Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038308.265ON32531112321e-171
Suva_2.2738.265ON3762302521e-23
YDR113C (PDS1)8.265ON3731852466e-23
Smik_4.3588.265ON3712302318e-21
Skud_4.3748.265ON3731892113e-18
NDAI0J013508.265ON4221512062e-17
TDEL0F039208.265ON3223231929e-16
ZYRO0C01584g8.265ON2822631643e-12
SAKL0H16962g8.265ON3361881645e-12
KLLA0F19206g8.265ON2632151323e-08
Kwal_56.237818.265ON2932661307e-08
KLTH0G13618g8.265ON3022561272e-07
Kpol_543.418.265ON3061691174e-06
CAGL0L12298g8.265ON286861165e-06
AGR083W8.265ON295299940.002
TPHA0A017808.265ON35243810.11
Ecym_43058.265ON31144770.35
NOTE: 3 genes in the same pillar as NCAS0B03830 were not hit in these BLAST results
LIST: TBLA0E04460 KAFR0B05510 KNAG0H03230

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03830
         (325 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...   479   e-171
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   101   1e-23
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    99   6e-23
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    94   8e-21
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    86   3e-18
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    84   2e-17
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    79   9e-16
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    68   3e-12
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    68   5e-12
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    55   3e-08
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    55   7e-08
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    54   2e-07
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    50   4e-06
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    49   5e-06
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    41   0.002
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    36   0.11 
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    34   0.35 

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score =  479 bits (1232), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/311 (79%), Positives = 248/311 (79%)

Query: 1   MSLDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNIS 60
           MSLDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNIS
Sbjct: 1   MSLDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNIS 60

Query: 61  PXXXXXXXXXXXXPLAKKDNNNSSFSSRXXXXXXXXXXXXYGSVLGMDALPRTKSLILKX 120
           P            PLAKKDNNNSSFSSR            YGSVLGMDALPRTKSLILK 
Sbjct: 61  PRRRQLLQLQNRLPLAKKDNNNSSFSSRKNGLNNIKKLKKYGSVLGMDALPRTKSLILKD 120

Query: 121 XXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXXXXXXXGMSGLGIGLFHDNEDNSKSKLG 180
                         NAFGLKLRNAMKQH          GMSGLGIGLFHDNEDNSKSKLG
Sbjct: 121 VDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNEDNSKSKLG 180

Query: 181 GLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDI 240
           GLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDI
Sbjct: 181 GLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDI 240

Query: 241 NKLKTFHSSYKLDSPVSTVEDADKLLALETIETSVDDXXXXXXXXXXXXXXPTRDSNDDS 300
           NKLKTFHSSYKLDSPVSTVEDADKLLALETIETSVDD              PTRDSNDDS
Sbjct: 241 NKLKTFHSSYKLDSPVSTVEDADKLLALETIETSVDDEAEWEHEVRHHRRRPTRDSNDDS 300

Query: 301 IDLVPLYNGEG 311
           IDLVPLYNGEG
Sbjct: 301 IDLVPLYNGEG 311

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  101 bits (252), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 102/230 (44%), Gaps = 40/230 (17%)

Query: 101 YGSVLGMDALPRTKSLILK-------XXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXX 153
           YGSVLG +ALP+ KSL+LK                      N    KL++A  Q      
Sbjct: 157 YGSVLGYNALPKMKSLVLKDLADPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSED 216

Query: 154 XXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDR 213
                G    GIGLF++         GGLQQLI+   K +       P K  G D D   
Sbjct: 217 EHEFSG----GIGLFNNQ--------GGLQQLIKNTAKGK-----EGPGKEDGDDHD--- 256

Query: 214 EIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLD--SPVSTVEDADKLLALETI 271
            IE AP R+EPLP+VP GY PF  EDI KLKTF+S Y LD     +    ADK+  L  +
Sbjct: 257 -IEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLV 315

Query: 272 ETSVDDXXXXXXXXXXXXXXPT------RDSNDDSIDLVP----LYNGEG 311
           E + +D              P       ++S DD    +P    LYNGEG
Sbjct: 316 EVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESLYNGEG 365

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query: 5  TNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP 47
           NEDKEN   Y  +  S   S   P+TPAH LLKRS S VLKP
Sbjct: 3  ANEDKENNIVYTGNESS---STSFPQTPAH-LLKRSHSNVLKP 41

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 99.4 bits (246), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 93/185 (50%), Gaps = 36/185 (19%)

Query: 101 YGSVLGMDALPRTKSLILK-------XXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXX 153
           YGSVLG +ALP+ KSL+LK                      +  G KL++A+ +      
Sbjct: 156 YGSVLGYNALPKMKSLVLKDLADSGKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDG 215

Query: 154 XXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDR 213
                G    G+GLF++         GGLQQLI+ +TK    +K     KT       D 
Sbjct: 216 ENELNG----GLGLFNEQ--------GGLQQLIKNSTKNEQKTKNDKSDKT------DDY 257

Query: 214 EIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDAD------KLLA 267
           +IE AP R+EPLP+VP GY+PF  +DI KLKTF+S YKLD     +ED D       LL 
Sbjct: 258 DIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLD-----LEDEDDTPDKVDLLP 312

Query: 268 LETIE 272
           LE I+
Sbjct: 313 LEQID 317

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 5  TNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP 47
           NEDKEN   Y  +  S       P+TPAH LLKRS S +LKP
Sbjct: 4  ANEDKENNIVYTGNESSGIN---FPQTPAH-LLKRSHSNILKP 42

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 93.6 bits (231), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 102/230 (44%), Gaps = 45/230 (19%)

Query: 101 YGSVLGMDALPRTKSLILK-------XXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXX 153
           YGSVLG +ALP+ KSL+LK                      N    KL+NA+ Q      
Sbjct: 157 YGSVLGYNALPKMKSLVLKDLVDPGKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDD 216

Query: 154 XXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDR 213
                G     IGLF++         GGLQQLI+ + +  S SK          D     
Sbjct: 217 EHEFSG----DIGLFNNQ--------GGLQQLIKNSVQNESKSK---------SDNADGY 255

Query: 214 EIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVED----ADK--LLA 267
           EIE AP R +PLP+VP GY+PF  EDI KLK+F+S Y+LD     +ED     DK  LL 
Sbjct: 256 EIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD-----LEDDGGSTDKVDLLP 310

Query: 268 LETI--ETSVDDXXXXXXXXXXXXXXPTRDSNDDSIDLVP----LYNGEG 311
           LE I  E+  D+              P    N   I  +P    L NGEG
Sbjct: 311 LEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIESLCNGEG 360

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 5  TNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP 47
           NEDKEN   Y  +  S       P+TPAH LLKRS S VLKP
Sbjct: 3  ANEDKENNIVYSGNGSSNLN---FPQTPAH-LLKRSHSNVLKP 41

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 85.9 bits (211), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 93/189 (49%), Gaps = 37/189 (19%)

Query: 101 YGSVLGMDALPRTKSLILKXXXXXXXXXXXXXXXNA-------FGLKLRNAMKQHXXXXX 153
           YGSVLG +ALP+ KSL+LK               +         G+KL+NA  Q      
Sbjct: 157 YGSVLGYNALPKMKSLVLKDLAGPAKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDD 216

Query: 154 XXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDR 213
                G     IGLF++         GGLQQLI+  TK +  SK          D D D 
Sbjct: 217 EHESNG----DIGLFNNQ--------GGLQQLIKNTTKGKQGSKEED-------DDDDDY 257

Query: 214 EIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVED----ADK--LLA 267
           EIE AP R+EPLP+VP GY  F  EDI KL+TF+S Y+LD     +ED     D+  LL+
Sbjct: 258 EIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELD-----LEDHGDSVDRVGLLS 312

Query: 268 LETIETSVD 276
           LE I+   +
Sbjct: 313 LEVIDEEAE 321

 Score = 36.2 bits (82), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 5  TNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP 47
           NEDKEN   Y  +  S       P+TPAH LLKRS S VLKP
Sbjct: 3  ANEDKENNIVYTGNESSGIN---FPQTPAH-LLKRSHSNVLKP 41

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 84/151 (55%), Gaps = 27/151 (17%)

Query: 137 FGLKLRNAMKQHXXXXXXXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLI---RENTKER 193
           FGLKL++AM  +            SGL   LFHD+         GL QLI   ++N  E+
Sbjct: 208 FGLKLKHAMNNNNNNNNSDG----SGL---LFHDSNH-------GLHQLINFNKKNMPEK 253

Query: 194 STSKIRSPLKTIGQDT-DSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKL 252
           ++      L    +DT D + +IEYAPIRE+ LP++P GYTPFT EDINKLK +HS + +
Sbjct: 254 NSISQSVKLDNKKEDTYDEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAI 313

Query: 253 --------DSPVSTVEDADKLLALETIETSV 275
                    SP ST+ D + LL+L++ +T  
Sbjct: 314 HHDHSDYQQSP-STLGDPEMLLSLQSFDTQT 343

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 66/137 (48%), Gaps = 25/137 (18%)

Query: 6   NEDKENKTT-YESHVH-STKQSHLMPETPAHLLLKRSLSTV------LKPNSV--NATDE 55
           +EDKEN +T Y+ H H  + +  L P+TPAHLL KRS S +      +KP ++      +
Sbjct: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLL-KRSSSILSKQKPDIKPGNLELQLQSD 71

Query: 56  LG------NISPXXXXXXXXXXXXPLAKKDNNNSSFSSRXXXXXXXXXXXXYGSVLGM-- 107
            G      NISP            PL+KKDNNNS    +            YGSVLG+  
Sbjct: 72  AGAGAVPPNISPRRQLLQLQNRF-PLSKKDNNNSFILKQQQQQFDHKRLKKYGSVLGLGT 130

Query: 108 -----DALPRTKSLILK 119
                + L R KSL+LK
Sbjct: 131 DGNNHNNLTRIKSLVLK 147

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 78.6 bits (192), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 93/323 (28%), Positives = 122/323 (37%), Gaps = 74/323 (22%)

Query: 28  MPETPAHLLLKRSLSTVLKP----NSVNAT--DELGNISPXXXXXXXXXXXXPLAKKDNN 81
            P+TPAHLL KRS S ++KP    N  N T  D    +              PLA KDNN
Sbjct: 23  FPQTPAHLL-KRSQSAMMKPSGEENPSNLTYRDCDAPVKRASPSRRVQQGRPPLASKDNN 81

Query: 82  NS--------------------SFSSRXXXXXXX-------XXXXXYGSVLGMDALPRTK 114
            S                    S S +                   YGSVLG +ALP+ K
Sbjct: 82  RSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMK 141

Query: 115 SLILKXXXXX----XXXXXXXXXXNAFGLKLRNAMKQHXXXXXXXXXXGMSGLGIGLFHD 170
           SL+LK                   +   LKL NA+ +              G  +G   D
Sbjct: 142 SLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDRSDE----------EGEEVGGLFD 191

Query: 171 NEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPF 230
                     GL  L+R++ K+              +D   DREIEY P R EPLP++P 
Sbjct: 192 K--------SGLLHLVRDSKKD--------------EDDWEDREIEYGPQRHEPLPYIPE 229

Query: 231 GYTPFTPEDINKLKTFHSSYKLDSPVSTVED--ADKLLALETIETSVDDXXXXXXXXXXX 288
           G+     ED +KLKTF S Y ++   S  +D   D  L LE I ++ DD           
Sbjct: 230 GHLSLAQEDYDKLKTFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAGDDENIERENLTVK 289

Query: 289 XXXPTRDSNDDSIDLVPLYNGEG 311
                     D+ ++ P Y GEG
Sbjct: 290 QREML--PQYDTFEIQPSYCGEG 310

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 104/263 (39%), Gaps = 67/263 (25%)

Query: 28  MPETPAHLLLKRSLSTVLKPNSVNATDELGNISPXXXXXXXXXXXXPLAKKDNNNSSFSS 87
           +P+TP HLL KRS   VLKP       +  ++SP            PLA KD+N SS + 
Sbjct: 25  LPQTPIHLL-KRSQPNVLKPEENTPVKKSRSVSPVRGQRRL-----PLASKDHNKSSAAG 78

Query: 88  ---------RXXXXXXXXXXXXYGSVLGMDALPRTKSLILKXXXXXXXXXXXXXXXNAFG 138
                    +            YGSVLG   LPRTKSL+LK               +   
Sbjct: 79  PVKKRQPTLQGELLSNPRKLQKYGSVLGYTDLPRTKSLVLK--DGDDEDDDEEEENSELQ 136

Query: 139 LKLRNAMKQHXXXXXXXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKI 198
            KL++AM +                         ++S   LGGL +L+R           
Sbjct: 137 KKLQDAMNRR------------------------EDSNEGLGGLAKLVR----------- 161

Query: 199 RSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDS---- 254
                      D+  +IEYAP R  PL + P G+T +  EDI KLK      + D     
Sbjct: 162 -----------DTKDDIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHE 210

Query: 255 PVSTVEDADKLLALETIETSVDD 277
                E+ D LL L +IE++ +D
Sbjct: 211 DNEPQENDDGLLPLMSIESNNED 233

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 72/188 (38%), Gaps = 44/188 (23%)

Query: 101 YGSVLGMDALPRTKSLILKXXXXXXXXXX------------XXXXXNAFGLKLRNAMKQH 148
           YGSVLG + LPR KSL+LK                           N    KL  A+  H
Sbjct: 119 YGSVLGYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNH 178

Query: 149 XXXXXXXXXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQD 208
                     G+ G                  GLQQL++               + + + 
Sbjct: 179 NEDDKEEGSIGLLGSNT---------------GLQQLLKH--------------RNVEEG 209

Query: 209 TDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKL---DSPVSTVEDADKL 265
            +SD EIE  P   E LP VP GY+PF   D+ KL TF S + +   DS     +D D L
Sbjct: 210 ENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHKEDSDCEECDDYDGL 269

Query: 266 LALETIET 273
           L +  +++
Sbjct: 270 LTISMVKS 277

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 87/215 (40%), Gaps = 54/215 (25%)

Query: 101 YGSVLGMDA-LPRTKSLILKXXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXXXXXXXG 159
           YGSVLGM+  +PRTKSL+LK                   L +  + K             
Sbjct: 88  YGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGKS------------ 135

Query: 160 MSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAP 219
              LG G              GL+ LIRE   E +                    IEYAP
Sbjct: 136 -LNLGFG-------------NGLKALIREKEDELN--------------------IEYAP 161

Query: 220 IREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDAD-KLLALETIETSVDDX 278
            R++ LP++P GY PF  E I KL+   S ++++S     E+ D +L++L     + D+ 
Sbjct: 162 KRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISL----AATDED 217

Query: 279 XXXXXXXXXXXXXPTRDSNDDS--IDLVPLYNGEG 311
                           DS+++S  I+L   YNG+G
Sbjct: 218 LVSPTRYNNHKHNLELDSDNESITIELGEEYNGQG 252

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 90/266 (33%), Gaps = 74/266 (27%)

Query: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPX 62
           +   E+KEN    E  V         P TP HLL  RS S             + NISP 
Sbjct: 1   MGARENKENAIWSERSV---------PVTPTHLL-SRSQSF------------MKNISPK 38

Query: 63  XXXXXXXXXXXPLAKKDNNNSSF---SSRXXXXXXXXXXXXYGSVLG-----------MD 108
                      PLA KDNN S+    +               GS +G            +
Sbjct: 39  RAEQRK-----PLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTN 93

Query: 109 ALPRTKSLILK-----XXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXXXXXXXGMSGL 163
             PR KSL+LK                    N+   KLR  +                  
Sbjct: 94  GAPRIKSLVLKDDIEEEQSQSDGGEAEDDESNSLAAKLRGKL------------------ 135

Query: 164 GIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREE 223
                     N++ +    +Q               + L +   D+DSD E+E  P R E
Sbjct: 136 ----------NARDRDDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEVEVIPPRPE 185

Query: 224 PLPFVPFGYTPFTPEDINKLKTFHSS 249
           PLP +P GYTPFT EDI KL+   +S
Sbjct: 186 PLPHIPHGYTPFTDEDIGKLQDTEAS 211

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 92/256 (35%), Gaps = 61/256 (23%)

Query: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPX 62
           +  +EDKEN    ES+V         P TP HLL  RS S             + N SP 
Sbjct: 1   MGRHEDKENSIWSESNV---------PVTPRHLL-SRSQSF------------MKNKSPK 38

Query: 63  XXXXXXXXXXXPLAKKDNNNS-SF--SSRXXXXXXXXXXXXYGSVLGMDAL--------- 110
                      PLA KDNN S S+  +               GS +G   L         
Sbjct: 39  RAEARR-----PLASKDNNRSVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNAS 93

Query: 111 --PRTKSLILKXXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXXXXXXXGMSGLGIGLF 168
             P+ KSL+LK               +       N +                G   GL 
Sbjct: 94  GAPKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLL 153

Query: 169 HDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFV 228
                      GGLQ L+     +R+            +++DSD+E+E  P R EPLP V
Sbjct: 154 --------GATGGLQSLLGPKLSQRA------------EESDSDQEVEVIPPRPEPLPHV 193

Query: 229 PFGYTPFTPEDINKLK 244
           P GYTPF  ++I KL+
Sbjct: 194 PEGYTPFGEQEIAKLQ 209

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 68/169 (40%), Gaps = 40/169 (23%)

Query: 101 YGSVLGMDALPRTKSLILKXXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXXXXXXXGM 160
           YGSVLG +ALP+ KSL+LK                      + ++  +            
Sbjct: 119 YGSVLGYNALPKVKSLVLKDISDNEDDDDDLLSLKLRDSMNKKSINTNK----------- 167

Query: 161 SGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPI 220
           S  GIGL            G LQQLIR+  ++                    REIE+   
Sbjct: 168 SNSGIGLLSG---------GNLQQLIRDANEDV-------------------REIEHKSN 199

Query: 221 REEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVS-TVEDADKLLAL 268
                 ++P  + PF   DI KLKTF+S +KL+   S   ED+ +LL L
Sbjct: 200 AFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSELLLL 248

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 7/86 (8%)

Query: 199 RSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHS----SYKLDS 254
           +S L+ I  D D DREIE A +RE   P+ P GY P    D+ KLK  ++    ++ +DS
Sbjct: 145 KSGLRKIFNDRDLDREIEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNAINRPTFIMDS 204

Query: 255 P--VSTV-EDADKLLALETIETSVDD 277
           P  +S V +D+ +LL L+  E+ +++
Sbjct: 205 PRAISIVGDDSPQLLPLDLEESKLEE 230

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 99/299 (33%), Gaps = 92/299 (30%)

Query: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPX 62
           +  +EDKEN  T      S  +  +MP TP H L KRS S +   NS             
Sbjct: 1   MKKHEDKENLVT------SAGRGAMMPRTPIHQL-KRSSSNLAGRNSTR----------- 42

Query: 63  XXXXXXXXXXXPLAKKDNNNSS-----------------------FSSRXXXXXXXXXXX 99
                      PLA KD N S                         SS            
Sbjct: 43  ----------MPLASKDRNQSQGVFGLKTSGAGGAGGAQAQSKRPASSSIAKNMPDSKLK 92

Query: 100 XYGSVLGMD--ALPRTKSLILK--XXXXXXXXXXXXXXXNAFGLKLRNAMKQHXXXXXXX 155
            YGSVLG+   +L + KSL+LK                 N    KL++ +          
Sbjct: 93  KYGSVLGVGYGSLAKAKSLVLKDTSDCESANEESEEEEGNPLAAKLKSRLCSAEEG---- 148

Query: 156 XXXGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREI 215
                          NED+  S L     L+ E           S L   G+  +    +
Sbjct: 149 --------------GNEDDGSSGL-----LLGEAL---------SQLAAAGETQEDVPPV 180

Query: 216 EYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSY-----KLDSPVSTVEDADKLLALE 269
           EYAP +   LP VP GY      D+ KL  +HS +     K D   +   D+ +L+ LE
Sbjct: 181 EYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLE 239

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 225 LPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDADKLLA 267
           L + P GY PF  EDI KL TF       SP S +   D LLA
Sbjct: 244 LSYSPEGYIPFNNEDIKKLNTFK------SPYSNLNVNDSLLA 280

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 207 QDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSY 250
           QDT+   +IE AP +   L  +P GY  F  E+I KL T+ S +
Sbjct: 186 QDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,912,089
Number of extensions: 1130377
Number of successful extensions: 2766
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2816
Number of HSP's successfully gapped: 37
Length of query: 325
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 215
Effective length of database: 40,868,139
Effective search space: 8786649885
Effective search space used: 8786649885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)