ++  +D+  RF W+ PL+N+KF ++V +++KMI S  R+PI+ 
Sbjct: 213 EIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWV 272

Query: 322 ETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIM 381
           E+ T++  D FDIFE IV KY I I                +I + L  H +ECL D+  
Sbjct: 273 ESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATA-RINRDLNDHHDECLFDFNN 331

Query: 382 CLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGCI 441
           CLKYGP  +N          P D+++     L  K   K   IL+  P+  ++  G G +
Sbjct: 332 CLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTL 391

Query: 442 YLEDRN----------------PEDPEAEYEANTD-------DESDTEDNVEH-RQEDEE 477
           YLE  N                 +D E E   N+        +ESDTE  V+H R+  ++
Sbjct: 392 YLESPNGIQEDAAASSADELSSAKDAEDEERDNSTREGSGNGEESDTEPAVDHSRRSKKK 451

Query: 478 DIGAM-------MSPMIDNTRTEDELENGEKSHEDDNHSNDNEE 514
            I  +        SPM D+ RT           E+D+  ND+ E
Sbjct: 452 KIAGVKEEPQRSFSPMKDSQRT---------LFEEDSEQNDSME 486

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  248 bits (633), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 236/447 (52%), Gaps = 18/447 (4%)

Query: 95  VDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAAS 154
           +D  ++  ++ RG  E  +  KT+ GQL +  Y+LI +++L+ + L     K+      +
Sbjct: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100

Query: 155 RLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMY 214
           + V L RRY + + G V D+ R++  V EP  ++DMIM+ HLINDH   RK +Q +  +Y
Sbjct: 101 KYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159

Query: 215 SNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPFPG---EK 271
           +N+TR     +  +CS CN  +    F +YKH N  + L+PLER  VEVF PF     EK
Sbjct: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219

Query: 272 LGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETTTIENQDF 331
           + GKY   LY RDY SRFIW++PL    F +L+  +++++ +MIR+PIF ET T++ QD 
Sbjct: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279

Query: 332 FDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMCLKYGPHTFN 391
           FDI E I  +Y+  I                ++++LL  +KEEC  DW MCL+      N
Sbjct: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339

Query: 392 NKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIV--KIGRGCIYLEDRNP- 448
               DR  G+P DLL  +IP++  K   K ++I+  L   ++V  K   G IYLED    
Sbjct: 340 QTYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDEESA 399

Query: 449 ---EDPEAEYEANTDDESDTEDNVEHRQEDEEDIGAMMSPMIDNTRTEDELENGEKSHED 505
              +DP+ +     ++     D++++          +++P+     TE+E+   +    +
Sbjct: 400 FVMDDPDDDCTPVPEEPPVASDSIQNS-------ATILTPITSTQITENEVARQDPDQLE 452

Query: 506 DNHSNDNEEGVT-KVEGSVPTTPKRRK 531
               + N E ++ +V    P   K RK
Sbjct: 453 IRPPSQNNESLSDRVSSEEPPVSKERK 479

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  235 bits (600), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 197/365 (53%), Gaps = 17/365 (4%)

Query: 95  VDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAAS 154
           +D+DM +    + E+E      T+ GQL +  Y+L+ +++LT+E L   + K+      +
Sbjct: 73  LDQDMLIEGRLQLEKEI----NTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVEN 128

Query: 155 RLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMY 214
           + V L RRY + E   + D  R++ +V EP  ++D+IM+ H++N H   +  +  L   Y
Sbjct: 129 KFVLLKRRYYVQENL-LHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFY 187

Query: 215 SNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPFPGE---- 270
           +N+T+ F + +  FCS CN S   I +KK+KH N    L+PL R  VE+F PF       
Sbjct: 188 ANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGN 247

Query: 271 ------KLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETT 324
                 K+ GKYP +LY RDY SR++W+ PL++     L+ +++K++FSMIR+PIF +T 
Sbjct: 248 DNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTC 307

Query: 325 TIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIMCLK 384
           T++ QD FD+ E I   Y+I I                +++ L   HKEECL DW MCLK
Sbjct: 308 TLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLK 367

Query: 385 YGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGCIY 442
                 N   +DR  GVP DLL     DL+ K       ++  L   ++V+     G IY
Sbjct: 368 LVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIY 427

Query: 443 LEDRN 447
           LED N
Sbjct: 428 LEDEN 432

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  223 bits (569), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 125/383 (32%), Positives = 203/383 (53%), Gaps = 6/383 (1%)

Query: 74  IKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTN 133
           + R  LK  ++P I    +   +  ++     RG ++  +FQ TING L++  Y+LI T+
Sbjct: 52  LPRSHLKELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTD 111

Query: 134 SLTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGN-VRDKLRQNRMVCEPVFIYDMIM 192
            LT + +S   +K    ++  +  FL  RY + ++G  VRD+   ++++C P  + ++++
Sbjct: 112 KLTPKKVSREKVKWAN-KSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVL 170

Query: 193 TWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKG 252
             HLIN+H   +  H+ L   Y+NI+R        +CS CNPS+   P KK K    ++G
Sbjct: 171 CTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEG 230

Query: 253 LLPLERVQVEVFEPFPGEKL-GGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMI 311
           LLP ER+ +E+F+PF  EKL  G Y  ILY RDY SR++W+ PL+ + F  L   +    
Sbjct: 231 LLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYF 290

Query: 312 FSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPH 371
           F++ + PI+ E++TI   D   + +KI  KY + I                 +++LL  H
Sbjct: 291 FTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLH 350

Query: 372 KEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGD-IPDLYTKSYDKIEQILQDLPT 430
           ++ECL DW MCLKYG +  NN  N +  G+P +LL    I +   K   K   ++ +   
Sbjct: 351 EDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFP 410

Query: 431 ENIVKI--GRGCIYLEDRNPEDP 451
            N++ +  G+  IYLED     P
Sbjct: 411 HNMIVLDNGKSEIYLEDNLTSTP 433

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  211 bits (537), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 127/388 (32%), Positives = 205/388 (52%), Gaps = 30/388 (7%)

Query: 82  YLIPNIGEKYKDYV---DEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQE 138
           +++P + E Y+DY+   D  +D+ F++RGE++   F + + G+L + TY L+  N+LT E
Sbjct: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119

Query: 139 TLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLIN 198
           T+           A ++   L +R+  D++GN+RD    N +V EP  ++++I+T HL N
Sbjct: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179

Query: 199 DHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLER 258
            H +     Q L  +Y+N TR FV+    +C+ CNP +   P +K +H N  + LLPLER
Sbjct: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239

Query: 259 VQVEVFEPF--------------PGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLV 304
           V +EVF PF              P  K+ GKY  + Y RD+R+R++W  PL+N KF  LV
Sbjct: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299

Query: 305 DLISKMIFSMIR-IPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQ 363
           D I+    +++   PIF E++TI+  D  +IFE +  KY + +                +
Sbjct: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359

Query: 364 IRKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDI-----PDLYTKSY 418
            +  L   K EC  DW+MCLK G ++  N++ +R  G   ++L  ++      D+  K  
Sbjct: 360 FKTHLHRAKSECADDWLMCLKQGTYS-ANRVIERQLGKASNILFTELMGQFERDMRKKKL 418

Query: 419 DKIEQILQDLPTENIVKIGR--GCIYLE 444
             IEQ      +ENI    +  GCI++E
Sbjct: 419 KYIEQSF----SENIKTYPKSGGCIFIE 442

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  197 bits (501), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 208/404 (51%), Gaps = 16/404 (3%)

Query: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141
           Y+IP IG+KY   +   +D   +Q+GE        +    L++  Y+L+K + LT++ + 
Sbjct: 31  YIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNV- 86

Query: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201
           A AL +D+  A +RL+ L  RY  D +  V D+ +QN++V +P   + M+MT HL+NDH 
Sbjct: 87  AVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHL 146

Query: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261
                ++ L   ++N++  F++   ++CS+CN +K+ I  KK   ++    +L  ER+ +
Sbjct: 147 TRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLIL 206

Query: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321
           +V  PF  +K+  +Y  IL   D+ ++F+W  PL+N K   ++  +++ I ++   P+F 
Sbjct: 207 DVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFI 266

Query: 322 ETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGPHKEECLADWIM 381
            + T+   D F++   +  +Y I+I               P + ++L  HK ECL  W M
Sbjct: 267 SSFTLSLNDIFELCCYLAREYNISI-GLGTRNMQKAYSKNPYVTRILNSHKTECLKSWFM 325

Query: 382 CLKY-GPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGC 440
           CLK+      N+K + R       L +G + D   K  ++ + I+  LP+EN + I  G 
Sbjct: 326 CLKWLADRQSNSKFDIRPPNKNYGLFSG-MTDFLKKYEERSKMIIGRLPSENFINIDEGS 384

Query: 441 --IYLEDR-------NPEDPEAEYEANTDDESDTEDNVEHRQED 475
             IY ED          E P+   E+  +   D++DN E  QED
Sbjct: 385 HFIYSEDEFSFDNLVEKETPKKLSESVVNSSEDSDDNYEDNQED 428

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  182 bits (461), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/384 (28%), Positives = 201/384 (52%), Gaps = 19/384 (4%)

Query: 79  LKGYLIPNIGEKYKDYVDE---DMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSL 135
           LK Y   ++G  Y DY+DE   ++++  +++G ++   +       L +   +++ T +L
Sbjct: 27  LKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTL 86

Query: 136 TQETLSATALKM-DKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTW 194
           + E +     K+ +  +A  +  F +RRY L+E  N+ DK +  R++CEP ++YD+++ +
Sbjct: 87  SPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAY 146

Query: 195 HLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSK--------ETIPFKKYKH 246
           HL           + L   +SN+ R +++   ++CS C P +        + I FK  ++
Sbjct: 147 HL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRN 204

Query: 247 INWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDL 306
               + L P+ER+ +E+F PF   K+  KY +ILY RDY +R+IW   L+  K  H+ ++
Sbjct: 205 NIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNI 264

Query: 307 ISKMIFSM-IRIPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQI- 364
           +++   S+   +PIF +++TI+N D FDI EKI  +Y I++                ++ 
Sbjct: 265 LTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMF 324

Query: 365 RKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLL-TGDIPDLYTKSYDKIEQ 423
           ++L+  +K +CL  W   L +G    NNK N R    P D++   ++     K  D+  +
Sbjct: 325 KQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLR 384

Query: 424 ILQDLPTENIVKIGR--GCIYLED 445
           I++   T+N VK+G     I++ED
Sbjct: 385 IIKQTITDNYVKLGNVASIIFIED 408

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  157 bits (396), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 110/378 (29%), Positives = 184/378 (48%), Gaps = 19/378 (5%)

Query: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141
           +  P IG+  + Y D  +D   ++RGE+E  EF+ T+   +    Y  ++  SL ++   
Sbjct: 28  FFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87

Query: 142 ATA-LKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDH 200
             A LK+      S+ ++L  RY  +  G++ +  + N+++CEP +IY + M  H +N+H
Sbjct: 88  IPASLKI----KTSKKMYLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNH 142

Query: 201 GRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKK-YKHINWFKGLLPLERV 259
            R  K ++ L   Y NI    V  + Q+CS CN + +    +  Y   N +   LPLER+
Sbjct: 143 MRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERL 202

Query: 260 QVEVFEPFPGE--KLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRI 317
           Q+++ +PF     K+  KY  IL  RDY SR+ W+ PL++    ++   + K + ++ R 
Sbjct: 203 QIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRT 262

Query: 318 PIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKL----LGPHKE 373
           PIF  +  I       I  KI+ +Y+I I                  R +    L  +KE
Sbjct: 263 PIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKE 322

Query: 374 ECLADWIMCLKYGPHTFN-NKMNDRACGVPGDLLTGDIPDLYTKSY-DKIEQILQDLPTE 431
           +C +DW  C++    TF  N+  DR  G   + L G       K + +K + +L DL  E
Sbjct: 323 KCKSDWYQCIR--NTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEE 380

Query: 432 NIVKIGR--GCIYLEDRN 447
           N++KIG     IY ++ N
Sbjct: 381 NVLKIGECGSIIYFDNNN 398

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  144 bits (363), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 171/378 (45%), Gaps = 26/378 (6%)

Query: 84  IPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSAT 143
           IP +   YK  +  D+D+  +  G  +  + +   +  L +  Y LI+  +   ET    
Sbjct: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEE- 82

Query: 144 ALKMD-----KF--RAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHL 196
           A+K       K+   A  + + +  RY L+E G + DK    +++  P  IYD+IM  H 
Sbjct: 83  AMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHF 142

Query: 197 INDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGL--- 253
           +NDH    K H  L   YSNI+R  V    Q CS CNP         YKHI + +     
Sbjct: 143 LNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKST------YKHIEYTRHFSCD 196

Query: 254 --LPLERVQVEVFEPFPG-EKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKM 310
                E++ VE+F+PF   +    K+  ++Y RDY +R++W+ PL       L + ++  
Sbjct: 197 KNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATH 256

Query: 311 IFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIXXXXXXXXXXXXXXXPQIRKLLGP 370
           +   +RIPI+ E+ T++  +   I ++I +   + +                 +++L   
Sbjct: 257 LLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQ 316

Query: 371 HKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGD-IPDLYTKSYDKIEQ--ILQD 427
           ++E C  +W   +    + +N   N    G+P +L+  + + D   K+Y K  Q  IL  
Sbjct: 317 NREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD--NKTYKKKRQRTILLT 374

Query: 428 LPTENI-VKIGRGCIYLE 444
           L    I +K G+  +Y E
Sbjct: 375 LSKNTILLKNGKSALYKE 392

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 67/169 (39%), Gaps = 27/169 (15%)

Query: 182 CEPVFIYDMIMTWH--------LINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCN 233
           C P  ++ +I   H         +  H    +   +L   Y NI++F +  +   C  C 
Sbjct: 156 CPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPDCK 215

Query: 234 PSKETIPFKKYKHINWFKGLLPL-----ERVQVEVFEPFPGEKLGGK----YPQILYFRD 284
           P    +  KK+        +LPL     +R+QV++        +  K       ILY  D
Sbjct: 216 P----LSSKKFNITRV--NVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYIGD 269

Query: 285 YRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRI-PIFFETTTIENQDFF 332
           Y S  +W+  L   +    + L+ +M  +++ I P   +   ++NQ  F
Sbjct: 270 YHSGAVWLFALDGEEDATDILLVLEMFLNVVLITPKHIQ---VDNQKIF 315

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 12/89 (13%)

Query: 229 CSVCNPSKETIPFKKYKHI-----NWFKGLLPLERVQVEVFEPFPGEKLGG-KYPQILYF 282
           C  C   K T    K+KHI      + K   P E +  ++F P  G  +   KY   + F
Sbjct: 348 CKDCLAGKIT----KHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDITSPKY--FISF 401

Query: 283 RDYRSRFIWMVPLRNSKFGHLVDLISKMI 311
            D  +RF W+ PL+     H++ +  +++
Sbjct: 402 TDENTRFRWVFPLKKKDADHILPIFQQLV 430

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 86/224 (38%), Gaps = 37/224 (16%)

Query: 122 LNESTYELIKTNSLTQETLSA-------------TALKMDKFRAASRLVFLNRRYG-LDE 167
           +N+   +L+  N    E+L A             TA+   K +  +   ++  RY  +DE
Sbjct: 61  MNDLIADLLLANKFNPESLKAAVFSKYTGAENKGTAISRSKRKLKNFCDYITARYVVIDE 120

Query: 168 QGNVRDKLRQN---RMVCEPVFIYDMIMTWHLIND---------HGRPRKCHQLLGPMYS 215
           +   R   + +   +M C P  +   I+ +H   D         H      H  +G   S
Sbjct: 121 KIYARKASKGDESPKMWCPPSLMTFFIIRYHRRQDIDESERKARHRGVAATHDAIGEKMS 180

Query: 216 NITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFE----PFPGEK 271
            ITR  ++ +   C  CN +K  +P       N  K  +P E + +++ +         K
Sbjct: 181 GITRQLIQDVTYDCLKCNVTK-GVPIIYVPDDNP-KAEVPFENLLIDIIDLKDRSCRCPK 238

Query: 272 LGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMI 315
              K  QIL+  D  + + W+  L ++    +      MIF ++
Sbjct: 239 DNKKKSQILHIMDQYTEYTWLYILDDTHHDAIA-----MIFEVL 277

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 12/89 (13%)

Query: 229 CSVCNPSKETIPFKKYKHI-----NWFKGLLPLERVQVEVFEPFPGEKLGG-KYPQILYF 282
           C  C   K T    K+KHI      + K   P E +  ++F P  G  +   KY   + F
Sbjct: 263 CKDCLAGKLT----KHKHIVGSRLKYQKYYEPFEYIHTDLFGPVSGVDITSPKY--FISF 316

Query: 283 RDYRSRFIWMVPLRNSKFGHLVDLISKMI 311
            D  +RF W+ PL+     H++ +  +++
Sbjct: 317 TDENTRFRWVFPLKKKDADHILPIFQQLV 345

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 229 CSVCNPSKETIPFKKYKH-----INWFKGLLPLERVQVEVFEPFPGEKLGGKYPQ-ILYF 282
           C  C   K     +K+ H     + + K   P + +  +VF P   +K    YP   + F
Sbjct: 384 CITCLQGKS----RKHNHTVGSRLKYQKNYEPFQYIHTDVFGPVSVDK---PYPSWFVAF 436

Query: 283 RDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIR 316
            D  +RF W+ PL N     ++ +I+ ++ ++ R
Sbjct: 437 TDEATRFRWVFPLENKTADLMLHVITALVNTIKR 470

>NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON} 
          Length = 234

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 255 PLERVQVEVFEPFPGEKLGGKYPQ-ILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFS 313
           P + +  +VF P   +K    YP   + F D  +RF W+ PL N     ++ +I+ ++ +
Sbjct: 28  PFQYIHTDVFGPVSVDK---PYPSWFVAFTDEATRFRWVFPLENKTADLMLHVITALVNT 84

Query: 314 MIR 316
           + R
Sbjct: 85  IKR 87

>CAGL0J00429g Chr10 (34645..35103) [459 bp, 152 aa] {ON} highly
           similar to uniprot|P00427 Saccharomyces cerevisiae
           YHR051w COX6
          Length = 152

 Score = 30.8 bits (68), Expect = 4.9,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 14/99 (14%)

Query: 90  KYKDYVDEDMDLAFVQRGEREF------FEFQKTINGQLNESTYELIKTNSLTQETLSAT 143
           KY D+ DE+    F  R E+EF      FE Q+ +N   N  +Y+L+   ++ ++ L A 
Sbjct: 42  KYSDHHDEETFEEFTARYEKEFDEAYDLFEVQRVLN---NCFSYDLVPAPAVIEKALRA- 97

Query: 144 ALKMDKFRAASRLVFLNRRYGLDEQGNVR---DKLRQNR 179
           A +++    A R VF   +Y ++ +   +   D+L++ R
Sbjct: 98  ARRVNDLPTAVR-VFEALKYKVENEDQYKAYLDELKEVR 135

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 409 DIPDLYTKSYDKIEQILQDLPTENIVKIGRGCIYLEDRNPEDP 451
           D P  +  +    ++ILQ+ P     K+G+G IY+E  N +D 
Sbjct: 448 DAPQFHNAAMTLFDRILQESPDNTRAKMGKGIIYIERENWQDA 490

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 229 CSVCNPSKETIPFKKYKHINWFKGLL--PLERVQVEVFEPFPGEKLGG-KYPQILYFRDY 285
           C  C   K T    K+KHI   +  +  P+  +  ++F P  G  +   KY   + F D 
Sbjct: 161 CKDCLTGKLT----KHKHIVGSRLNIKSPMSYIHTDLFGPVSGVDITSPKY--FISFTDE 214

Query: 286 RSRFIWMVPLRNSKFGHLVDLISKMI 311
            +RF W+ PL+     H++ +  +++
Sbjct: 215 NTRFRWVFPLKKKDADHILPIFQQLV 240

>Ecym_7367 Chr7 complement(765199..765660) [462 bp, 153 aa] {ON}
           similar to Ashbya gossypii ACL110W
          Length = 153

 Score = 30.0 bits (66), Expect = 8.4,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 21/102 (20%)

Query: 90  KYKDYVDEDMDLAFVQRGEREF------FEFQKTINGQLNESTYELIKTNSLTQETLSAT 143
           KY D+ DE+    F  R E+EF      FE Q+ +N   N  +Y+L+    + ++ L A 
Sbjct: 44  KYSDHHDEETFEEFTARYEKEFDEAYDLFEVQRVLN---NCFSYDLVPAPVVIEKALKA- 99

Query: 144 ALKMDKFRAASRLVFLNRRYG----------LDEQGNVRDKL 175
           A +++    A R VF   +Y           L+E G+VR +L
Sbjct: 100 ARRVNDLPTAIR-VFEALKYKVENEDQYKAYLEELGDVRKQL 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,828,730
Number of extensions: 3300201
Number of successful extensions: 30899
Number of sequences better than 10.0: 949
Number of HSP's gapped: 28619
Number of HSP's successfully gapped: 1233
Length of query: 588
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 473
Effective length of database: 40,294,809
Effective search space: 19059444657
Effective search space used: 19059444657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)