Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038408.263ON49749726580.0
NDAI0J013608.263ON50149019420.0
TDEL0F039008.263ON55949118750.0
SAKL0H17006g8.263ON53148718520.0
NDAI0B019908.263ON58848918480.0
YLR089C (ALT1)8.263ON59249518410.0
KNAG0M012108.263ON52148818330.0
Skud_12.1578.263ON59249118350.0
KNAG0G020408.263ON59149018340.0
ZYRO0C01628g8.263ON53448618210.0
NCAS0B050208.263ON56849118170.0
Suva_10.1738.263ON59249518180.0
Smik_12.1488.263ON59249518160.0
KLLA0F19162g8.263ON52848617950.0
KAFR0B055308.263ON51449017890.0
YDR111C (ALT2)8.263ON50748917380.0
CAGL0L12254g8.263ON57449717420.0
KAFR0B05520singletonON51049017200.0
Smik_4.3578.263ON50749717180.0
Skud_4.3728.263ON50748917180.0
Suva_2.2718.263ON50749717090.0
KAFR0B027308.263ON53949217030.0
Kpol_543.398.263ON49248916690.0
TPHA0J007508.263ON52249716680.0
Kwal_56.237918.263ON51848216640.0
KLTH0G13662g8.263ON51948216580.0
TBLA0E044408.263ON56249716590.0
Kpol_392.58.263ON51248916380.0
Ecym_43078.263ON53448816190.0
TPHA0A018008.263ON49849116000.0
TBLA0F030608.263ON50050015660.0
TBLA0G01630singletonON50049615410.0
AGR085W8.263ON52149115030.0
Kwal_34.160181.472ON3791741472e-09
CAGL0J05126g1.321ON4333481242e-06
KLTH0G09614g2.252ON3891791222e-06
Kpol_1039.222.252ON3861871213e-06
SAKL0D11528g1.472ON3832141115e-05
KLTH0G19646g1.472ON3791371116e-05
NCAS0G040501.472ON3841271106e-05
ZYRO0A01672g2.252ON3861341091e-04
Kwal_23.48882.252ON3891811072e-04
SAKL0E08492g2.252ON3841791062e-04
TDEL0C040902.252ON3831271053e-04
TPHA0O014501.321ON4431731044e-04
KNAG0G005501.472ON3871611035e-04
ADL249W2.252ON3871961035e-04
Kpol_278.23.511ON4981261036e-04
NDAI0B045502.102ON5651631036e-04
KLLA0F03509g2.252ON3871881027e-04
Kwal_14.25741.321ON4431351019e-04
Kpol_1035.231.321ON4441371000.001
Suva_6.1361.321ON4441381000.001
Ecym_6319singletonON354273990.001
Smik_10.1801.321ON444130990.001
KNAG0E018502.252ON384148990.002
Ecym_32902.252ON386185980.002
SAKL0F02156g3.511ON498124990.002
SAKL0H21824gna 1ON499122990.002
KNAG0B006603.511ON496126980.002
YJL060W (BNA3)1.321ON444138970.003
NDAI0G057601.321ON448324970.003
NCAS0B064402.252ON385123960.003
NCAS0A092001.321ON445356960.003
KNAG0B053201.321ON433165950.005
Skud_10.1561.321ON460138950.005
SAKL0D06886g1.321ON447132950.005
TDEL0D019001.321ON443136930.009
KLLA0F10021g3.511ON497124930.010
TPHA0F012602.252ON392179920.012
Kpol_480.11.472ON380131910.013
KLTH0H10648g1.321ON443131910.013
NCAS0B072202.102ON510197920.013
AEL170C1.321ON458131910.015
Kwal_47.17462na 1ON492124910.015
Skud_9.552.252ON385129910.016
KLLA0F01617g1.321ON444357900.021
CAGL0G01254g3.511ON504122890.028
ZYRO0G20636g1.321ON453132880.038
Ecym_62921.321ON430337880.039
Kwal_47.189823.511ON496125870.042
TPHA0D033703.511ON497123870.044
KAFR0A017101.321ON435126870.045
TBLA0B009902.102ON546160860.062
KLTH0E07678gna 1ON492133860.063
KLTH0G19624gsingletonON46850850.087
KAFR0J015802.252ON383181840.093
YIL116W (HIS5)2.252ON385127840.11
NCAS0E006703.511ON497149840.11
KLTH0G02002g3.511ON496189840.12
CAGL0G06028g2.102ON537162840.12
NDAI0I028303.511ON500128830.13
Smik_9.532.252ON388128830.14
KLTH0B00176g8.204ON44847830.14
ZYRO0C06028g3.511ON496124820.17
AFR548C3.511ON497130820.19
Smik_8.2182.102ON513129810.22
YGL202W (ARO8)3.511ON500123810.27
Kwal_8.5858.204ON446226800.28
NDAI0B037302.252ON386127800.31
Kpol_1035.302.102ON50144800.35
Suva_15.3342.102ON560129790.40
CAGL0C01243g2.252ON383128790.44
TPHA0O015202.102ON50344790.47
Smik_7.693.511ON500122780.53
Suva_9.782.252ON386123780.59
KLLA0A04906gna 1ON480122770.80
YHR137W (ARO9)2.102ON513129770.87
TDEL0A016008.204ON47547760.95
Kpol_1032.398.204ON453358761.1
Suva_7.613.511ON500122751.3
Skud_8.1982.102ON517129751.4
TBLA0A103205.287ON62157751.4
Skud_7.693.511ON500122741.6
TDEL0D057903.511ON497123741.7
Ecym_7228na 1ON488133714.3
ZYRO0E08800g3.534ON61098714.7
KAFR0D014203.511ON49244705.2
SAKL0E04268g2.420ON421180705.6
Smik_16.3183.372ON68028706.4
Suva_16.4033.372ON68028696.6
Ecym_55428.204ON44653697.0
TBLA0B080808.204ON444179688.7
KLLA0D11110g2.102ON530163689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03840
         (497 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...  1028   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   752   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   726   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   717   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   716   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   713   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   710   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   711   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   711   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   706   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   704   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   704   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   704   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   696   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            693   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   674   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   675   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   667   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   666   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   666   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   662   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   660   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   647   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   647   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   645   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   643   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   643   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   635   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   628   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   620   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   607   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              598   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   583   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    61   2e-09
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    52   2e-06
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    52   2e-06
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    51   3e-06
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    47   5e-05
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    47   6e-05
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    47   6e-05
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    47   1e-04
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    46   2e-04
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    45   2e-04
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    45   3e-04
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    45   4e-04
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       44   5e-04
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    44   5e-04
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    44   6e-04
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    44   6e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    44   7e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    44   9e-04
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    43   0.001
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    43   0.001
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    43   0.001
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    43   0.001
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    43   0.002
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    42   0.002
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    43   0.002
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    43   0.002
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    42   0.002
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    42   0.003
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    42   0.003
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    42   0.003
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    42   0.003
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    41   0.005
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    41   0.005
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    41   0.005
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    40   0.009
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    40   0.010
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    40   0.012
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    40   0.013
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    40   0.013
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    40   0.013
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    40   0.015
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    40   0.015
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    40   0.016
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    39   0.021
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    39   0.028
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    39   0.038
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    39   0.039
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    38   0.042
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    38   0.044
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    38   0.045
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    38   0.062
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    38   0.063
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    37   0.087
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    37   0.093
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    37   0.11 
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     37   0.11 
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    37   0.12 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    37   0.12 
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    37   0.13 
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    37   0.14 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.14 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    36   0.17 
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    36   0.19 
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    36   0.22 
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    36   0.27 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    35   0.28 
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    35   0.31 
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    35   0.35 
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    35   0.40 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    35   0.44 
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    35   0.47 
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    35   0.53 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    35   0.59 
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    34   0.80 
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    34   0.87 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    34   0.95 
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    34   1.1  
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    33   1.3  
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    33   1.4  
TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON} Anc_5...    33   1.4  
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    33   1.6  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    33   1.7  
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    32   4.3  
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    32   4.7  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    32   5.2  
SAKL0E04268g Chr5 complement(338322..339587) [1266 bp, 421 aa] {...    32   5.6  
Smik_16.318 Chr16 complement(569893..571935) [2043 bp, 680 aa] {...    32   6.4  
Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {...    31   6.6  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    31   7.0  
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    31   8.7  
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    31   9.6  

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/497 (100%), Positives = 497/497 (100%)

Query: 1   MSPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEI 60
           MSPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEI
Sbjct: 1   MSPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEI 60

Query: 61  TVANIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIG 120
           TVANIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIG
Sbjct: 61  TVANIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIG 120

Query: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180
           GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT
Sbjct: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180

Query: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240
           GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV
Sbjct: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240

Query: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300
           INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY
Sbjct: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300

Query: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360
           PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM
Sbjct: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360

Query: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420
           VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS
Sbjct: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420

Query: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480
           LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW
Sbjct: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480

Query: 481 INKWEKFHKHFYEKYQD 497
           INKWEKFHKHFYEKYQD
Sbjct: 481 INKWEKFHKHFYEKYQD 497

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/490 (70%), Positives = 424/490 (86%), Gaps = 3/490 (0%)

Query: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNP 68
           +DF+PAPKLS+KD+N NV+ A+FA+RG+I +KA++LQ QLNKNPH LPF+EITVANIGNP
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70

Query: 69  QELNQKPLTFARQVVSILQYPELLNNRDVLTKEK--IFNSDSFDRAERLLRDIGGSVGAY 126
           QEL+QKPLTFARQVVSILQYPELLN R+ LT     I+N+DSFDRAE+LL +IGGSVGAY
Sbjct: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           SASQGVYGIRKT A YIT+RD GE + P DIF+TTGAT+A+SYLLS+L  GPQTGVL+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVL-DSIKKGIKPSVIVVINPGN 245
           PQYPLYTA LAL+ +TM+PYYL+EES WS +T EIEK +  +++ KGI+P V+V+INPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 246 PTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFD 305
           PTG++LSE ++ KIF IAAKYGIV++ADEVYQEN+F+G +FHS KKVLR LQKQ+P +++
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 306 NIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLML 365
           N+QLAS+HSTSKG+FGECGQRGGYME++GF ++VR L+LKLAC+ VC VVTGQAM+DLM+
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 366 LPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSK 425
           LPPK+GD SY+LD  ERQ+I + M  RA+KLY MF  ++GI+CQKPQGAMYL+P L+LS 
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 426 KAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWE 485
           K I +A+   + PDEFYCHELL+ TGICTVPGSGFGQK  TYHLRTTFLAPG +WINKWE
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 486 KFHKHFYEKY 495
           KFHK F ++Y
Sbjct: 491 KFHKAFLKRY 500

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/491 (68%), Positives = 412/491 (83%), Gaps = 1/491 (0%)

Query: 8   NNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGN 67
           + DF PA  L+++D+NENV+ AK+A+RGSI ++AE+LQ QL ++P  LPFD+I  ANIGN
Sbjct: 69  HQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGN 128

Query: 68  PQELNQKPLTFARQVVSILQYPELL-NNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126
           PQ+LNQKPL+F RQV+SILQYPE+L    + L  + +F  D+ +RA+R+LRD+GGSVGAY
Sbjct: 129 PQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAY 188

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           S+SQGVYGIRKT A++IT+RD GEP+YPEDIFLT GA++A SYLLS+LCRG +TGVLIPI
Sbjct: 189 SSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPI 248

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTATLALN S ++PYYLDEES WSTNT EIE +V +SI+ GI+PSV+VVINPGNP
Sbjct: 249 PQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNP 308

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TG+VLS  AI KIFQ+AAKYGIVV+ADEVYQENIF G +FHS KKVLR LQK++PG +DN
Sbjct: 309 TGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDN 368

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QL S+HSTSKGV GECGQRGGYMEL GFT E+RQ++LKLA +++C VVTGQA+VDLM+ 
Sbjct: 369 VQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVC 428

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PPK GD SYE D+KER+ I + +  RA  L+  F+ L+GIECQKP+GAMYL+P + L  K
Sbjct: 429 PPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYK 488

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
           AI  A+ L  TPDEFYC +LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI KWE 
Sbjct: 489 AIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWED 548

Query: 487 FHKHFYEKYQD 497
           FHK FY++Y+D
Sbjct: 549 FHKKFYDQYRD 559

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/487 (68%), Positives = 406/487 (83%)

Query: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70
           FQPA KLSL+D+NENV+ AK+A+RG I  KAE+L+ QL ++P  LPFD I  ANIGNPQ+
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 71  LNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQ 130
           L+QKPLTF RQV+S+LQ P++L         +I+  D+ DRA RLL +IGGSVGAYS SQ
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164

Query: 131 GVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYP 190
           GVYG RKT A++ITKRDGGE +Y EDIFLT GA++A SY+LS+LCRGPQTGVLIPIPQYP
Sbjct: 165 GVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYP 224

Query: 191 LYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAV 250
           LYTA+LALN S  +PYYLDEES WSTN  EIEK+V +SI KG++P  +VVINPGNPTGA+
Sbjct: 225 LYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284

Query: 251 LSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLA 310
           LS  +I KIF++AAKYGIVV+ADEVYQEN+F+G +FHS +KVL+ LQ+++ GKFDNIQLA
Sbjct: 285 LSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLA 344

Query: 311 SMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKK 370
           S+HSTSKGV GECGQRGGYMEL+GF+ +VRQ+ LKLA +++C VVTGQA+VDLM+ PPK 
Sbjct: 345 SLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKP 404

Query: 371 GDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAK 430
           GDASYE D+KER EI DA+  RA  LY  F++L+GIECQKPQGAMYL+P L LS KA+ K
Sbjct: 405 GDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQK 464

Query: 431 AESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKH 490
           AE L+L+PDEFYC ELL+ATGICTVPGSGFGQ  GTYHLRTTFLAPG +WI  WE+FHK 
Sbjct: 465 AEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKK 524

Query: 491 FYEKYQD 497
           FY +Y+D
Sbjct: 525 FYNEYRD 531

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/489 (68%), Positives = 403/489 (82%), Gaps = 1/489 (0%)

Query: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69
           DF PA +L+L D+NENV+ AK+A+RGSI ++AE+L+VQL  NP  LPF +I  ANIGNPQ
Sbjct: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159

Query: 70  ELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128
           +L QKPL+F RQV+SILQYP++L  N   L   K++  D+ DRA+ LL +IGGSVGAYSA
Sbjct: 160 QLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSA 219

Query: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188
           SQGVYGIRKT A +IT+RDGGEP+YPEDIFLT        YLLS+LC+GP+TGVLIPIPQ
Sbjct: 220 SQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQ 279

Query: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248
           YPLYTATLALN S  +PYYLDE+S WSTN  EIE++V D++++ I PSV+VVINPGNPTG
Sbjct: 280 YPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTG 339

Query: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308
           AVL+E +I  IF+IAAKYGIVV+ADEVYQENI DGV+F+S KKVLR LQK +PGKFDN+Q
Sbjct: 340 AVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQ 399

Query: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368
           LAS+HSTSKGV GECGQRGGYMEL+GFT EVR+++LKLA +++C VVTGQA+VDLM+ PP
Sbjct: 400 LASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPP 459

Query: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428
           KKGDASYE D+ ER+ I   +  RA +LY  F  L+GIECQKPQGAMYL+P L L  KA+
Sbjct: 460 KKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAV 519

Query: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488
            +A+ L +TPDEFYC  LLDATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI KWE FH
Sbjct: 520 QEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFH 579

Query: 489 KHFYEKYQD 497
           K FY+ Y+D
Sbjct: 580 KEFYDNYRD 588

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 407/495 (82%), Gaps = 1/495 (0%)

Query: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63
           L   NN+F PA +L+L+D+NENV+ AK+A+RG+I ++AE+L+ QL K+P  LPFD I  A
Sbjct: 98  LKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINA 157

Query: 64  NIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGS 122
           NIGNPQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L+ DIGGS
Sbjct: 158 NIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGS 217

Query: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGV 182
           VGAYS+SQGV GIRK+ AE+ITKRD GE SYPEDIFLT GA++A +YLLS+ CRGP+TGV
Sbjct: 218 VGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277

Query: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVIN 242
           LIPIPQYPLYTATLALN S  +PYYLDE S WSTN  EIE +V ++I+  IKP+V+VVIN
Sbjct: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337

Query: 243 PGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPG 302
           PGNPTGAVLS  +IA+IF++AAKYG VV+ADEVYQENIF G +FHS KK+LR LQ+++PG
Sbjct: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397

Query: 303 KFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVD 362
           KFDN+QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VD
Sbjct: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457

Query: 363 LMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLI 422
           LM+ PP +G+ S+E D+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + 
Sbjct: 458 LMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517

Query: 423 LSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWIN 482
           L  KA+ +A  L LTPDEFYC +LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EWI 
Sbjct: 518 LPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577

Query: 483 KWEKFHKHFYEKYQD 497
           KWE FHK F+++Y+D
Sbjct: 578 KWESFHKEFFDQYRD 592

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/488 (67%), Positives = 405/488 (82%), Gaps = 1/488 (0%)

Query: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70
           F+PA KL   D+N+N++DA++A+RG+I +KAE+L++QL++ P  LPF+ ITVANIGNPQ+
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 71  LNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQ 130
           L+QKPLTF+RQVVSILQYP LL+  + L     +  D+F RA  LL  IGGSVGAYS +Q
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQ 153

Query: 131 GVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYP 190
           GVYGIR++ A++IT+RD GE + P+DIFLT GA+ AA+YLLS+LCR   TG++IPIPQYP
Sbjct: 154 GVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYP 213

Query: 191 LYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAV 250
           LYTA++ +  S M+PYYLDEES WST   EIE+ V+DSIK+G+ P VIVVINPGNPTGAV
Sbjct: 214 LYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAV 273

Query: 251 LSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYP-GKFDNIQL 309
           LS   IA+I  IAAKYGIVVLADEVYQ NI+ GV+FHS KKVLR LQ+ +P G++DN+QL
Sbjct: 274 LSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQL 333

Query: 310 ASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPK 369
           ASMHSTSKGV GECGQRGGYMELVGF++EVRQ++LKLA +++CSVVTGQA+VDLML PP+
Sbjct: 334 ASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPR 393

Query: 370 KGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIA 429
           +GD SYELD +ER+EI + M  R   LY  F KL+GIECQ+PQGAMYL+P L+LSKKAI 
Sbjct: 394 EGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIE 453

Query: 430 KAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHK 489
           +A+SL L PDEFYCH LLD TGICTVPGSGFGQK+GTYH+RTTFLAPG +WI  WE FHK
Sbjct: 454 EAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHK 513

Query: 490 HFYEKYQD 497
            FY+KY+D
Sbjct: 514 AFYDKYRD 521

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/491 (66%), Positives = 408/491 (83%), Gaps = 1/491 (0%)

Query: 8   NNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGN 67
           N+DF PA +L+L+D+NENV+ AK+A+RG+I ++AE+L+ QL K+P  LPFD+I  ANIGN
Sbjct: 102 NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 161

Query: 68  PQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126
           PQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L+ DIGGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           S+SQGV GIRK+ AE+ITKRD GE SYPEDIFLT GA++A +YLLS+ CRGP+TGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTATLALN S  +PYYLDE+S WSTN  EIE +V ++I+  IKP+V+VVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TGAVLS  ++++IF++AAKYG VV+ADEVYQENIF G +FHS KK+LR LQ+++PGKFDN
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VDLM+ 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PP +G+ S+ELD+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + L  K
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
           A+ +A  L LTPDEFYC  LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EWI KWE 
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 487 FHKHFYEKYQD 497
           FHK F+++Y+D
Sbjct: 582 FHKEFFDQYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/490 (67%), Positives = 408/490 (83%), Gaps = 3/490 (0%)

Query: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70
           F PA ++ + D+NENV+ AK+A+RGSI ++AE LQ QL ++P  LPFD+I  ANIGNPQ+
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 71  LNQKPLTFARQVVSILQYPELLNN--RDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128
           LNQKPL+F RQV+S+LQ+PELLN+   +      ++ +D+  RAE+LL DIGGSVGAYS 
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188
           SQGV GIRKT A++IT+RD  EP+YPEDIFLT GA++A SYLLS+ C+G +TGVLIPIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248
           YPLYTATLALN S  +PYYLDE+S WSTNT EI+ +VLD+I + IKPSV+VVINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFD-GVQFHSTKKVLRGLQKQYPGKFDNI 307
           AVLSE AIA+IF+IAAKYGIVV+ADEVYQENIFD  V+FHS KKVLR LQ+++PGKFD +
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 308 QLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLP 367
           QLAS+HSTSKGV GECGQRGG+MEL GF+ E+RQ++LKLA +++C VVTGQA+VDLM+ P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 368 PKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKA 427
           P++G+ SYELD+ ER  I   +++RA KL+  F++L+GI+CQKPQGAMYL+P L L  KA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 428 IAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKF 487
           + KA+ + +T DEFYC ELL+ TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI+ WEKF
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 488 HKHFYEKYQD 497
           HK FY KY+D
Sbjct: 582 HKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/486 (67%), Positives = 400/486 (82%), Gaps = 1/486 (0%)

Query: 13  PAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELN 72
           PA KL L ++NENV+ AK+A+RG+I + A +L  +L K+PH LPFD I  ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 73  QKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQG 131
           QKPLTF RQV+S+LQYP LL  N  VL   K++  D+  RA RLL DIG SVGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 132 VYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPL 191
           + GIR+T A++IT+RDGGE +Y EDIFLT GA+SA SYLLS+LC+G +TGVLIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 192 YTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVL 251
           YTA+LALN S  +PYYLDE+S WSTN TEIE +V ++I++ IKPSV+VVINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 252 SELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLAS 311
           SE  I++IF IAAKYGIVV+ADEVYQEN+FDG +FHS KK+LR LQK  PG FDN+QLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 312 MHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKG 371
           +HSTSKGV GECGQRGGYME+ GF +++RQ++LKLA +++C VVTGQA+VDLM+ PPK G
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 372 DASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKA 431
           D SYELD++ER+ I +A+ ERA KL+A F+ L+GIECQKP+GAMYL+P L+L  KAI  A
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 432 ESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHF 491
           E   +TPD FYC +LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI +WE FHK F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 492 YEKYQD 497
           YE+Y+D
Sbjct: 529 YEEYRD 534

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/491 (66%), Positives = 406/491 (82%), Gaps = 1/491 (0%)

Query: 8   NNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGN 67
           +N+F PA +L+L ++N+NV+ AK+A+RG+I ++AE+L++QL ++P  LPFD I  ANIGN
Sbjct: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137

Query: 68  PQELNQKPLTFARQVVSILQYPELL-NNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126
           PQ+LNQKPL+F RQV+S+LQYPE+L  +   L    +F  D+ +RA+ LL +IGG+VGAY
Sbjct: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           SASQGVYGIRKT A +ITKRD GEP+YPEDIFLT GA++A  YLLS+LC+GP+TGVLIPI
Sbjct: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTA+LALN S  +PYYLDE+S WSTN  EIE++VL +  K I+PSV+VVINPGNP
Sbjct: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TGAVLSE +I  IF+IAAKYGIVV+ADEVYQEN+F+ V+FHS KKVLR LQK++PG +D 
Sbjct: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QLAS+HSTSKGV GECGQRGGYMEL GFT EVR ++LKLA +++C VVTGQA+VDLM+ 
Sbjct: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PPKKGD S+E D+ ER+ I   ++ RA +LY  F+ L+GIECQKPQGAMYL+P L L  K
Sbjct: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
           A+ KA+ L ++PDEFYC  LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI KW+ 
Sbjct: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557

Query: 487 FHKHFYEKYQD 497
           FH+ FY  Y+D
Sbjct: 558 FHQDFYNTYRD 568

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/495 (65%), Positives = 408/495 (82%), Gaps = 1/495 (0%)

Query: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63
           L   NN+F PA +L+L D+NENV+ A++A+RG+I ++AE+L+ QL K+P  LPF++I  A
Sbjct: 98  LKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINA 157

Query: 64  NIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGS 122
           NIGNPQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L++DIGGS
Sbjct: 158 NIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGS 217

Query: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGV 182
           VGAYS+SQGV GIRK+ A++ITKRDGGE +YPEDIFLT GA++A +YLLS+ CRGP+TGV
Sbjct: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGV 277

Query: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVIN 242
           LIPIPQYPLYTATLALN S  +PYYLDE S WSTN  EIE +V ++I+  IKP+V+VVIN
Sbjct: 278 LIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337

Query: 243 PGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPG 302
           PGNPTGAVLS  +IA+IF++AAKYG VV+ADEVYQENIF G +F+S KKVLR LQ+ +PG
Sbjct: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPG 397

Query: 303 KFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVD 362
           KFDN+QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VD
Sbjct: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457

Query: 363 LMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLI 422
           LM+ PP +G+ S+E D+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + 
Sbjct: 458 LMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517

Query: 423 LSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWIN 482
           +  KAI +A  L LTPDEFYC +LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EW+ 
Sbjct: 518 VPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMK 577

Query: 483 KWEKFHKHFYEKYQD 497
           KWE FHK F+++Y+D
Sbjct: 578 KWEIFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/495 (65%), Positives = 405/495 (81%), Gaps = 1/495 (0%)

Query: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63
           L   NN+F PA +L+L D+NENV+ AK+A+RG+I ++AE+L+ QL K+P  LPF++I  A
Sbjct: 98  LKTSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINA 157

Query: 64  NIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGS 122
           NIGNPQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L+ +IGGS
Sbjct: 158 NIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGS 217

Query: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGV 182
           VGAYS+SQGV GIR++ AE+ITKRD GE SYPEDIFLT GA++A +YLLS+ CRGP+TGV
Sbjct: 218 VGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277

Query: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVIN 242
           LIPIPQYPLYTATLALN S  +PYYLDE S WSTN  EIE +V ++I+  IK +V+VVIN
Sbjct: 278 LIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVIN 337

Query: 243 PGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPG 302
           PGNPTGAVLS  +IA+IF++AAKYG VV+ADEVYQENIF G +FHS KK+LR LQ+++PG
Sbjct: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397

Query: 303 KFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVD 362
           KFDN+QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VD
Sbjct: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457

Query: 363 LMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLI 422
           LM+ PP +G+ S+E D+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + 
Sbjct: 458 LMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKID 517

Query: 423 LSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWIN 482
           L  +A+ +A  L LTPDEFYC +LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EWI 
Sbjct: 518 LPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577

Query: 483 KWEKFHKHFYEKYQD 497
           KWE FHK F++ Y+D
Sbjct: 578 KWETFHKEFFDHYRD 592

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/486 (66%), Positives = 402/486 (82%), Gaps = 1/486 (0%)

Query: 12  QPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQEL 71
           +PAPKLSL D+NENV+ AK+A+RG I ++AE+L+ QL K+P  LPF +I  ANIGNPQ+L
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103

Query: 72  NQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQG 131
           +QKPLTF R+V+S+LQ+PELL   D    + ++ +DS  RA+RLL ++GGSVGAYS SQG
Sbjct: 104 DQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 132 VYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPL 191
           V GIR+T A++ITKRD GE SYPEDI+LT GA++A SY+LS+LC+GP TGVLIPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 192 YTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVL 251
           YTA+LALN S  +PYYL EE  WST+  EIE++VLD+I+KGIKP+ +VVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 252 SELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLAS 311
           SE +I KIF++AAKYGIVV+ADEVYQEN+F G +F+S KKVLR LQK Y G++DNIQLAS
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 312 MHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKG 371
           +HSTSKGV GECGQRGGYMELVGF  ++RQ+ LKLA +++C VVTGQA+VDLM+ PP+ G
Sbjct: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 372 DASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKA 431
           D SYE D++ER++I DA+ ERA KL+  F +L+GIEC+KPQGAMYLYP L L  K I +A
Sbjct: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 432 ESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHF 491
           + L + PDEFYC  LL+ TGICTVPGSGFGQ  GTYHLRTTFL PG EW+  WEKFHK F
Sbjct: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 492 YEKYQD 497
           ++KY+D
Sbjct: 523 FDKYRD 528

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/490 (66%), Positives = 401/490 (81%), Gaps = 3/490 (0%)

Query: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQL--NKNPHCLPFDEITVANIG 66
           ++F+PA K++L D+N+NV+ +++A+RGSI  +AE+L+ +L  N +   L F+ I  ANIG
Sbjct: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85

Query: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126
           NPQ+L+QKPLTF+RQV+SILQYPELLN R++L    IF SD+ +RAE LL  IGGSVGAY
Sbjct: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           S+SQGVYGIR+T A YIT RD GE + P+DIFLT GA+ AASYLLS+LC+   TGVLIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTAT+ L  + M+PYYL+EES WSTNT EIEK+VLD+I   +KPSV+VVINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TG+VLS+  I  I  I AKYGIV++ADEVYQENIFDG +FHS KKVLR LQKQYPGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QLAS+HSTSKGV GECGQRGGYMELVGF DE+RQ +LKLA +++CSV+TGQA+VDLM+ 
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PPKKGD SYELD  ER+ I + + ERA KLY +F +L G+ECQKPQGAMYL+P L   + 
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
            I +A + N++PDEFYCH LL+ATGICTVPGSGFGQK+GTYHLRTTFLAPG +W  KW+ 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 487 FHKHFYEKYQ 496
           FH+ F+ KYQ
Sbjct: 505 FHEEFFSKYQ 514

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 397/489 (81%), Gaps = 1/489 (0%)

Query: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69
           DF+PA K++ KD+N  V  A++A+RG+I  +A++L+ +L KNP  LPFD+I  ANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 70  ELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128
           +L+QKPLTF RQV++IL+YPE+L    + L    +F+ D+ +RAERLL DIGGS+GAYS 
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188
           SQGV GIR+T A++IT+RDGGEP+ PEDI+LTTGA+SAA+ LLS+LC+  QTG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248
           YPLYTA+ +L  + ++PYYLDEES WSTN+ EIEK+V D++KK I+PSV++VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308
           AVLSE  IA+I  IAAKYGI +++DEVYQENIF+ V+FHS KKVLR LQ  YPGKFDN+Q
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368
           LAS+HS SKG   ECGQRGGYME++GF+ E+R  L KL  +++CSVVTGQA+VDLM+ PP
Sbjct: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428
           + GD SYE D  ER +IF  M  RA  LY  F +L+GIECQKPQGAMYL+P L+L KKA+
Sbjct: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488
            ++E L + PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG +WI  W++FH
Sbjct: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 489 KHFYEKYQD 497
           + F+ KY++
Sbjct: 499 QDFFSKYRN 507

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/497 (64%), Positives = 400/497 (80%), Gaps = 9/497 (1%)

Query: 5   SLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVAN 64
           S  N  F PA + +LKD+NE V++AK+A+RG+I ++AE+L+ QL +NPH LPF++I  AN
Sbjct: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142

Query: 65  IGNPQELNQKPLTFARQVVSILQYPELL----NNRDVLTKEKIFNSDSFDRAERLLRDIG 120
           IGNPQ+L QKPL+F RQV+S+LQYPEL+    NN   + K+     D+ DRA+RLL DIG
Sbjct: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQ-----DAIDRAKRLLDDIG 197

Query: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180
           GSVGAYS+SQGV GIRKT A++IT RD G  +YPEDIFLT GA+SA  YLLS+ CRG +T
Sbjct: 198 GSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEET 257

Query: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240
           GVLIPIPQYPLYTATLAL  S  +PYYL+EE+ WST+  E+E ++LDSI+  IKPSV+VV
Sbjct: 258 GVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVV 317

Query: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300
           INPGNPTGAVLSE AI +IF +AAKYGI+V+ADEVYQEN+F+ V+FHS KKVLR LQ + 
Sbjct: 318 INPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQ 377

Query: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360
           PG +DN+QLAS+HSTSKGV GECGQRGGYMELVGFT ++RQ++LKLA +++C VVTGQA+
Sbjct: 378 PGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQAL 437

Query: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420
           VDLM+ PP+KG+ SYE D++ER+ I   +++RA  L+  F KLDGI CQKPQGAMYL+P 
Sbjct: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPK 497

Query: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480
           L L  KAI +A   +++PDEFYC  LL+ TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W
Sbjct: 498 LELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKW 557

Query: 481 INKWEKFHKHFYEKYQD 497
           I  W  FH+ FY K+++
Sbjct: 558 IEDWVDFHQEFYNKFKN 574

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 395/490 (80%), Gaps = 3/490 (0%)

Query: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQL--NKNPHCLPFDEITVANIG 66
           +DF+PAPK+S+ D+N+ +++A++A+RGSI+++AE+L+ +L     PH  PF+ I  ANIG
Sbjct: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81

Query: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126
           NPQ+L+QKPLTF+RQV+SIL+YP LL  +DVL  + I+  D+ +RAE L   IG SVGAY
Sbjct: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           S +QGVYGIR+T A +I+KRD  E +  +DIFLT GA+ A +YL+  LC+   TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTA++ ++ + M+PYYLDEES WST   EIE  V+++I+ GIKPS +VVINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TGAVLS   I +I  +AAKYGIV++ADEVYQ+NIF+G +FHS KK+LR LQK+YPGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QLAS+HSTSKGV GECGQRGGYME+VGF+DEVR LLLKLA + +CSVVTGQA+VDLM+ 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PP  GD SYE D++ER EI   + +RA KLY  F  L+GIECQKPQGAMYL+P LIL  +
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
           AI +A+ L +  DEFYCH+LL+ TGICTVPGSGFGQ++GTYH+RTTFL+PG EWI+ W+K
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 487 FHKHFYEKYQ 496
           FH+ F ++YQ
Sbjct: 501 FHEKFMKEYQ 510

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/497 (61%), Positives = 399/497 (80%), Gaps = 1/497 (0%)

Query: 2   SPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEIT 61
           S  + ++ +F+PA K++ KD+N  V  A++A+RG+I  +A++L+ +L + P  LPFD+I 
Sbjct: 11  SVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDII 70

Query: 62  VANIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIG 120
            ANIGNPQ+L+QKPLTF RQV+SIL+YPE+L    D L    +F  D+  RAE LL DIG
Sbjct: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIG 130

Query: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180
           GS+GAYS SQGV GIR++ AE+ITKRD GEP+ PE+I+LTTGA+SAA+ LLS+LC+  QT
Sbjct: 131 GSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQT 190

Query: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240
           G+LIPIPQYPLYTA+ +L  + ++PYYLDE S WST + EIEK+V D+++KGIKPSV++V
Sbjct: 191 GLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIV 250

Query: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300
           INPGNPTGAVLSE  IAKI  IAAKYGI +++DEVYQEN+F+GV+FHS KKVLR LQ+ Y
Sbjct: 251 INPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLY 310

Query: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360
           PGKFDN+QLAS+HS SKG  GECGQRGGYME+VGF+ ++R  L KL  +++CSVVTGQA+
Sbjct: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAV 370

Query: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420
           VDLM+ PP+ GD SY+ D  ER +IF  MY RA  L+  F++L+GIECQKPQGAMYL+P 
Sbjct: 371 VDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPR 430

Query: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480
           L+L +KA+ ++E L + PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG +W
Sbjct: 431 LVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQW 490

Query: 481 INKWEKFHKHFYEKYQD 497
           I  W+ FH+ F+ KY+D
Sbjct: 491 IQDWKHFHQDFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/489 (62%), Positives = 395/489 (80%), Gaps = 1/489 (0%)

Query: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69
           DF+PA K++ KD+N +V  A++A+RGSI  +A++L+ +L KNP  LPFD+I  ANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 70  ELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128
           +L+QKPLTF RQV+SIL+YPE+L  + + L    +F+ D+  RAE LL+DIGGSVGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188
           SQGV GIR+T A++IT RDGGEP+ PEDI+LTTGA+SAA+ LLS+LC+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248
           YPLYTA+ +L  + ++PYYLDEE  WST + EIEK+V D+++KGI+PSV++VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308
           AVL+E  IA+I  IAAKYGI V++DEVYQEN+F+  +FHS KKVLR LQ  YPGKFDN+Q
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368
           LAS+HS SKG  GECGQRGGYME+VGF+ ++R  L KL  +++CSVVTGQA+VDLM+ PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428
           + GD SYE D++ER +IF+ M  RA  LY  F+ L+GIECQ PQGAMYL+P LIL  KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488
            ++E L + PDEFYC  LL++TGICTVPGSGFGQK GTYH+RTTFLAPG +WI  W+ FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 489 KHFYEKYQD 497
           + F+ +Y+D
Sbjct: 499 QSFFNEYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 400/497 (80%), Gaps = 1/497 (0%)

Query: 2   SPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEIT 61
           S  + ++ DF+PA KL+ KD+N +V  A++A+RG+I  +AE+L+ +L ++ + LPF+ I 
Sbjct: 11  SVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSII 70

Query: 62  VANIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIG 120
            ANIGNPQ+L+QKPLTF RQV+SIL+YPE+L  + D L    +F  D+  RA+RLL DIG
Sbjct: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIG 130

Query: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180
           GSVGAYS SQGV GIR+T A++IT+RDGGEP+ PEDI+LTTGA+SAA+ LLS+LC+  QT
Sbjct: 131 GSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQT 190

Query: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240
           G+L+PIPQYPLYTA+ +L  + ++PYYLDEE+ WST + EIE++VLD++KKGI+PSV+VV
Sbjct: 191 GLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVV 250

Query: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300
           INPGNPTGAVL+E  IAKI  IAAKYGI +++DEVYQENIF  V+FHS KK+LR LQ  +
Sbjct: 251 INPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLH 310

Query: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360
           PGKFDN+QLAS+HS SKG  GECGQRGGYME+VGF+ ++R  L KL  +++CSV TGQA+
Sbjct: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAI 370

Query: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420
           +DLM+ PP+ GD SY+ D+KER +I++ M  RA  LY  F++L+GI+CQKPQGAMYL+P 
Sbjct: 371 IDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPK 430

Query: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480
           L L +KA+ ++E LN+ PD  YC  LL++TGICTVPGSGFGQK GTYH+RTTFL PG +W
Sbjct: 431 LFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQW 490

Query: 481 INKWEKFHKHFYEKYQD 497
           I  W +FH+ F+ KY+D
Sbjct: 491 IQDWRQFHQDFFNKYRD 507

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/492 (63%), Positives = 398/492 (80%), Gaps = 1/492 (0%)

Query: 7   ENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIG 66
            N +F+PA +L++ D+NENV+ AK+A+RG I  +AE+L+ QL + P+ LPFD+I  ANIG
Sbjct: 48  HNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIG 107

Query: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLT-KEKIFNSDSFDRAERLLRDIGGSVGA 125
           NPQ+L Q+PL+F RQV+S+LQYP LL+  +       ++  D+  RA+++L+DIGGSVGA
Sbjct: 108 NPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGA 167

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIP 185
           YS SQGVYGIR+T A +IT+RDGGEP+YPEDIFLT GA++A +YLLS+LC+G +TGVLIP
Sbjct: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227

Query: 186 IPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGN 245
           IPQYPLYTATLALN S  +PY+LDE + WS N  EIE ++  +++  IKP V+VVINPGN
Sbjct: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287

Query: 246 PTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFD 305
           PTGAVLS+ AI  I +IAAKYGIVV+ADEVYQENIFDG++FHS K VLR LQ++ PGKFD
Sbjct: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFD 347

Query: 306 NIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLML 365
           N+QLAS+HSTSKGV GECGQRGGYME++GFT EVRQ++LKLA +++C VVTGQA+VDLM+
Sbjct: 348 NVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMV 407

Query: 366 LPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSK 425
            PPK+G+ S+ LD+ +R+ I   + +RA  L+  F+ LDGIECQKP GAMYL+P L L  
Sbjct: 408 SPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPY 467

Query: 426 KAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWE 485
           +AI +A+ L L+PDEFYC ELL+ TGICTVPGSGFGQ  GTYHLRTTFLAPGIEWI+ W+
Sbjct: 468 RAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWK 527

Query: 486 KFHKHFYEKYQD 497
           +FH  F EKY  
Sbjct: 528 QFHIEFMEKYNS 539

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/489 (61%), Positives = 382/489 (78%), Gaps = 4/489 (0%)

Query: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70
           F PA KLS+ D+N++ V A +A+RGSI ++AE L  Q+  +P  LPFD+I  ANIGNPQ+
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 71  LNQKPLTFARQVVSILQYPELLNNRDVLTKE---KIFNSDSFDRAERLLRDIGGSVGAYS 127
           + QKPLTF RQV+SIL+YP +LN+ ++L K     ++  D  +RA ++L  IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 128 ASQGVYGIRKTAAEYITKRDG-GEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           ASQGV G R+T A++I KRDG  + + P DIFLT GA+SA  YLLS+LC GP+ GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTATL L+ ST IPYYL E ++WSTNT EIE  + +S+  G+KP  IV+INPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TGA+LSE  +A I +I+AKYGI ++ADEVYQENIF G +FHS +KVL  LQ ++PG +DN
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QLAS+HSTSKG  GECGQRGGYMEL+GF DEV  ++LKLA +++CSVVTGQA++DL+  
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PP+ GDASY+LD++ER +I   +  RA +LY +F  L+G+ECQ+PQGAMYL+P LIL  K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
           AI KA  L + PDE+YC ELLDATGICTVPGSGFGQ  GTYHLRTTFL PG EWI +W +
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 487 FHKHFYEKY 495
           FH+ FYE++
Sbjct: 483 FHQQFYERF 491

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/497 (61%), Positives = 400/497 (80%)

Query: 1   MSPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEI 60
           ++ +SL++ +F+PA KL++ D+NENV+ AK+A+RG I  +AE L+ QL  NP  LPF ++
Sbjct: 26  LTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKV 85

Query: 61  TVANIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIG 120
             ANIGNPQ+LNQKPLTF RQV+S+LQYP +L+       + ++  D+ +RA+R+L DIG
Sbjct: 86  INANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIG 145

Query: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180
            SVG+YS+SQGV+G+RKT AEYI++RDGGE +Y EDIFLT GA+SA SYLL++LC+G ++
Sbjct: 146 SSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKES 205

Query: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240
           GVLIPIPQYPLYTATLALN +  +PYYL+E S WSTN  EIE +V ++I++ I P V+VV
Sbjct: 206 GVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVV 265

Query: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300
           INPGNPTGA+LS  +I KIF +AA +GIVV+ADEVYQENIF G +FHS KKVLR LQ++ 
Sbjct: 266 INPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRV 325

Query: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360
           PGK++N+QLAS+HSTSKGV GECGQRGGYMEL GF+ E++  +LKL  +++C VVTGQA+
Sbjct: 326 PGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQAL 385

Query: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420
           VDLM  PPKKG+ASYE D+ ER  I   +YERA  L+  F++++G+ CQKPQG+MYL+P 
Sbjct: 386 VDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPK 445

Query: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480
           + +  KA+ KA+ L++TPDE YC ELL+ATGICTVPGSGFGQK GT+HLRTTFLAPG  W
Sbjct: 446 IDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSW 505

Query: 481 INKWEKFHKHFYEKYQD 497
           I++W +FH+ F  KY+D
Sbjct: 506 IDQWREFHQIFCNKYRD 522

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/482 (62%), Positives = 390/482 (80%), Gaps = 1/482 (0%)

Query: 16  KLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELNQKP 75
           K +L+DINE V++AK+A+RG I ++AE+L+ +L + P  LPFD+I  ANIGNPQ+L+QKP
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97

Query: 76  LTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGVYGI 135
           LTF RQV+++LQ P+L+++       K F  D+ +RA+++L+ +GGSVGAYS SQGV G 
Sbjct: 98  LTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGF 157

Query: 136 RKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTAT 195
           R++ AE+I +RDG EP+  +DIFLTTGA+ A SY+LS+ C GP+ G LIPIPQYPLYTA+
Sbjct: 158 RESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTAS 216

Query: 196 LALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELA 255
           LALN S  +PYYLDEES WS +T +IEK+V DSIKKGI+P+ +VVINPGNPTGA+L+   
Sbjct: 217 LALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDT 276

Query: 256 IAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHST 315
           I  + ++AAKY +V++ADEVYQEN F+  +F S KKVLR LQK  PGK+DN+QLAS+HST
Sbjct: 277 IENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHST 336

Query: 316 SKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASY 375
           SKGV GECGQRGGYMELVGF++EV+Q+ LKLA +++C VVTGQA++DLM+ PPKKGDASY
Sbjct: 337 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASY 396

Query: 376 ELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKAESLN 435
           E D++ER +I DA+++R+  LY  F  ++G+ CQ+PQGAMYL+P L LS KAI KAES  
Sbjct: 397 EQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAG 456

Query: 436 LTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHFYEKY 495
           L PDE+YC ELL+ATGICTVPGSGFGQ  GT+HLRTTFLAPG EWI+ W+KFH+ F E +
Sbjct: 457 LAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDH 516

Query: 496 QD 497
           +D
Sbjct: 517 RD 518

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 388/482 (80%), Gaps = 1/482 (0%)

Query: 16  KLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELNQKP 75
           K +L+D+N+ V++AK+A+RG I ++AE+L+ +L + P  LPF++I  ANIGNPQ+L+QKP
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 76  LTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGVYGI 135
           LTF RQV+S+LQ P L+ +       K+F  D+ +RA+++L+ +GGSVGAYSASQGV G 
Sbjct: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158

Query: 136 RKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTAT 195
           R++ AE+I +RDG EP+   DIFLT GA+SA S +LS+ C G + G LIPIPQYPLYTAT
Sbjct: 159 RQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217

Query: 196 LALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELA 255
           LALN +  +PYYLDE S WS +T ++E++V D+I+KG++P+ +VVINPGNPTGA+LS  A
Sbjct: 218 LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277

Query: 256 IAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHST 315
           I KI  +AAKY +VV+ADEVYQEN FD   F S KKVLR LQK  PGK+DN+QLAS+HST
Sbjct: 278 IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337

Query: 316 SKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASY 375
           SKGV GECGQRGGYMELVGF++EV+Q+ LKLA +++C VVTGQA+VDLM+ PPKKGDASY
Sbjct: 338 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397

Query: 376 ELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKAESLN 435
           ELD++ER  I +++++++  LY  F  L+G+ CQKPQGAMYL+P L LS+KAI KAESL 
Sbjct: 398 ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457

Query: 436 LTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHFYEKY 495
           + PDE+YC ELL+ATGICTVPGSGF Q  GTYHLRTTFLAPG EW++ W+KFH+ F +++
Sbjct: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517

Query: 496 QD 497
           +D
Sbjct: 518 RD 519

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/497 (60%), Positives = 389/497 (78%), Gaps = 3/497 (0%)

Query: 2   SPLSLENNDFQP--APKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDE 59
           SPLS   +  +   A +L  +D+N NVV AK+A+RG+I   A+ L++QL K+P  LPF+ 
Sbjct: 67  SPLSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFES 126

Query: 60  ITVANIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDI 119
           +  +NIGNPQ+L QKPL+F RQV+SIL+YP LL++   L     +  DS +RA+ LL DI
Sbjct: 127 VINSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDI 186

Query: 120 GGSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQ 179
           G S+GAYS SQGV+GIR+T A++IT RD GE +YP+DIFLT GA+SA S +LS+LC+G Q
Sbjct: 187 G-SIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQ 245

Query: 180 TGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIV 239
           TGVLIPIPQYPLYTATL LN +T +PYYLDE + WST+  EI K+  DS++ GIKP+ +V
Sbjct: 246 TGVLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLV 305

Query: 240 VINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQ 299
           VINPGNPTG+VL+  AI  +F +AAKYG+VV+ADEVYQ+NIF G +FHS KK+LR LQK+
Sbjct: 306 VINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKE 365

Query: 300 YPGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQA 359
            P K+DNIQLAS+HS SKG+ GECG RGGY E +GFT EV+Q++ KL+ +++CS V GQA
Sbjct: 366 VPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQA 425

Query: 360 MVDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYP 419
           +VDLM  PPKKG+ SYELD+ ERQ I     +R+ KLY MF+ L+G+ CQKPQGAMY++P
Sbjct: 426 LVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFP 485

Query: 420 SLILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIE 479
           ++ L   AI  A++L++TPDEFYC ELL ATGICTVPGSGFGQ+ GTYH+RTTFLAPG+E
Sbjct: 486 NIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVE 545

Query: 480 WINKWEKFHKHFYEKYQ 496
           W+ +WEKFH  F+EKY+
Sbjct: 546 WMKRWEKFHIEFFEKYR 562

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/489 (60%), Positives = 384/489 (78%), Gaps = 7/489 (1%)

Query: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNP 68
           ++  PA KL + D+N+NV+ AK+A+RGSI ++AE+L++ L      LPFD +  ANIGNP
Sbjct: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNP 89

Query: 69  QELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128
           Q+L QKPLTF RQV+SILQYPELL      +   IF  D+ +RA +LL++IG SVG+YS+
Sbjct: 90  QQLKQKPLTFYRQVLSILQYPELLE-----SGSNIFKKDAIERARKLLKEIG-SVGSYSS 143

Query: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188
           SQG+  IRKT A +ITKRD GE S P DIFLT GA+SA  YLLS+LC+  ++GVLIPIPQ
Sbjct: 144 SQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203

Query: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248
           YPLYTATLALN +  +PYYLDE   WST+  EIE+++ DS+ KGIKP+ +V+INPGNPTG
Sbjct: 204 YPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263

Query: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308
           ++LS  ++ KI ++AA +GIV++ADEVYQEN+F+  +FHS KKVLR LQK +PG++D +Q
Sbjct: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323

Query: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368
           LAS+HSTSKGV GECGQRGGYMEL GF  E++Q++LKL  +++C VVTGQA+VDLM+ PP
Sbjct: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383

Query: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428
           +KGD SYE D+ ER  I + +  RA  L+  F+ ++G+ CQKP+GAMYL+P + L  K +
Sbjct: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443

Query: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488
            K++ L++TPDEFYC  LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI++W KFH
Sbjct: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503

Query: 489 KHFYEKYQD 497
             FY+KY+D
Sbjct: 504 AEFYDKYRD 512

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/488 (59%), Positives = 386/488 (79%), Gaps = 4/488 (0%)

Query: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70
           F+P   L L+D+N NV++AK+A+RG I  +A +L+ QL+++P  LPF +I  ANIGNPQ+
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 71  LNQKPLTFARQVVSILQYPELLNN-RDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSAS 129
           L QKPL+F+R+V+S+L+ P LL    +VL    I+  D+  RA+R++RD+  S+GAYS S
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNL--IYKPDAVRRAKRMMRDLQTSIGAYSHS 167

Query: 130 QGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQY 189
           QGV G RKT AEY++ RDG EP+  EDIFLTTGA++ AS ++ +LC+G ++GVLIPIPQY
Sbjct: 168 QGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQY 226

Query: 190 PLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGA 249
           PLYTAT+ LN +  +PYYLDEES WS N  ++E+++++SI+KG+KP+ +VVINPGNPTGA
Sbjct: 227 PLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGA 286

Query: 250 VLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQL 309
           +L   ++ +IF IAAKY IVV+ADEVYQEN+F+G++F+S KKVLR LQ++Y   F N+QL
Sbjct: 287 ILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQL 346

Query: 310 ASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPK 369
            S+HSTSKG+ GECGQRGGYMELVGF+D++R+++LK+A + +CS V GQA+VDLML  PK
Sbjct: 347 VSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPK 406

Query: 370 KGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIA 429
            GD SYE D  ER  I +A+ ER++ L+  F+ L+G+EC+KPQG+MYL+P L+L +KAI 
Sbjct: 407 PGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIK 466

Query: 430 KAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHK 489
            AESL++ PDEFYC ELL++TGICTVPGSGFGQ   T HLRTTFL PG EWI  WE FHK
Sbjct: 467 AAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHK 526

Query: 490 HFYEKYQD 497
            FY+KY+D
Sbjct: 527 SFYDKYRD 534

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/491 (57%), Positives = 377/491 (76%), Gaps = 3/491 (0%)

Query: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNP 68
            DF P  K++LKD+N  ++  ++A+RG I  +AE+L++QL K+P  LPF++I  ANIGNP
Sbjct: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66

Query: 69  QELNQKPLTFARQVVSILQYPELLNNRD---VLTKEKIFNSDSFDRAERLLRDIGGSVGA 125
           Q+L QKPL+F R+V+SILQYP++L +      L + +++  D   RA +LL +IGGSVGA
Sbjct: 67  QQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIP 185
           YS SQGV GI++T A+YITKRD GE +YPEDIFLTTGA+SA S++L + C GP TGVLIP
Sbjct: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186

Query: 186 IPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGN 245
           IPQYPLYTAT+ L  +T I YYL+EE  WS NT E+E  + +SIK GIKP+ IV+INPGN
Sbjct: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246

Query: 246 PTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFD 305
           PTG++L+E  IA I +I+AKYG++++ADEVYQEN+F G +FHS KKVLR LQ++Y G ++
Sbjct: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306

Query: 306 NIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLML 365
            +QLAS+HSTSKG+ GECGQRGGYMEL+G TD+VR  ++KL  +++CSVVTGQA++D+++
Sbjct: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366

Query: 366 LPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSK 425
            PP+ GD SYE+D+ ER  I + +  R++KL+ +F  L+G+EC +PQGAMYL+P  I  +
Sbjct: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426

Query: 426 KAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWE 485
           K I  A+ L+   D  YC ELL+ TGICTVPGSGFGQK  TYHLRTTFL PG  WI+ W 
Sbjct: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486

Query: 486 KFHKHFYEKYQ 496
           KFH  F E+Y+
Sbjct: 487 KFHTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 384/500 (76%), Gaps = 7/500 (1%)

Query: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63
           +++    F PAPK SL DINE+++ A++AIRG+I  +AE+L +QL +N   LPF +I  A
Sbjct: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60

Query: 64  NIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSV 123
           NIGNPQ+L+Q+PLTF RQV+S++Q+P+LL ++D+L  +KI++ DS +RA +LL  IGGSV
Sbjct: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV 120

Query: 124 GAYSASQGVYGIRKTAAEYITKRD-GGEPSY------PEDIFLTTGATSAASYLLSVLCR 176
           GAYS+SQGV  IRK  A +I KRD   +P+         ++FLT GA++A  ++L +  +
Sbjct: 121 GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK 180

Query: 177 GPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPS 236
               GVL+PIPQYPLYTA + L KS ++PYYL+E + WST+  +IE++V+D+IK+ IKP+
Sbjct: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240

Query: 237 VIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGL 296
            +VVINPGNPTGA+L++ +I  I  IAA+YGIV++ADEVYQEN+++  +FHS KKVL  L
Sbjct: 241 TLVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300

Query: 297 QKQYPGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVT 356
           +K YP K+DN+QLAS+HS SKGV GECGQRGGYME+ GF+++V+++LLK+A +++CSVVT
Sbjct: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360

Query: 357 GQAMVDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMY 416
           GQ +VDLM+ PP+ GD SYELD+ ER  I   +  ++  LY +F +L GI CQKPQGAMY
Sbjct: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420

Query: 417 LYPSLILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAP 476
           L+P L LS+ AI  A  LNL PDEFYC +LL+ TGICTVPGSGFGQ  GTYHLRTTFL P
Sbjct: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480

Query: 477 GIEWINKWEKFHKHFYEKYQ 496
           GIEWIN WEKFH  F EKY+
Sbjct: 481 GIEWINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/496 (56%), Positives = 371/496 (74%), Gaps = 9/496 (1%)

Query: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69
           D  PAPK SL DI+++++D ++AIRG+I  +A++LQ QLN +P+ LPF +I  ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 70  ELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSAS 129
           +L Q+PLTF RQV+S+++YP L+N++++L + KI+  D+  RAE +L  IGGSVGAYS+S
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSS 124

Query: 130 QGVYGIRKTAAEYITKRDGGE---------PSYPEDIFLTTGATSAASYLLSVLCRGPQT 180
           QG+  IRK  A+ I +RD  E              +IFLT GAT+A SY+L +  +    
Sbjct: 125 QGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENC 184

Query: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240
           GVL+PIPQYPLYTA + L  S ++PYYL+E+  WST+  EIE ++ D+I + IKP+ +V+
Sbjct: 185 GVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVI 244

Query: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300
           INPGNPTGA+LS  +I +I  IAAKYGIV++ADEVYQ NI+   +FHS KK+L  L+ QY
Sbjct: 245 INPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQY 304

Query: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360
           P K+DN+QLAS+HS SKGV GECGQRGGY EL+GF+DE+++++LKLA + +CSVVTGQ +
Sbjct: 305 PKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQIL 364

Query: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420
           VDLM  PP+KGD SY+LD++ER  I   +  ++  LY +F +L GI CQKPQGAMYL+P 
Sbjct: 365 VDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPR 424

Query: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480
           L L+   I +A+  NL PDEFYC +LL+ TGICTVPGSGFGQK+GTYH+RTTFL  GIEW
Sbjct: 425 LHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEW 484

Query: 481 INKWEKFHKHFYEKYQ 496
           I  WEKFH  F  +Y+
Sbjct: 485 IKLWEKFHLEFMNQYK 500

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/491 (56%), Positives = 368/491 (74%), Gaps = 2/491 (0%)

Query: 7   ENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIG 66
           + + F PA  ++L D+NENVV AK+A+RG I  +AE+L+ +L ++P  LPF +I  ANIG
Sbjct: 33  DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIG 92

Query: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126
           NPQ+L QKPLTF RQV+S++Q P+LL       ++  F +D   RA R+L+D GGSVGAY
Sbjct: 93  NPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA-FKADVVVRARRMLQDAGGSVGAY 151

Query: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186
           SASQGV G R+T A++I +RDG  P+ P++++LT GA+SA S LLS  C+GP+TGVLIPI
Sbjct: 152 SASQGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210

Query: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246
           PQYPLYTAT+  N +  +PYYL+E   WSTN  E+E+++LDS K+ I P  +VVINPGNP
Sbjct: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270

Query: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306
           TG+VLS   +  I  +AAKYGIVV+ADEVYQ+N+F   +FHS +KVL+ LQ + P  + N
Sbjct: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330

Query: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366
           +QLAS+HS SKG+ GECGQRGGYMEL+GF +E+R++ +KLA +++C VVTGQA+VDLM+ 
Sbjct: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390

Query: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426
           PP +GD SYE   +E + I+  + ER++ L+  F  L+GIEC  PQGA+YL+P L L +K
Sbjct: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450

Query: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486
           AI  A+ L +  DE YC ELLD TGICTVPG+GFGQ  GTYH+RTTFL PG +WI  W+ 
Sbjct: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510

Query: 487 FHKHFYEKYQD 497
           FHK FY+KY+D
Sbjct: 511 FHKKFYDKYRD 521

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 81/174 (46%), Gaps = 31/174 (17%)

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSA---ASYLLS-----VLCRG 177
           Y A QG + +RK  AE  +  D       E++ LT GA +A     Y L+      +C  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDVTLSE--ENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 178 PQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSV 237
           P    L  IPQ  ++ A + L        +L +E+ +  N  E+E+++  + K       
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMIKPNTK------C 157

Query: 238 IVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKK 291
           IV+  P NP  +V+    + +I ++A K+GIVV  DEVY         FHS +K
Sbjct: 158 IVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 75/348 (21%), Positives = 145/348 (41%), Gaps = 36/348 (10%)

Query: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAA-SYLLSVLCRGPQTG 181
           V  YS ++G   + K+  E + K   G+    +++ +TTGA     S L+ +L  G +  
Sbjct: 74  VNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDEVI 132

Query: 182 VLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGI--KPSVIV 239
           V  P     +    L       +P +  +E      T +  ++  D+++K    K   ++
Sbjct: 133 VFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKAVI 192

Query: 240 VINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQ 299
           +  P NP G V +E  + K+ Q+  ++  VV++DEVY E+++    F     +   +   
Sbjct: 193 INTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY-EHLYFTESFPRIANINEDIA-- 249

Query: 300 YPGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQA 359
                 N+ L ++ S  K  F   G R G+  ++   D++   + K A   +C       
Sbjct: 250 ------NLTL-TVGSAGKS-FAATGWRIGW--IISKNDQLLNYVSK-AHTRICFASPS-- 296

Query: 360 MVDLMLLPPKKGDASYELDKKERQEIFDAMYERARK----LYAMFDKLDGIECQKPQGAM 415
                   P +   +  ++   + + F  M E  RK    L   FDKL G+   +P+G  
Sbjct: 297 --------PLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQPEGTY 347

Query: 416 YL---YPSLILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGF 460
           ++   +  + + +  +   E L    D    + L++  GI  +P + F
Sbjct: 348 FILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 82/179 (45%), Gaps = 21/179 (11%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPY-YLD 209
           P   +++ L  G+  +   L+   C   +  +LI  P Y +Y+    +N   +I    + 
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 210 EESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
           E++++  NT +    V+++++      +  V +PGNPTGA++   +I KI     + GIV
Sbjct: 144 EDNSFQMNTDK----VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIV 198

Query: 270 VLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGG 328
            + DE Y       + F ST      L  +YP       LA + + SK  FG  G R G
Sbjct: 199 AI-DEAY-------IDFCSTGGSAAPLVNKYP------NLAVLQTLSKS-FGLAGVRLG 242

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 82/187 (43%), Gaps = 18/187 (9%)

Query: 143 ITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKST 202
           + K  G EP   +++ L  G+      L+   CR     +L   P Y +Y+    +N   
Sbjct: 73  LDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVE 132

Query: 203 MIPY-YLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQ 261
           ++    + E++++  N  E    VL ++K   K  ++ + +PGNPTG ++++  I  I +
Sbjct: 133 IVECPLITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILE 188

Query: 262 IAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFG 321
                G+VV+ DE Y     D      T   +  L  +YP       L  + + SK  FG
Sbjct: 189 NWTN-GLVVV-DEAY----IDFADAEGTTYSMAKLVTKYP------NLTVLQTLSKS-FG 235

Query: 322 ECGQRGG 328
             G R G
Sbjct: 236 LAGIRLG 242

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 87/214 (40%), Gaps = 33/214 (15%)

Query: 88  YPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGVYGIRKTAAEYITKRD 147
           Y   LN  + LT E+       DR  R           Y A +G   +R   A   + + 
Sbjct: 30  YSLCLNELEQLTGERF----ELDRDLRF---------TYGAIKGSDELRSLVASLYSDK- 75

Query: 148 GGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYY 207
             E    +D  L T     A++L+S    GP   V+   P Y   ++   +  + +    
Sbjct: 76  --EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICVDPTYQQLSSVPKMFGAEVELLE 133

Query: 208 LDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYG 267
           L+ E+ +  +  +++ ++  + K       IV+ NP NP G+V+    + +I  +A K  
Sbjct: 134 LNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNNPLGSVIPTATLEEIAALARKNE 187

Query: 268 IVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYP 301
           I V+ DEVY+        FHS        + QYP
Sbjct: 188 IRVICDEVYRP------LFHSHDN-----ESQYP 210

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 155 EDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAW 214
           +++ +T GA   A++L+     GP   ++   P Y   ++  ++  + +   +L+ E  +
Sbjct: 82  DNVLITNGAI-GANFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDGY 140

Query: 215 STNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
           + N  +++  V  + K       IV+ NP NP G+V+S   + +I   A +  I ++ DE
Sbjct: 141 TPNIQKLKSKVRANTK------YIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCDE 194

Query: 275 VYQENIFDGVQFHSTKK 291
           VY         FHS+++
Sbjct: 195 VYSP------LFHSSEQ 205

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDE 210
           P + +D  L T    AA++L+     GP   V+   P Y    +   +  + +    L +
Sbjct: 74  PEFNKDNVLVTNGAIAANFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSLLKLQK 133

Query: 211 ESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVV 270
           E  +  N   ++K++  + K      +I++ NP NP G+ +S   +  I Q+  +  I +
Sbjct: 134 EDGFIPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDICQLCEENNIYL 187

Query: 271 LADEVYQ 277
             DEVY+
Sbjct: 188 HCDEVYK 194

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 146 RDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIP 205
           +D  +P   E++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 206 YYL-DEESAWSTNTTEIEKLVLD--SIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQI 262
             L   ++++  NT E+ K   +  SIK      +I + +PGNPTGA +    I KI Q 
Sbjct: 138 CPLITSDNSFQANTDEVIKTAQNDPSIK------LIFITSPGNPTGAKVETSRIEKILQN 191

Query: 263 AAKYGIVVLADEVY 276
             + G+VV+ DE Y
Sbjct: 192 WDR-GMVVV-DEAY 203

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 79/181 (43%), Gaps = 25/181 (13%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALN--KSTMIPYYL 208
           P   E++ L  G+      L+   C   +  +LI  P Y +Y+    +N  +   +P  +
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 209 DEESAWSTNTTEIEKLVLD-SIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYG 267
           ++ S        IE L  D SIK      ++ + +PGNPTGA++    I K+     + G
Sbjct: 144 EDNSFQMDTEKVIETLQNDPSIK------LVFITSPGNPTGALIKPENIEKLLS-QWQSG 196

Query: 268 IVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRG 327
            VV+ DE Y       + F +T   +  L  +YP       LA + + SK  FG  G R 
Sbjct: 197 FVVV-DEAY-------IDFCTTGGSVAPLVNKYP------NLAVLQTLSKS-FGLAGIRL 241

Query: 328 G 328
           G
Sbjct: 242 G 242

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 23/179 (12%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYL-D 209
           P   E+I L  G+  +   L+ V C   +  ++I  P Y +Y+    +N    +   L  
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 210 EESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
           E++++  +T++    VL+++ +     +I + +PGNPT A++    I K+       G +
Sbjct: 144 EDNSFQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLN--NWTGGL 197

Query: 270 VLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGG 328
           V+ DE Y     D     +T      L  +YP       LA + + SK  FG  G R G
Sbjct: 198 VVVDEAY----IDFCGGSTTP-----LVNKYP------NLAVIQTMSKS-FGLAGVRLG 240

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDE 210
           P   E++ L  G+  +   ++   C   +  ++   P Y +Y+   ++N   ++   L  
Sbjct: 81  PLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPL-- 138

Query: 211 ESAWSTNTTEIE-KLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
               S N+ +++ + VLD++KK     ++ + +PGNPTGA +    I KI Q     GI+
Sbjct: 139 --VTSDNSFQVDTEAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGIL 195

Query: 270 VLADEVY 276
           V+ DE Y
Sbjct: 196 VV-DEAY 201

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 26/173 (15%)

Query: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSY-----PEDIFLTTGATSAA-SYLLSVLCR 176
           V  YS ++G    R T  + +T  D   P Y     PE++ +TTGA     + L+ +L +
Sbjct: 84  VNQYSPTRG----RPTLIKSLT--DLYSPLYKLTLKPENVLVTTGANEGILACLMGILNQ 137

Query: 177 GPQTGVLIPIPQYPLYTATLALNKSTMIPYY----LDEE----SAWSTNTTEIEKLVLDS 228
             +  V  P     +    L   K   +P      LD+     + W+ +  + E ++ + 
Sbjct: 138 NDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITNK 197

Query: 229 IKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIF 281
            K       I++  P NP G V +   + +I  I  K+ +++++DEVY    F
Sbjct: 198 TK------AIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 73/161 (45%), Gaps = 26/161 (16%)

Query: 119 IGGSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGP 178
           I GS    +   G+YG++ +A               +++ +T GA   A++LL     G 
Sbjct: 59  IKGSKDLRTLIAGLYGVQFSA---------------DNVLVTNGAI-GANFLLYYTLVGK 102

Query: 179 QTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPS-- 236
              V+   P Y    +   +  + +    L E+ ++  N        LD++KK IK +  
Sbjct: 103 GDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSFLPN--------LDTLKKAIKSNTK 154

Query: 237 VIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQ 277
           +I++ NP NP G V+S+  +  I ++  +  + +  DEVY+
Sbjct: 155 LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 84/196 (42%), Gaps = 25/196 (12%)

Query: 136 RKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTAT 195
           R  A+ +  + +G  P   ++I L  G+  +   ++   C   +  V++  P Y +Y   
Sbjct: 71  RNAASAF--REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVC 128

Query: 196 LALNKS--TMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSE 253
             +N      +P    + S        +E+L LD   K IK  V+ + +PGNPTGA +  
Sbjct: 129 ADINDVGYVEVPLISSDNSFQIDEDRILEQLNLD---KSIK--VVFITSPGNPTGACIEV 183

Query: 254 LAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMH 313
             + K+ +     GIVV+ DE Y       + F + K  L  L  ++P       L  + 
Sbjct: 184 GRVEKLLR-NWTAGIVVV-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQ 228

Query: 314 STSKGVFGECGQRGGY 329
           + SK   G  G R G+
Sbjct: 229 TLSKAS-GLAGIRLGF 243

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS---TMIPYYLDEES 212
           DI LTTG T+     L V C     G +I + +   ++++LA  ++   T  P  +DE  
Sbjct: 132 DIILTTGNTNGWESTLRVFC---NKGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 213 AWSTNTTEIEKLVLDSIKKGI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVV 270
                  EI    LD+   G  KP ++  I  G NPTG  L++    +I++IA K+  ++
Sbjct: 188 IIPEKLEEI----LDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLI 243

Query: 271 LADEVY 276
           + DE Y
Sbjct: 244 IEDEPY 249

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 16/163 (9%)

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPE---DIFLTTGATSAASYLLSVLCRGPQTGV 182
           YS +QG+  +      +ITK +   P Y E   DI L  G++ +   +   LC    T +
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNT-PPYNETLYDIMLANGSSDSMFKVFETLCDESTTVL 195

Query: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKL--VLDS------IKKGIK 234
           +      P+ +  +A   +  IP  L+    +     +IE L  +LD+       K   K
Sbjct: 196 MEEFTFVPVISNVMATG-AKCIPLKLNLN--YEDQGIDIEYLENLLDNWGGKSNTKHLSK 252

Query: 235 PSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           P ++  I+ G NP G  LS     KI+ IA ++ +++L D+ Y
Sbjct: 253 PKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 83/188 (44%), Gaps = 20/188 (10%)

Query: 143 ITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALN--K 200
           I K    +P   +++ L  G+  +   L+   C   +  +LI    Y +YT    +N  +
Sbjct: 76  IFKDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVE 135

Query: 201 STMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIF 260
              +P  L EE  +  +    E+ +L++++      ++ + +PGNPTG  +    I KI 
Sbjct: 136 YVTVPLLLSEEDKFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKIL 191

Query: 261 QIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVF 320
               + G+VV+ DE Y     D V+        +G       K++NI  A + + SK  F
Sbjct: 192 S-QWQTGLVVV-DEAY----IDFVEGSD-----KGSLAPLATKYENI--AVLQTLSKS-F 237

Query: 321 GECGQRGG 328
           G  G R G
Sbjct: 238 GLAGIRLG 245

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 15/135 (11%)

Query: 156 DIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEE--- 211
           ++ +TTGA     S L+ +L  G +  V  P     +    +   K T +P +  +E   
Sbjct: 116 NVQVTTGANEGILSCLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMNV 175

Query: 212 -----SAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKY 266
                + W+ N  E+E  +    K       +++  P NP G V +   + +I +I  K+
Sbjct: 176 RNTKGTEWTVNYDELEAAITPKTK------ALILNTPHNPVGKVFTREELLRIGEICVKH 229

Query: 267 GIVVLADEVYQENIF 281
            +V+++DEVY+   F
Sbjct: 230 NVVIISDEVYEHLYF 244

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 15/137 (10%)

Query: 154 PEDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI------PY 206
           PE++ +TTGA     S L+ ++   P   V++  P +  Y   + L    ++      P 
Sbjct: 115 PENVLVTTGANEGILSCLMGII--NPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPK 172

Query: 207 YLDEESAWSTNTTEIEKLVLDSIKKGIKPSV--IVVINPGNPTGAVLSELAIAKIFQIAA 264
            LD      T  T    +  D   + I P    +++  P NP G V +   + K+  I  
Sbjct: 173 ELDNRVTKGTEWT----VDFDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGNICV 228

Query: 265 KYGIVVLADEVYQENIF 281
           +  ++++ADEVY+   F
Sbjct: 229 ENNVIIIADEVYEHLYF 245

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 19/138 (13%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI------PYY 207
           E++ +TTGA     S L+ +L  G +  V++  P +  Y   + L    ++      P  
Sbjct: 116 ENVVVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 208 LDEESA----WSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIA 263
           LD+ +     W+ +  + EK +    K       +++  P NP G V +   +  +  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITSKTK------AVIINTPNNPIGKVFTHDELTTLGNIC 227

Query: 264 AKYGIVVLADEVYQENIF 281
            K+ +V+++DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 118/273 (43%), Gaps = 36/273 (13%)

Query: 154 PEDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEES 212
           PE+I +TTGA     + L+S+L  G +  VL P     +Y   +       +P  L    
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVP--LTPPK 156

Query: 213 AWSTNTTEIEKLVLD--SIKKGI--KPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGI 268
              T  T+  +  LD    +  I  K   +++ +P NPTG V +   +  +  I  +  +
Sbjct: 157 DLKTRRTKGSEWTLDFDQFRSAISEKTKAVIINSPHNPTGKVFTREELLTLGNICVEKNV 216

Query: 269 VVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGG 328
            +++DEVY EN++    F      L  L  +      NI L ++ S  K +F   G R G
Sbjct: 217 YIISDEVY-ENLY----FTPECVKLASLSPE----ISNITL-TIGSAGK-IFAVTGWRIG 265

Query: 329 YMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASYELDKKERQEIFDA 388
           ++     ++ V   LLKLA  A   +            PP+   A + +D     + FD 
Sbjct: 266 WI----ISENVE--LLKLASSAHIKICFSSPS------PPQLACA-HAIDIALNSDYFDR 312

Query: 389 M----YERARKLYAMFDKLDGIECQKPQGAMYL 417
           M     E+   L ++F++L G+    P+G+ ++
Sbjct: 313 MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFI 344

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 55/130 (42%), Gaps = 3/130 (2%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESA 213
           E++ +TTGA     S L+ +L  G +  V  P     +    L   K   +P    +E  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELCGGKVVYVPINPPKELD 175

Query: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVI--NPGNPTGAVLSELAIAKIFQIAAKYGIVVL 271
                 E   +  +  +K I P    VI   P NP G V +   +  +  I  K+ ++++
Sbjct: 176 LRNTRGEEWTIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIII 235

Query: 272 ADEVYQENIF 281
           +DEVY+   F
Sbjct: 236 SDEVYEHLYF 245

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 70/148 (47%), Gaps = 14/148 (9%)

Query: 137 KTA-AEY------ITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQY 189
           KTA AEY       T  +   P    +I L  G+  +   ++   C   +  +L+  P Y
Sbjct: 63  KTAIAEYRNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTY 122

Query: 190 PLYTATLALNKSTMIPY-YLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248
            +Y+    +N   ++    + E++++  ++ +    VLD +    +  ++ + +PGNPTG
Sbjct: 123 SMYSVCAKINDVEVVTCPLITEDNSFQMDSDK----VLDILNNDQEIKLLFITSPGNPTG 178

Query: 249 AVLSELAIAKIFQIAAKYGIVVLADEVY 276
           A +    I K+ Q   + G+VV+ DE Y
Sbjct: 179 AQIETARIEKVLQNWDR-GLVVV-DEAY 204

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 22/185 (11%)

Query: 145 KRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI 204
           K +G  P   ++I L  G+      L+   C      VL+  P Y +Y+    +N + ++
Sbjct: 78  KSEGLAPISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVV 137

Query: 205 PY-YLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIA 263
               + E++++  +       VL+++       ++ +  PGNPTGA +S   I  +    
Sbjct: 138 ECPLITEDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNW 193

Query: 264 AKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGEC 323
           +  GIVV+ DE Y       + F S+      L  +YP       L  + + SK  FG  
Sbjct: 194 SA-GIVVV-DEAY-------IDFSSSDSA-APLVNKYP------NLVVIQTLSKS-FGLA 236

Query: 324 GQRGG 328
           G R G
Sbjct: 237 GVRLG 241

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS--TMIPYYLDEESA 213
           D+  T G T+A    L V C     G  I    Y   ++  A       + P  LDE   
Sbjct: 135 DVLATAGNTNAWESTLRVFC---NRGDTILAEAYSFSSSLYAAEAQGVNVFPVPLDE--- 188

Query: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLA 272
           +     ++E ++ +   +  KP ++  I  G NPTG+ LS+   AKI++IA K+  +++ 
Sbjct: 189 FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIE 248

Query: 273 DEVY 276
           DE Y
Sbjct: 249 DEPY 252

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 50/122 (40%), Gaps = 2/122 (1%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           DI  TTG+T A    L + C    T VL+    Y              IP  +D +    
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDT-VLLEEFTYSSSVEAADAQGLNCIPVPMDNQGIIP 191

Query: 216 TNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
               E+     D       P ++  I  G NPTG  LSE     I+++A KY I+++ D+
Sbjct: 192 EKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIVEDD 251

Query: 275 VY 276
            Y
Sbjct: 252 PY 253

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI---PYYLDEES 212
           D+  TTG T+A    L V C     G +I + +   +++ LA  ++  I   P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 213 AWSTNTTEIEKLVLDSIKKGI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVV 270
                  E  + +LD+  +G  KP ++  I  G NPTG+ LS+    KI+++A K+  ++
Sbjct: 188 I----IPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFII 243

Query: 271 LADEVY 276
           + DE Y
Sbjct: 244 IEDEPY 249

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 19/138 (13%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI------PYY 207
           E++ +TTGA     S L+ +L  G +  V++  P +  Y   + L    ++      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 208 LDEESA----WSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIA 263
           LD+ +     W+ +  + EK +    K       +++  P NP G V +   +  +  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITSKTK------AVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 264 AKYGIVVLADEVYQENIF 281
            K+ +V+++DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 134/324 (41%), Gaps = 51/324 (15%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESA 213
           E+I +TTGA     S L+ +L  G +  V++  P +  Y + + L    ++   ++    
Sbjct: 120 ENITITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKD 177

Query: 214 WSTNTTEIEKLVLD--SIKKGIKPSV--IVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
                TE  +  +D    +  I P    ++V +P NP G V ++  + K+ +I  +  ++
Sbjct: 178 LDQRITEGTEWTIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVI 237

Query: 270 VLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGGY 329
           +++DEVY+      + F+ +   +  L  +        QL     ++   F   G R G+
Sbjct: 238 IISDEVYE-----FLYFNDSFTRIATLSPEIG------QLTLTVGSAGKTFAATGWRIGW 286

Query: 330 MELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASYELDKKERQEIFDAM 389
           +  +    E+ Q + K A   +C              P ++  A+   D  E        
Sbjct: 287 V--ISQNPELLQYVSK-AHTRICFASPS---------PLQEACANSINDALE-----SGY 329

Query: 390 YERARKLY--------AMFDKLDGIECQKPQGAMYLYPSLILSKKAIAK-----AESLNL 436
           +E+ RK Y        A+F++L G+   KP+G  ++      SK  I +      E L+ 
Sbjct: 330 FEKMRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLAD--FSKVKIPEDYPWPEEILDK 386

Query: 437 TPDEFYCHELLDATGICTVPGSGF 460
             D    H L++  G+  +P + F
Sbjct: 387 GKDFRISHWLINELGVVAIPPTEF 410

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 155 EDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLD-EESA 213
           E++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++   L  E+++
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLAD 273
           +  N+ +    VLD +K      ++ + +PGNPTG  +    I K+ Q     G+VV+ D
Sbjct: 148 FQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-D 201

Query: 274 EVY 276
           E Y
Sbjct: 202 EAY 204

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 75/356 (21%), Positives = 144/356 (40%), Gaps = 52/356 (14%)

Query: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAA-SYLLSVLCRGPQTG 181
           V  YS ++G   +     +  T   G E    E++ +TTGA     S L+ +L  G +  
Sbjct: 86  VNQYSPTRGRVSLLNALIKQYTPIYGSELK-QENVTITTGANEGILSCLMGLLNAGDE-- 142

Query: 182 VLIPIPQYPLYTATLALNKSTMI------PYYLDEESAWSTNTTEIEKLVLDSIKKGI-- 233
           V++  P +  Y + + L    ++      P  LD+     T  T    + ++  K  I  
Sbjct: 143 VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWT----VDMEQFKNAITS 198

Query: 234 KPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVL 293
           K   +++  P NP G V +   + +I  I  +  +++++DEVY E+++   +F     + 
Sbjct: 199 KTKAVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVY-EHLYFTDEFTRIATLS 257

Query: 294 RGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCS 353
             +           QL     ++   F   G R G++  +    E+ Q + K A   +C 
Sbjct: 258 PEIG----------QLTLTVGSAGKTFAATGWRIGWV--ISLNSELLQYVSK-AHTRICF 304

Query: 354 VVTGQAMVDLMLLPPKKGDASYELDKKERQEIFDAM---YERARKLY-AMFDKLDGIECQ 409
                         P +   +  ++       F+ M   Y +  K++ ++F++L G+   
Sbjct: 305 ASPS----------PLQEACANSINDALESNYFEKMRQEYIQKFKIFTSVFEEL-GLPYT 353

Query: 410 KPQGAMYLYPSLILSKKAIAK-----AESLNLTPDEFYCHELLDATGICTVPGSGF 460
           KP+G  ++      SK  I +      E LN   D    H L++  G+  +P + F
Sbjct: 354 KPEGTYFVLAD--FSKVKIPEDYPYPKEILNKGKDFRISHWLINELGVVAIPPTEF 407

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 77/165 (46%), Gaps = 16/165 (9%)

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAA-SYLLSVLCRGPQTGVLI 184
           YS ++G   + K  A+  T   G + S  ++I + TGA  A  S L+ +L +G +  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 185 PIPQYPLYTATLALNKSTMI------PYYLDEESAWSTNTTEIEKLVLDSIKKGI--KPS 236
           P   +  Y + + L    +       P  LD+     T  TE E +  D ++K I  +  
Sbjct: 136 PF--FDQYISNIELAGGVVRYVPINPPRELDDRV---TRGTEWE-IDWDILEKTINSRTK 189

Query: 237 VIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIF 281
            +++  P NP G V +   + ++ +I     IV+++DEVY+   F
Sbjct: 190 CVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 62/138 (44%), Gaps = 19/138 (13%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI------PYY 207
           E++ +TTGA     S L+ +L  G +  V++  P +  Y   + L    ++      P  
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 208 LDEESA----WSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIA 263
           LD+ +     W+ +  + E  +    K       +++  P NP G V +   +  +  I 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITSKTK------AVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 264 AKYGIVVLADEVYQENIF 281
            K+ +V+++DEVY+   F
Sbjct: 244 VKHNVVIISDEVYEHLFF 261

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 5/132 (3%)

Query: 154 PEDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEE- 211
           P ++ +TTGA  A  S L+ +L +G +  V  P     +    +   K T +P +  +E 
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 212 SAWSTNTTEIEKLVLDSIKKGIKPSV--IVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
               T+ TE   +  D ++  I P    +++  P NP G V +   + +I  I  +  +V
Sbjct: 178 ENRVTHGTEW-TVDYDELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVENNVV 236

Query: 270 VLADEVYQENIF 281
           +++DEVY+   F
Sbjct: 237 IISDEVYEHLYF 248

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 15/136 (11%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYY----LD 209
           E++ +TTGA     S L+ +L  G +  V  P     +    L   K   +P      +D
Sbjct: 115 ENVTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMD 174

Query: 210 EE----SAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAK 265
           +     + W+ +  +    + D  K       +++  P NP G V +   + +I +I  K
Sbjct: 175 QRVVKGTEWTVDYEQFANAITDKTK------AVIINTPHNPIGKVFTREELTRIGEICVK 228

Query: 266 YGIVVLADEVYQENIF 281
             +V+++DEVY+   F
Sbjct: 229 KNVVIISDEVYEHLYF 244

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 9/124 (7%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS--TMIPYYLDEESA 213
           D+  T G T A   +L + C     G  I   Q+   ++  A       + P  LDE   
Sbjct: 134 DVLATIGNTGAWESVLRIFC---NRGDTILAEQFAFSSSISAAEAQGVNVFPIPLDEHG- 189

Query: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLA 272
                +++E ++ +  +   KP ++  +  G NPTG+ LS     +I++IA K+  +++ 
Sbjct: 190 --IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIE 247

Query: 273 DEVY 276
           DE Y
Sbjct: 248 DEPY 251

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 81/179 (45%), Gaps = 20/179 (11%)

Query: 155 EDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAW 214
           +++ L  G+      L+   C+     +++  P Y +Y+    +N   ++   L  E   
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVED-- 142

Query: 215 STNTTEIE-KLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLAD 273
             N+ +++ K  L+++KK     ++ + +PGNPTG +++   I  + +   K G+VV+ D
Sbjct: 143 --NSFQMDVKRTLETLKKDDLIRLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV-D 198

Query: 274 EVYQENIFDGVQFHSTKKV----LRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGG 328
           E Y +  F       TKK     +  L  +YP       L  + + SK  FG  G R G
Sbjct: 199 EAYVD--FSTYFNEETKKTEYFSVAKLVTKYPN------LTVLQTLSKS-FGLAGIRLG 248

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 23/131 (17%)

Query: 155 EDIFLTTGATSA---ASYLL-----SVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPY 206
           +DI LT GA  A   A Y L      V+C  P    L  +P+  ++ A + L        
Sbjct: 79  DDILLTNGAIGANFLAFYTLVGAGDHVICVEPTYSQLYSVPE--MFGAEVDL-------L 129

Query: 207 YLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKY 266
            L +E  +  N   ++ ++ ++ K      +I++ NP NP G+V+ +  + +I ++  + 
Sbjct: 130 TLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPNNPLGSVIKKDLLKQICKLCEEN 183

Query: 267 GIVVLADEVYQ 277
            I + +DEVY+
Sbjct: 184 DIYLHSDEVYR 194

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 7/131 (5%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLAL--NKSTMIPYYLDEE-S 212
           +I +TTGA       L  L   P   V++  P +  Y + + +   K T +P +  +E S
Sbjct: 116 NIQVTTGANEGILACLVGLL-NPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMS 174

Query: 213 AWSTNTTEIEKLVLDSIKKGIKPSV--IVVINPGNPTGAVLSELAIAKIFQIAAKYGIVV 270
              T  TE   +  D ++  I P    +++  P NP G V +   + +I QI  +  +V+
Sbjct: 175 VRPTEGTEW-TVDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVI 233

Query: 271 LADEVYQENIF 281
           ++DEVY+   F
Sbjct: 234 ISDEVYEHLYF 244

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 88/197 (44%), Gaps = 26/197 (13%)

Query: 102 KIFNSDSFDRAER--LLRDIGGSVGA---------YSASQGVYGIRKTAAEYITKRDGGE 150
           KI N+  F+++ER  +  +I               YS ++G+  +      Y  K  G  
Sbjct: 74  KISNTPHFEKSERKTVTTNISKETPVELPLSKSMQYSETRGLNPLLD-FIRYFIKWIGNS 132

Query: 151 PSYPE---DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYY 207
           P Y +   ++ L  G++ +   +   LC    T ++      P+ +  +A   +  IP  
Sbjct: 133 PPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVLMEEFTFVPVISNVMATG-AKCIPIK 191

Query: 208 LDEESAWSTNTTEIEKL--VLDSIKKG-----IKPSVIVVINPG-NPTGAVLSELAIAKI 259
           ++    +     +I+ L  +L++ K+G      KP ++  I+ G NP G  LS     KI
Sbjct: 192 VNLN--YEDQGIDIDYLSNLLNNWKEGPYKHLSKPKILYTISTGQNPMGMTLSMEKREKI 249

Query: 260 FQIAAKYGIVVLADEVY 276
           +QIA ++ +++L D+ Y
Sbjct: 250 YQIAQQHDLIILEDDPY 266

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 61/131 (46%), Gaps = 5/131 (3%)

Query: 155 EDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAW 214
           E++ +TTGA       L+ L   P   V++  P +  Y   + L    +    +   +  
Sbjct: 130 ENVQVTTGANEGIFACLAGLV-NPGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAEL 188

Query: 215 STNTTEIEKLVLD--SIKKGI--KPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVV 270
           S   TE  + V+D   +++ I  K   +++ +P NP G V +   + K+  I  + GI +
Sbjct: 189 SKRVTEGTEWVIDYDMLRQTINEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYI 248

Query: 271 LADEVYQENIF 281
           ++DEVY+   F
Sbjct: 249 ISDEVYEHLYF 259

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 6/124 (4%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTM--IPYYLDEESA 213
           DI  TTG+T      L + C     G  + + +Y   ++  A +   +  IP  LD E  
Sbjct: 132 DIITTTGSTQGWDASLRIFC---NKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEGI 188

Query: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLA 272
                 E+     D       P ++  I  G NPTG  LS+     I+ +A KY ++++ 
Sbjct: 189 IPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIE 248

Query: 273 DEVY 276
           DE Y
Sbjct: 249 DEPY 252

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 150 EPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI--PYY 207
           +P   +++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++  P  
Sbjct: 83  KPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 208 LDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYG 267
           + + S        +  L  D + K     +I V +PGNPTGA +    I KI Q   + G
Sbjct: 143 VSDNSFQMDTEAALTILKNDPLIK-----LIFVTSPGNPTGAKIKTCLIEKILQ-NWENG 196

Query: 268 IVVLADEVY 276
           +VV+ DE Y
Sbjct: 197 LVVV-DEAY 204

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 74/357 (20%), Positives = 143/357 (40%), Gaps = 60/357 (16%)

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPE-----DIFLTTGATSAA-SYLLSVLCRGPQ 179
           YS ++G   + K+  ++ +      P Y E     ++ +TTGA     + L+ +L  G +
Sbjct: 88  YSPTRGRPSLLKSLTDFYS------PIYNETLNESNVTITTGANEGILASLVGLLNPGDE 141

Query: 180 TGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGI--KPSV 237
             V  P     +    +   K   +P    +E +         K+  D + K I  +   
Sbjct: 142 VIVFEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTKC 201

Query: 238 IVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQ 297
           I++  P NP G V +   + ++  I  K  I +++DEVY E+++ G +F     + +   
Sbjct: 202 IILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISK--- 257

Query: 298 KQYPGKFDNIQLASMHSTSKGVFGECGQRGGYM-----ELVGFTDEVRQLLLKLACLAVC 352
                +  ++ L S+ S  K  F   G R G++     EL+ +  +    +    C +  
Sbjct: 258 -----EIGDLTL-SVGSAGKS-FAATGWRIGWVVSRNAELLSYVSKAHTRI----CFSSP 306

Query: 353 SVVTGQAMVDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAM----FDKLDGIEC 408
           S              P +   ++ +D       F+ M E  ++ +A+    FD+L G+  
Sbjct: 307 S--------------PFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDEL-GLPY 351

Query: 409 QKPQGAMYLYPSLILSKKAIAKA----ESLNLTPDEF-YCHELLDATGICTVPGSGF 460
            KP G  ++   +  SK  I         LN    +F   + L++  G+  +P + F
Sbjct: 352 TKPDGTYFV--CVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVAIPPTEF 406

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+  TTG T+A    L V C     G +I + +   ++++LA  ++  I  +     A  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 216 TNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
               ++E L+ +  +   KP ++  I  G NPTG+ L+     +I++IA K+  +++ DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 275 VY 276
            Y
Sbjct: 248 PY 249

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 155 EDIFLTTGATSAA-SYLLSVLCRGPQTGVLIP-----IPQYPLYTATLA---LNKSTMIP 205
           E++ +TTGA     S L+ +L  G +  V  P     IP   L    +    +N    + 
Sbjct: 123 ENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMD 182

Query: 206 YYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAK 265
             + E   W+ +  E+ K      K       +++  P NP G V ++  + KI  +  +
Sbjct: 183 QRIVEGKDWTIDYEELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTKIGNLCVE 236

Query: 266 YGIVVLADEVYQ 277
             +V+++DEVY+
Sbjct: 237 NNVVIISDEVYE 248

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 75/337 (22%), Positives = 127/337 (37%), Gaps = 48/337 (14%)

Query: 155 EDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAW 214
           E+I +TTGA  A    L  L + P   V++  P +  Y   + +    +    L   +  
Sbjct: 99  ENILVTTGAIQALLESLMALIK-PGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQG 157

Query: 215 STNTTEIEKLVLD--SIKKGI--KPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVV 270
                E    +LD  +++     K  ++++ NP NP G V +   + ++  +    G  +
Sbjct: 158 KKRILEANDWILDRETLRAAFTDKTKLMIINNPNNPLGKVFNRDELLEMATLCVNNGAYI 217

Query: 271 LADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRGGYM 330
           +ADEVY+   F          +   + ++       I + S    +  +F   G R G+M
Sbjct: 218 IADEVYEFLQFTPNPLSRISNLSEAIAQK------TITIGS----AGKIFRVTGWRVGWM 267

Query: 331 ELVGFTDEVRQLLLKLACLAV----CSVVTGQAMVDLMLLPPKKGDASYELDKKERQEIF 386
                  + R+L+ K+  + V    CS    Q    L +   +  +  Y L        F
Sbjct: 268 -----ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGI--QRALECGYFLSMPNE---F 317

Query: 387 DAMYERARKLYAMFDKLD--GIECQKPQGAMYLYPSLILSKKAIAKAESL-----NLTPD 439
           D      RK   ++  LD  G+   KPQGA ++      SK  I +         N   D
Sbjct: 318 D------RKFSIIYKALDYLGVSYTKPQGAHFIITD--FSKVKIPEDYQFPEYLKNRARD 369

Query: 440 EFYCHELLDATGICTVPGSGF----GQKKGTYHLRTT 472
            F  + L     I  +P S F     +K    +LR T
Sbjct: 370 FFISYWLTQEFCILLLPCSEFYCEEHRKNSETYLRIT 406

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 11/125 (8%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS--TMIPYYLDEESA 213
           ++  TTG T +    L + C     G  I   QY   ++  A       + P  LD +  
Sbjct: 135 NVLATTGNTGSWESTLRIFC---NRGDTILAEQYTFSSSVYAAEAQGINVFPVPLDADGL 191

Query: 214 WSTNTTEIEKLVLDSIKKGI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVL 271
                 E  + +LD+      KP ++  I  G NPTG+ LS+    +I++IA K+ ++++
Sbjct: 192 ----IPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLII 247

Query: 272 ADEVY 276
            DE Y
Sbjct: 248 EDEPY 252

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 7/123 (5%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D  LTTG T+     L + C      +L     +    A+         P  +D +    
Sbjct: 132 DSILTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDSDGI-- 188

Query: 216 TNTTEIEKLVLDSIKKGI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLAD 273
               E  + +LD+   G  KP ++  I  G NPTG+ LS+     I++IA K+  +++ D
Sbjct: 189 --IPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIED 246

Query: 274 EVY 276
           E Y
Sbjct: 247 EPY 249

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 7/126 (5%)

Query: 161 TGATSAA-SYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTT 219
           TGA  A  S L+ +L  G +  V  P   +  Y   + L+   ++   +       T  T
Sbjct: 113 TGANEAIFSILIGLLNPGDEVIVFEPF--FDQYIPNIELSGGKVVYVPITPPKNLDTRVT 170

Query: 220 EIEKLVLD--SIKKGI--KPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEV 275
           + E+  +D  S++  +  K   I++  P NP G V +E  + ++  I  K  +V+++DEV
Sbjct: 171 KGEEWQIDWDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEV 230

Query: 276 YQENIF 281
           Y+   F
Sbjct: 231 YEHLYF 236

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 12/160 (7%)

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIP 185
           YS +QG+  I     + I       P    D+ L  G++ +   L   L     T VL+ 
Sbjct: 112 YSQTQGLAPILD-FLKLIVANCNNPPYQNWDLLLANGSSDSMFKLFDTLT-DETTTVLVE 169

Query: 186 IPQYPLYTATLALNKSTMIPYYLDEESAWST---NTTEIEKLVLDSIKKGI-----KPSV 237
              +    + +    ++ +P  L+  S  S    N T ++ L L++ + G      +PS+
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHL-LENWQSGPYKHLNRPSI 228

Query: 238 IVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           +  I+ G NPTG  +S    A+I+++A KY  +++ D+ Y
Sbjct: 229 LYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 24/133 (18%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYP----------LYTATLALNKSTMIP 205
           DI  TTG+T      L + C    T VL+    Y           L    + L+   ++P
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 206 YYLDEESA-WSTNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIA 263
             L+E  A WS+   E+             P ++  I  G NPTG  LS+     I+++A
Sbjct: 191 SKLEEMLANWSSLYGEMPM-----------PKLLYTIPTGQNPTGCTLSDNRKPHIYRLA 239

Query: 264 AKYGIVVLADEVY 276
            +Y I+++ D+ Y
Sbjct: 240 QQYDIIIIEDDPY 252

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 227 DSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           D  KK  +  + +V    NPTGA+ S  +  K+ ++A KY I++++D+VY
Sbjct: 180 DGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 82/181 (45%), Gaps = 27/181 (14%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPY-YLD 209
           P   E+  L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++    + 
Sbjct: 83  PLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLIT 142

Query: 210 EESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKY--G 267
           E++++  + TEI    L+ +       ++ + +PGNPTGA   ++ I +I  +   +  G
Sbjct: 143 EDNSFQIDATEI----LNILANDPLIKLVFITSPGNPTGA---KIEIDRIEYLLKNWDQG 195

Query: 268 IVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFGECGQRG 327
           +V++ DE Y +  F G    ST      L  +YP       L ++ + SK  FG  G R 
Sbjct: 196 LVIV-DEAYID--FSG---GSTAP----LVTKYP------NLVTLQTLSKS-FGLAGIRL 238

Query: 328 G 328
           G
Sbjct: 239 G 239

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 150 EPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLD 209
           +P   +++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++   L 
Sbjct: 83  KPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLT 142

Query: 210 EESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
                    TE    VL  +K      ++ V +PGNPTGA +    I K+ Q     G+V
Sbjct: 143 VSDGSFQMDTEA---VLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLV 198

Query: 270 VLADEVY 276
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 21/149 (14%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS---TMIPYYLDEES 212
           D+  T G T+A    L V C     G +I + +   +++ LA  ++   T  P  +D++ 
Sbjct: 133 DVVATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 213 AWSTNTTEIEKLVLDSIKKGI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVV 270
                     + +LD+   G  KP ++  I  G NPTG  L++    +IF+IA K+  ++
Sbjct: 189 IIPAKL----EAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLI 244

Query: 271 LADEVYQENIFDGVQFHSTKKVLRGLQKQ 299
           + D  Y         F    K  R LQK+
Sbjct: 245 IEDAPY--------YFLQMDKYERDLQKR 265

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 23/189 (12%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS--TMIPYYLDEESA 213
           D+  T G T +    L + C     G  I   +Y   ++  A       + P  LD +  
Sbjct: 135 DVLATIGNTGSWESTLRIFC---NRGDTILAEKYTFSSSVYAAEAQGVNVFPVPLDADGL 191

Query: 214 WSTNTTEIEKLVLDSIK-KGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVL 271
                 E  + +LD+   +  KP ++  I  G NPTG+ LS+    +I++IA K+  +++
Sbjct: 192 ----IPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIII 247

Query: 272 ADEVY---QENIFD-------GVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVFG 321
            DE Y   Q + ++        ++F S  + +  L K +       ++  M S SK V G
Sbjct: 248 EDEPYYFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSK-VLG 306

Query: 322 ECGQRGGYM 330
             G R G++
Sbjct: 307 P-GTRLGWL 314

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 71/162 (43%), Gaps = 14/162 (8%)

Query: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPED---IFLTTGATSAASYLLSVLCRGPQTGV 182
           Y+   G+  IR  A   + K +  +P+Y  D   + L++G+  +        C    T +
Sbjct: 125 YNEVPGLPQIRNFAKYLVNKIN--KPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVL 182

Query: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKL--VLDSIKKGI-----KP 235
           +      P+ +   A   +  IP  ++     ST   +++ L  +LD+   G      KP
Sbjct: 183 MEEFTFTPVISHVKATG-AECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKP 241

Query: 236 SVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
            ++  I  G NPTG  +      KI+++A K+  ++L D+ Y
Sbjct: 242 RILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 17/128 (13%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS---TMIPYYLDEES 212
           DI  T G T+A    L V C     G +I + +   +++ LA  ++   T  P  +D+  
Sbjct: 133 DIIATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSCLAAAQAQGITTFPIPIDD-- 186

Query: 213 AWSTNTTEIEKL--VLDSIKKGI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGI 268
               N    EKL  +LD+   G  KP ++  I  G NPTG  L    + +I++IA K+  
Sbjct: 187 ----NGIIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDF 242

Query: 269 VVLADEVY 276
           +++ D  Y
Sbjct: 243 LIVEDAPY 250

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 150 EPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLD 209
           +P   +++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++   L 
Sbjct: 83  KPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 210 -EESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGI 268
             ++++  NT    + VL  +       ++   +PGNPTGA +    I ++ Q     GI
Sbjct: 143 VSDNSFQMNT----EAVLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGI 197

Query: 269 VVLADEVY 276
           VV+ DE Y
Sbjct: 198 VVV-DEAY 204

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 230 KKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           KK  +  + +V    NPTGA+ S  +  K+ ++A KY I++++D+VY
Sbjct: 184 KKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 9/124 (7%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKS--TMIPYYLDEESA 213
           ++  + G T+A    L + C     G ++   +Y   +   A      T IP  +D   A
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYSFSSCLAACEAQGVTTIPIPID---A 184

Query: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLA 272
           +     ++E L+ +      KP ++  I  G NPTG  L       I++IA K+  +++ 
Sbjct: 185 FGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVE 244

Query: 273 DEVY 276
           DE Y
Sbjct: 245 DEPY 248

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTM--IPYYLDEESA 213
           D+  T G TSA    L V C     G  I   +Y   ++ +A     +   P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFC---NRGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDE--- 185

Query: 214 WSTNTTEIEKL--VLDSIKK---GI-KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKY 266
              N    E+L  +LD+ ++   G+ +P ++  +  G NPTG  LS      ++++A ++
Sbjct: 186 ---NGMVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQH 242

Query: 267 GIVVLADEVY 276
            ++++ DE Y
Sbjct: 243 DLLIVEDEPY 252

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 9/129 (6%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+ L+ G+  +   +   +C    T V+I    +    + +    + +IP  +D      
Sbjct: 136 DVILSGGSNDSMFKVFETIC-DESTTVMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRE 194

Query: 216 TNTTEIEKL--VLDSIKKGI-----KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYG 267
               ++E L  +LD+   G      KP V+  I  G NPTG  +      KI+Q+A K+ 
Sbjct: 195 RQGIDVEDLTRLLDNWSTGPYKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHD 254

Query: 268 IVVLADEVY 276
            +++ D+ Y
Sbjct: 255 FLIVEDDPY 263

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 156 DIFLTTGATSAASYLLSVLC-RGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAW 214
           D+  T G T+A    L V C RG    +L+    +    A+         P  +D +   
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRG--DVILVEAHSFSSSLASAEAQGVITFPVPIDADG-- 189

Query: 215 STNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLAD 273
                ++ K++ +      KP ++  I  G NPTG  +++     I++IA KY  +++ D
Sbjct: 190 -IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVED 248

Query: 274 EVY 276
           E Y
Sbjct: 249 EPY 251

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 94/226 (41%), Gaps = 37/226 (16%)

Query: 227 DSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQF 286
           D  KK  +  + +V    NP+GA  S+    K+  +A +Y I++++D+VY     D + F
Sbjct: 182 DDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY-----DLLGF 236

Query: 287 HSTKKVLRGLQKQYPGKFDNIQLASMH----STSKGVFGEC--------GQRGGYMELVG 334
           H  ++   G++K  P  F   QL  +     +T       C        G R GY E   
Sbjct: 237 HG-QRTDSGIRK--PSHFRFPQLDRITVPAGNTHGNTISNCTFSKIIAPGLRTGYQETAN 293

Query: 335 FTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASYELDKKERQEIFDAMYERAR 394
             +   QL L  A ++  +     +M+   ++  K G     + +     + D   ERAR
Sbjct: 294 -ENLANQLSLGGANISGGTPAQLNSMIIATMI--KSGAVGRIVAR-----LTDVYAERAR 345

Query: 395 KLYAMFDKL--DGIECQKPQGAMYLYPSL-------ILSKKAIAKA 431
            L A        G +C   +G  + + +L       +++++A AK 
Sbjct: 346 VLEASIKAYLPPGTQCTPCEGGYFSWCTLPPGYNSKLIAERASAKG 391

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDE 210
           P   E++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++   L  
Sbjct: 85  PLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPL-- 142

Query: 211 ESAWSTNTTEIE-KLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIV 269
              +  N+ +++ + VL  ++      ++ + +PGNPTGA +    I  + Q     G+V
Sbjct: 143 --LYKNNSFQMDTESVLTVLQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD-GLV 199

Query: 270 VLADEVY 276
           V+ DE Y
Sbjct: 200 VV-DEAY 205

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 234 KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           KP+V+  I  G NPTG  LS     KI++I  K+ I+++ D+ Y
Sbjct: 208 KPTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+ L+ G+  +   +    C    T V+I    +    + +    +T++P  ++  +   
Sbjct: 184 DVILSGGSNDSMYKVFETFC-DESTTVMIEEFTFTPAVSNVEATGATVVPIKINLSADRE 242

Query: 216 TNTTEIEKL--VLDSIKKGI-----KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYG 267
           T + +++ L  +L++   G      KP V+  I  G NPTG  + +    KI+++A ++ 
Sbjct: 243 TQSVDVDYLSQLLENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHD 302

Query: 268 IVVLADEVY 276
            +++ D+ Y
Sbjct: 303 FLIVEDDPY 311

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 9/128 (7%)

Query: 151 PSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI--PYYL 208
           P   +++ L  G+  +   ++   C   +  +L   P Y +Y+    +N   ++  P   
Sbjct: 83  PLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIY 142

Query: 209 DEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGI 268
           ++ S    +   I  L  D + K     ++ + +PGNPTGA +    I KI +  +  G 
Sbjct: 143 EDNSFQPDSQKVISILSSDPLIK-----LVFLTSPGNPTGAKIDSNIIIKILE--SWDGG 195

Query: 269 VVLADEVY 276
            V+ DE Y
Sbjct: 196 FVVVDEAY 203

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 234 KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           KP ++  I  G NPTG  LS     KI++I  K+ I++L D+ Y
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+F T G T+A    L + C     G +I + +   ++++LA  ++  +  +     A  
Sbjct: 134 DVFATAGNTNAWESTLRLFC---NRGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 216 TNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
               ++ K++ +      KP ++  I  G NPTG  ++      I++IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 275 VY 276
            Y
Sbjct: 250 PY 251

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 155 EDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAW 214
           +++ L  G+  +   ++   C   +  +L+  P Y +Y+    +N   ++   L      
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPL----VV 143

Query: 215 STNTTEIE-KLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLAD 273
           S N+ +++ + VL  ++      ++ V +PGNPTGA +    I ++ Q   + G+VV+ D
Sbjct: 144 SDNSFQMDVEAVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV-D 201

Query: 274 EVY 276
           E Y
Sbjct: 202 EAY 204

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+  T G+T A    L + C   +T VL+    Y              +   +D++    
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKV 186

Query: 216 TNTTEIEKLVLDSIKKGIKPSVIVVI-NPGNPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
              +E+ +   D   +G  P ++  I N  NPTG  L E    ++ ++A++Y  +++ D+
Sbjct: 187 DKLSEMLR-DWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDD 245

Query: 275 VY 276
            Y
Sbjct: 246 PY 247

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+ L+ G+  +   +   +C    T V+I    +    + +    + +IP  ++      
Sbjct: 136 DVILSGGSNDSMFKVFETIC-DESTTVMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRE 194

Query: 216 TNTTEIEKL--VLDSIKKGI-----KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYG 267
           +   ++E L  +LD+   G      KP V+  I  G NPTG  + +    KI+Q+A ++ 
Sbjct: 195 SQGIDVEYLTQLLDNWSTGPYKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHD 254

Query: 268 IVVLADEVY 276
            +++ D+ Y
Sbjct: 255 FLIVEDDPY 263

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 230 KKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           KK  K  +  +    NPTG   S     K+ +IA KY ++++AD+VY
Sbjct: 187 KKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 77/358 (21%), Positives = 140/358 (39%), Gaps = 74/358 (20%)

Query: 125 AYSASQGVYGIRKTAAEYITK------RDGGEPSYPEDIFLTTGATSAASYLLSVLCRG- 177
            Y +++G   +R    E++ +      RD    S PE + LT+GA+     +L++L +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYG---VLNILLQAT 106

Query: 178 -PQTGV----LIPIPQYPLY----------------------TATLALNKSTMIPYYLDE 210
            P TGV     I  P Y L                       +  L L ++ +  +   +
Sbjct: 107 LPHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESID 166

Query: 211 ESAWSTNTTEI----EKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKY 266
            +  + N  E+      + +  +KK  K  + V+    NP+G   +     K+ ++A KY
Sbjct: 167 PNPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKY 226

Query: 267 GIVVLADEVYQ------ENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHSTSKGVF 320
            ++++ D+VY        N  D  +  +  K    + ++     +N + +  ++ S   F
Sbjct: 227 DMLIITDDVYDLLNYSINNDPDKFELPTPIKRFVHIDRET----NNDESSYGNTVSNASF 282

Query: 321 GEC---GQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTG-----QAMVDLMLLPPKKGD 372
            +    G R GY E       + +LL         +V  G      +M+   LL    GD
Sbjct: 283 SKIIAPGLRFGYHE------SINKLLATQLSAGGANVSGGTPSQLTSMIVGTLL--TNGD 334

Query: 373 ASYELDKKERQEIFDAMYERARKLY-AMFDKL-DGIECQKPQGAMYLYPSLILSKKAI 428
           A     +K  + +     ERA  +Y AM   L  G E +K +G  + +  L  S  A+
Sbjct: 335 A-----EKILRNLIQTYCERADAMYNAMIKYLPKGTEIRKTEGGYFNWMKLTESYNAL 387

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+  T G T+A    L V C     G +I + +   ++++LA  ++  I  +     A  
Sbjct: 134 DVVATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDADG 189

Query: 216 TNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
               ++ K++ +      KP ++  I  G NPTG  +++     I++IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDE 249

Query: 275 VY 276
            Y
Sbjct: 250 PY 251

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+ L+ G+  +   +   +C    T VLI    +    + +    + ++P  ++      
Sbjct: 136 DVILSGGSNDSMFKVFETIC-DESTTVLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRD 194

Query: 216 TNTTEIEKL--VLDSIKKG-----IKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYG 267
           +   +++ L  +LD+   G      KP V+  I  G NPTG  + +    KI+++A K+ 
Sbjct: 195 SQGIDVDHLTQLLDNWSTGPYKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHD 254

Query: 268 IVVLADEVY 276
            +++ D+ Y
Sbjct: 255 FLIVEDDPY 263

>TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON}
           Anc_5.287 YHR045W
          Length = 621

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 290 KKVLRGLQKQYPGKFDNIQLA-SMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLK 345
           KK++  +QK +   FDN +L  +    S G+F +CG+R        FTD +R + L+
Sbjct: 405 KKIIDHIQKSHTNIFDNFRLNWATLLFSYGIFSKCGERQS-----RFTDNLRCIYLE 456

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215
           D+  T G T+     L V C     G +I + +   ++++LA  ++  +  +     A  
Sbjct: 134 DVLATAGNTNGWESTLRVFC---NRGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 216 TNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADE 274
               ++ K++ +      KP ++  I  G NPTG  +++     I++IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 275 VY 276
            Y
Sbjct: 250 PY 251

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMI-PYYLDEESAW 214
           ++  TTG T+A    L V C   +  V++        + + A  +  ++ P  +D +   
Sbjct: 131 NVVATTGNTNAWESTLRVFCN--RGDVILAEAHSFSSSLSSAEAQGVIVFPIPIDADG-- 186

Query: 215 STNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLAD 273
                ++EK++ +      +P ++  I  G NPTG  L++    +I++IA K+  +++ D
Sbjct: 187 -IIPEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIED 245

Query: 274 EVY 276
           E Y
Sbjct: 246 EPY 248

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 24/133 (18%)

Query: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYP----------LYTATLALNKSTMIP 205
           D+ +T G+T A    L + C  P   VL+    Y           +Y   + ++   ++P
Sbjct: 129 DVLITAGSTQAWDASLRLFC-NPGDSVLLESWTYSSSVEAAEAQGMYCVGVEIDGHGVVP 187

Query: 206 YYLDEESAWSTNTTEIEKLVLDSIKKGIK-PSVIVVINPG-NPTGAVLSELAIAKIFQIA 263
               E+  W            D +  G   P ++ VI  G NP G  L++     I+ I 
Sbjct: 188 ----EKLEWLLQN-------WDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNII 236

Query: 264 AKYGIVVLADEVY 276
            KY +V++ D+ Y
Sbjct: 237 QKYDMVLIEDDPY 249

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 52  PHCLPFDEITVANIGNPQELNQKPLTFARQVVS--ILQYPELLNNRDVLTKEKIFNSDSF 109
           P  L FDEI+ A  GNP+    + L F   + S   L  P  +    +L   KI   D  
Sbjct: 390 PPVLAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLL---KIMTGDLT 446

Query: 110 DRAERLLRDIGGSVGAYSA-SQGVYGIRKTAAEYITKR 146
            +A R+ R     +G YS  SQ    + K+A E++ ++
Sbjct: 447 PQAGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVREK 484

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 234 KPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           KP ++  I  G NPTG+ L     +++++IA K+  +++ DE Y
Sbjct: 206 KPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>SAKL0E04268g Chr5 complement(338322..339587) [1266 bp, 421 aa] {ON}
           highly similar to uniprot|P23542 Saccharomyces
           cerevisiae YLR027C AAT2 Cytosolic aspartate
           aminotransferase involved in nitrogen metabolism
           localizes to peroxisomes in oleate-grown cells
          Length = 421

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 71/180 (39%), Gaps = 21/180 (11%)

Query: 108 SFDRAERLLRDIGGSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLT------T 161
           S   AE+L+R+       Y    G+  +   AA  I   D   P+  E   ++      T
Sbjct: 53  SVHEAEKLIREDPSYNHEYLGIAGLTSLISGAANVILGED--SPALQEQRVVSVQSLSGT 110

Query: 162 GATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALN--KSTMIPYYLDEESAWSTNTT 219
           GA   A+  L+  C   +  V +  P +  +TA       K+   PY       W+  T 
Sbjct: 111 GALHIAAKFLNKFCS--EKVVYLSQPTWANHTAIFETQGLKTATYPY-------WNAATK 161

Query: 220 EIE-KLVLDSIKKGIKPSVIVV-INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQ 277
            ++ +  L++IK   K SV V+     NPTG   S+     I     K   +VL D  YQ
Sbjct: 162 SLDLEGYLNAIKDAPKGSVFVLHACAHNPTGLDPSKEQWVDILDALVKGDHIVLFDSAYQ 221

>Smik_16.318 Chr16 complement(569893..571935) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 468 HLRTTFLAPGIEWINKWEKFHKHFYEKY 495
           H + T L PG+E  NKW K    + +KY
Sbjct: 296 HYQKTILKPGVEANNKWNKLFSEYQKKY 323

>Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 468 HLRTTFLAPGIEWINKWEKFHKHFYEKY 495
           H + T L PG+E  NKW K    + +KY
Sbjct: 296 HYQKTILKPGVEANNKWNKLFSEYQKKY 323

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 230 KKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFD 282
           KK  +  + +V    NP+G   S     K+ ++A KY I++++D+VY   ++D
Sbjct: 184 KKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYD 236

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 69/179 (38%), Gaps = 30/179 (16%)

Query: 125 AYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRG--PQTG- 181
            Y + +G   +R+     I +      S PE I LT+GA+     +L++L +   P TG 
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYG---ILNILLQTTLPHTGY 106

Query: 182 ---VLIPIPQYPL---------------------YTATLALNKSTMIPYYLDEESAWSTN 217
                I  P Y L                     YT+         + Y+  E      N
Sbjct: 107 TKQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQN 166

Query: 218 TTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           +T+I +   +  KK  K     +    NP+G         ++ +IA KY ++++ D+VY
Sbjct: 167 STDIIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 69/163 (42%), Gaps = 18/163 (11%)

Query: 126 YSASQG---VYGIRKTAAEYITKRDGGEPSYPE-DIFLTTGATSAASYLLSVLCRGPQTG 181
           YS ++G   +    K    Y+ K     P+Y   D+ L  G++ + S + + L     T 
Sbjct: 131 YSDTKGFPQLIDFSKKLVSYLNK-----PAYDNWDVMLANGSSDSLSKVFTTLTDEDVT- 184

Query: 182 VLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKL--VLDSIKKG-----IK 234
           VL+    +    + +  N    IP  +D     S     +E +  +L++   G      K
Sbjct: 185 VLMEEFTFTPTISNVTANGGIPIPLKVDITDDASQQGINVEYMDQLLENWSTGEYSHLSK 244

Query: 235 PSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLADEVY 276
           P ++  I  G NPTG    +    KI+ +  K+ I+++ D+ Y
Sbjct: 245 PRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,995,453
Number of extensions: 2275198
Number of successful extensions: 6115
Number of sequences better than 10.0: 133
Number of HSP's gapped: 6237
Number of HSP's successfully gapped: 133
Length of query: 497
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 383
Effective length of database: 40,409,475
Effective search space: 15476828925
Effective search space used: 15476828925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)