Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038208.267ON1151155827e-79
KLTH0G13574g8.267ON112842391e-26
Suva_2.2748.267ON105762346e-26
Smik_4.3598.267ON105762293e-25
CAGL0B01793g8.267ON981052268e-25
NDAI0J013408.267ON141552281e-24
TPHA0A017708.267ON104762251e-24
TDEL0F039408.267ON110802233e-24
Skud_4.3758.267ON105762233e-24
Kwal_56.237768.267ON130672201e-23
KAFR0B054908.267ON85642161e-23
YDR115W8.267ON105762173e-23
Kpol_543.428.267ON112512173e-23
SAKL0H16918g8.267ON111612155e-23
AGR081C8.267ON130822158e-23
KNAG0H032208.267ON86512101e-22
Ecym_43038.267ON109892112e-22
ZYRO0C01540g8.267ON97932075e-22
KLLA0F19250g8.267ON116772043e-21
TBLA0E044708.267ON94521893e-19
AFR094C1.275ON48075661.0
KNAG0E019402.265ON36950661.2
ZYRO0D02442g2.262ON92855661.3
TBLA0C040104.117ON114444651.6
CAGL0L03960g2.157ON60337651.7
Kpol_1002.946.143ON37990642.2
TPHA0F018402.157ON52137642.5
Suva_15.2995.407ON85046633.3
TDEL0D010304.315ON117337607.1
ACR231C7.366ON47949598.6
Smik_8.2904.372ON26557599.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03820
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...   228   7e-79
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    97   1e-26
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    95   6e-26
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    93   3e-25
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    92   8e-25
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    92   1e-24
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    91   1e-24
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    91   3e-24
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    91   3e-24
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    89   1e-23
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    88   1e-23
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    88   3e-23
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    88   3e-23
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    87   5e-23
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    87   8e-23
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    86   1e-22
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    86   2e-22
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    84   5e-22
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    83   3e-21
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    77   3e-19
AFR094C Chr6 complement(603119..604561) [1443 bp, 480 aa] {ON} S...    30   1.0  
KNAG0E01940 Chr5 (403427..404536) [1110 bp, 369 aa] {ON} Anc_2.2...    30   1.2  
ZYRO0D02442g Chr4 complement(187845..190631) [2787 bp, 928 aa] {...    30   1.3  
TBLA0C04010 Chr3 complement(964128..967562) [3435 bp, 1144 aa] {...    30   1.6  
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    30   1.7  
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    29   2.2  
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    29   2.5  
Suva_15.299 Chr15 (522762..525314) [2553 bp, 850 aa] {ON} YHR103...    29   3.3  
TDEL0D01030 Chr4 (187325..190846) [3522 bp, 1173 aa] {ON} Anc_4....    28   7.1  
ACR231C Chr3 complement(765221..766660) [1440 bp, 479 aa] {ON} S...    27   8.6  
Smik_8.290 Chr8 (473966..474763) [798 bp, 265 aa] {ON} YHR200W (...    27   9.1  

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score =  228 bits (582), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%)

Query: 1   MSLFNRISSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLL 60
           MSLFNRISSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLL
Sbjct: 1   MSLFNRISSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLL 60

Query: 61  PFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           PFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH
Sbjct: 61  PFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 96.7 bits (239), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 59/84 (70%), Gaps = 4/84 (4%)

Query: 34  IRQGITGLGSPMGSNVLSQ--SPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLA 91
            R  +    +PM +   SQ  SP+  +L  FG  QRRWKSRGNTYQPSTLKRKR+ GFLA
Sbjct: 31  CRPSVFQAAAPMAAERSSQGSSPLFSAL--FGFTQRRWKSRGNTYQPSTLKRKRRVGFLA 88

Query: 92  KARDSQKCKILKRRRLKGRWYLTH 115
           +A+  Q  K+LKRRR KGRWYLTH
Sbjct: 89  RAKSKQGYKVLKRRREKGRWYLTH 112

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 94.7 bits (234), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (77%), Gaps = 4/76 (5%)

Query: 44  PMGSNVLSQSPMMG-SLLPFG---ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99
           P  S +L+ SP+   SL PFG   I QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 30  PQTSMLLNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89

Query: 100 KILKRRRLKGRWYLTH 115
           KILKRR+LKGRW+L+H
Sbjct: 90  KILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.8 bits (229), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 4/76 (5%)

Query: 44  PMGSNVLSQSPMMG-SLLPFG---ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99
           P  S +++ SP+   SL  FG   I QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 30  PQTSMIMNSSPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89

Query: 100 KILKRRRLKGRWYLTH 115
           KILKRR+LKGRW+L+H
Sbjct: 90  KILKRRKLKGRWFLSH 105

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 91.7 bits (226), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (60%), Gaps = 15/105 (14%)

Query: 11  LRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWK 70
           LRP+ L  G     M   +S+ LIR            N +S      S+L    LQRRWK
Sbjct: 9   LRPMNLTPGN---GMIGKNSVSLIR------------NEISSGTSFSSILTLFPLQRRWK 53

Query: 71  SRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           SRGNTYQPSTLKRKRKFGFLA+  + +  KI+KRR+ KGRWYLTH
Sbjct: 54  SRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 92.4 bits (228), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%)

Query: 61  PFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           PF I Q+RWKSRGNTYQPSTLKRKRK+GFL++ RD Q  KILKRR+LKGRW+L+H
Sbjct: 87  PFMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 91.3 bits (225), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 55/76 (72%), Gaps = 3/76 (3%)

Query: 43  SPMGSNVLSQSPMMGSLLPFGI---LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99
           S +G N +     + S+L   +   LQRRWKSRGNTYQPSTLKRKR+ GFLA+AR  Q  
Sbjct: 29  SILGGNAIGSRTGLASILGLNLDLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGN 88

Query: 100 KILKRRRLKGRWYLTH 115
           KIL+RR+ KGRWYLTH
Sbjct: 89  KILERRKAKGRWYLTH 104

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 90.5 bits (223), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 59/80 (73%), Gaps = 5/80 (6%)

Query: 36  QGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARD 95
           QG+  LG P   + LS    +  L PFGI+QRRWKSRGNT+QPSTLKRKR+ GFLA+AR 
Sbjct: 36  QGL--LGVPETHSPLSS---ISLLFPFGIMQRRWKSRGNTFQPSTLKRKRRIGFLARARS 90

Query: 96  SQKCKILKRRRLKGRWYLTH 115
               ++L+RR+ KGRWYLT+
Sbjct: 91  KTGSRVLQRRKAKGRWYLTY 110

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 90.5 bits (223), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 4/76 (5%)

Query: 44  PMGSNVLSQSPMMG---SLLPFGIL-QRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99
           P  S +L+  PM     + L FG + QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 30  PQSSMLLNSPPMKTMSLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89

Query: 100 KILKRRRLKGRWYLTH 115
           KILKRR+LKGRW+L+H
Sbjct: 90  KILKRRKLKGRWFLSH 105

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 89.4 bits (220), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 51/67 (76%), Gaps = 2/67 (2%)

Query: 51  SQSPMMGSLLP--FGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLK 108
           S S  M S L   FG+ Q+RWKSRGNTYQPSTLKRKR+ GFLA+ +  Q  KILKRRR K
Sbjct: 64  SSSSAMPSYLSSLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREK 123

Query: 109 GRWYLTH 115
           GRWYLTH
Sbjct: 124 GRWYLTH 130

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 87.8 bits (216), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)

Query: 52  QSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRW 111
           QS  +  +LPF   Q+RWKSRGNTYQPSTLKRKRKFGFL++A+  QK KILK R+ KGRW
Sbjct: 23  QSTNVFFILPF-FGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRW 81

Query: 112 YLTH 115
           YL+H
Sbjct: 82  YLSH 85

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 88.2 bits (217), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (73%), Gaps = 4/76 (5%)

Query: 44  PMGSNVLSQSPM-MGSLLPFG---ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99
           P    +L+ SP+   S  P G   I QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 30  PQTGMLLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89

Query: 100 KILKRRRLKGRWYLTH 115
           KILKRR+LKGRW+L+H
Sbjct: 90  KILKRRKLKGRWFLSH 105

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 88.2 bits (217), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%)

Query: 65  LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           LQRRWKSRGNTYQPSTLKRKRKFGFLA+AR     KIL+RR+ KGRWYL+H
Sbjct: 62  LQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 87.4 bits (215), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (81%), Gaps = 2/61 (3%)

Query: 55  MMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLT 114
           +M  LL  G+ QRRWKSRGNTYQPSTLKRKR+ GFLA+A++ Q  KILK R+ KGRWYLT
Sbjct: 53  IMNILL--GLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLT 110

Query: 115 H 115
           H
Sbjct: 111 H 111

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 87.4 bits (215), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 56/82 (68%), Gaps = 5/82 (6%)

Query: 34  IRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKA 93
           I+ G  G  +P  +      P M S+L  G+ Q+RWKSRGNTYQPSTLKRKR+ GFLA+A
Sbjct: 54  IQYGAIGAFTPAAA----PKPSMLSML-LGLTQKRWKSRGNTYQPSTLKRKRRVGFLARA 108

Query: 94  RDSQKCKILKRRRLKGRWYLTH 115
           R      ILKRRR KGRWYLTH
Sbjct: 109 RSRTGRNILKRRREKGRWYLTH 130

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 85.5 bits (210), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%)

Query: 65  LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           L RRWKSRGNTYQPSTLKRKRKFGFLA+ R S + K+LKRR+ KGRWYL+H
Sbjct: 36  LTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 85.9 bits (211), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 62/89 (69%), Gaps = 3/89 (3%)

Query: 29  SSLGLIRQGITGLGSPMGSNVLS--QSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRK 86
           SS   ++  +  L +   +  +S  Q P + SL+ FG+ QRRWKSRGNT+QPSTLKRKR+
Sbjct: 22  SSFSPMKSLVQPLATSAANTSVSTFQRPSVISLV-FGLNQRRWKSRGNTFQPSTLKRKRR 80

Query: 87  FGFLAKARDSQKCKILKRRRLKGRWYLTH 115
            GFLA+AR     KILKRR+ KGRWYLT+
Sbjct: 81  VGFLARARSKTGQKILKRRKEKGRWYLTY 109

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 84.3 bits (207), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 61/93 (65%), Gaps = 4/93 (4%)

Query: 23  FSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLK 82
           F +G   SL  +        SP+   +L  SP+      FG+ QRRWKSRGNT+QPSTLK
Sbjct: 9   FQVGARRSLFTMGNWTPTTVSPL-QRLLGPSPLSSG---FGMGQRRWKSRGNTFQPSTLK 64

Query: 83  RKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           RKR+ GFLA+AR  Q  KIL+RR+ KGRW+LTH
Sbjct: 65  RKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 83.2 bits (204), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 57/77 (74%), Gaps = 5/77 (6%)

Query: 43  SPMGSNVLSQSPMMGSLLPFGIL----QRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQK 98
           +PM   + SQ+   GS + FG+L    QRRWKSRGNT+QPSTLKRKR+ GFLA+AR    
Sbjct: 41  NPMEITLQSQTQANGSSI-FGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSG 99

Query: 99  CKILKRRRLKGRWYLTH 115
            +ILKRR+ KGRWYLT+
Sbjct: 100 QQILKRRKNKGRWYLTY 116

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 77.4 bits (189), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (82%)

Query: 64  ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115
           I  RRWKSRGNTYQPSTLKRKRK GFL++A+     KILKRR+ KGRW+L+H
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>AFR094C Chr6 complement(603119..604561) [1443 bp, 480 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL091C
           (GWT1)
          Length = 480

 Score = 30.0 bits (66), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 16  LGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNT 75
           LG G+  FS G  ++  L++Q I+G   P+ S ++S     G LL  G+  R    +G  
Sbjct: 156 LGVGSFVFSNGLVAASALLKQEISGQRPPLWSRLVSSVRSAGILLALGV-ARLVSVKGLE 214

Query: 76  YQPSTLKRKRKFGFL 90
           YQ    +    + F 
Sbjct: 215 YQEHVTEYGTSWNFF 229

>KNAG0E01940 Chr5 (403427..404536) [1110 bp, 369 aa] {ON} Anc_2.265
           YIL106W
          Length = 369

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 9   SHLRPVTLGAGTRWF--SMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMM 56
           SHL P      TR F  + G S + G  +Q   GLG+P G+  L   P++
Sbjct: 56  SHLSPGQTIRSTRGFKWNTGQSENNGSKQQQQNGLGTPAGNTALFSPPIL 105

>ZYRO0D02442g Chr4 complement(187845..190631) [2787 bp, 928 aa]
          {ON} similar to uniprot|P40482 Saccharomyces cerevisiae
          YIL109C SEC24 The Sec23p-Sec24p complex is one of three
          cytoplamic COPII factors involved in ER to Golgi
          transport vesicle coat component
          Length = 928

 Score = 30.0 bits (66), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%)

Query: 7  ISSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLP 61
          +S H + V   A  + ++        L+  G +G G+PMG     Q PM   + P
Sbjct: 1  MSHHKKRVYPAAQMQGYASNGFQQPALVNDGTSGYGAPMGYPAAGQVPMAAGVPP 55

>TBLA0C04010 Chr3 complement(964128..967562) [3435 bp, 1144 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1144

 Score = 29.6 bits (65), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 44  PMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKF 87
           PMGS  + Q P +GS     +L    ++   T  PST++RK+ F
Sbjct: 514 PMGSGPVKQEPFIGSKTETALLTLAKRAMRLT-PPSTIRRKKDF 556

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 29.6 bits (65), Expect = 1.7,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 17/37 (45%)

Query: 65  LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKI 101
           L R WK + N +    L++ RK   +    D + C I
Sbjct: 481 LNRSWKLKANAFNKEALQKMRKLQKMTTGSDEEDCSI 517

>Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON}
           (240130..241269) [1140 nt, 380 aa]
          Length = 379

 Score = 29.3 bits (64), Expect = 2.2,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 35/90 (38%), Gaps = 10/90 (11%)

Query: 2   SLFNRISSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLP 61
           S  N IS H   V L AG      GT   + +    I GL S    + +  SP  G   P
Sbjct: 152 STINCISWHSNGVLLAAG------GTDGYMRVFSGFIKGLDS---KDAVVNSPW-GDKFP 201

Query: 62  FGILQRRWKSRGNTYQPSTLKRKRKFGFLA 91
           FG L R W      +       + + GF+A
Sbjct: 202 FGSLVREWYQGSYVHDVKWNSSQERIGFVA 231

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 29.3 bits (64), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 17/37 (45%)

Query: 65  LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKI 101
           L + WK + NT+    L+R R    L    + + C I
Sbjct: 379 LNKSWKRKANTFNKEALQRIRNLQQLTSGLEEEDCSI 415

>Suva_15.299 Chr15 (522762..525314) [2553 bp, 850 aa] {ON} YHR103W
           (REAL)
          Length = 850

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 42  GSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKF 87
            S + SN+ SQ P+ G  L      R  K +  T   +T+KRK KF
Sbjct: 275 ASSLESNIPSQKPLSGKSLTPSQKYRLRKEQSETNLRNTIKRKEKF 320

>TDEL0D01030 Chr4 (187325..190846) [3522 bp, 1173 aa] {ON} Anc_4.315
           YLR436C
          Length = 1173

 Score = 27.7 bits (60), Expect = 7.1,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 39  TGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNT 75
           TGL S      L++ P M S+ P      RW S G+T
Sbjct: 953 TGLNSANNGTNLTKEPTMDSITPTMPNLERWNSNGST 989

>ACR231C Chr3 complement(765221..766660) [1440 bp, 479 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR190W
          Length = 479

 Score = 27.3 bits (59), Expect = 8.6,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 9  SHLRPVTLGAGTRWFSMGTS-SSLGLIRQGITGLGSPMGSNVLSQSPMM 56
          S L  +T G G+   S G+  SSL L  Q +  +GSPM ++++SQ P M
Sbjct: 52 SKLAELTPGGGSA--SAGSPVSSLRLPAQSLFRVGSPMRTSMMSQVPKM 98

>Smik_8.290 Chr8 (473966..474763) [798 bp, 265 aa] {ON} YHR200W
           (REAL)
          Length = 265

 Score = 27.3 bits (59), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 8   SSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGI 64
           SSHL  VT   G+R      +SS  ++ +G +G+G+  GS   S++   G+ + FG+
Sbjct: 168 SSHLLTVT--PGSRLLYENIASSPIILEEGSSGMGTFGGSGADSEAN--GAFMDFGV 220

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,350,055
Number of extensions: 420848
Number of successful extensions: 841
Number of sequences better than 10.0: 31
Number of HSP's gapped: 841
Number of HSP's successfully gapped: 31
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)