Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038108.268ON31431415790.0
NDAI0J013308.268ON3142428611e-115
YDR116C (MRPL1)8.268ON2852438531e-114
Smik_4.3608.268ON2852438481e-113
Skud_4.3768.268ON2852438441e-113
Suva_2.2758.268ON2852438161e-108
Kwal_56.237758.268ON2812468101e-108
SAKL0H16896g8.268ON2852418091e-107
KLTH0G13552g8.268ON2812418061e-107
KLLA0F19272g8.268ON2662418041e-107
Kpol_392.38.268ON2812397791e-103
TPHA0J007708.268ON2782477671e-101
ZYRO0C01518g8.268ON2772427641e-101
KNAG0H032108.268ON2852437371e-96
TDEL0F039508.268ON2762447325e-96
AGR080W8.268ON2752427222e-94
Ecym_43028.268ON2752417074e-92
KAFR0B054808.268ON2802426997e-91
CAGL0B01815g8.268ON2902486981e-90
TBLA0I031908.268ON2412154802e-58
SAKL0C04422g1.144ON221686750.77
TPHA0E025403.544ON88337731.3
Smik_15.4298.675ON418150693.1
KNAG0E013305.21ON51097685.6
ZYRO0A09856g8.445ON30140675.7
TBLA0H005508.445ON30144666.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03810
         (314 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   612   0.0  
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   336   e-115
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   333   e-114
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   331   e-113
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   329   e-113
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   318   e-108
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   316   e-108
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   316   e-107
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   315   e-107
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   314   e-107
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   304   e-103
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   300   e-101
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   298   e-101
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   288   1e-96
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   286   5e-96
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   282   2e-94
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   276   4e-92
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   273   7e-91
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   273   1e-90
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   189   2e-58
SAKL0C04422g Chr3 complement(431806..438456) [6651 bp, 2216 aa] ...    33   0.77 
TPHA0E02540 Chr5 (539071..541722) [2652 bp, 883 aa] {ON} Anc_3.5...    33   1.3  
Smik_15.429 Chr15 complement(743819..745075) [1257 bp, 418 aa] {...    31   3.1  
KNAG0E01330 Chr5 (264229..265761) [1533 bp, 510 aa] {ON} Anc_5.2...    31   5.6  
ZYRO0A09856g Chr1 (798939..799844) [906 bp, 301 aa] {ON} highly ...    30   5.7  
TBLA0H00550 Chr8 complement(105982..106887) [906 bp, 301 aa] {ON...    30   6.9  

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/314 (96%), Positives = 302/314 (96%)

Query: 1   MKGTRYSISSTMNILRIPARATVAFNRVPIRGGLLAQCTSSSQSRGIHSTSNVGXXXXXX 60
           MKGTRYSISSTMNILRIPARATVAFNRVPIRGGLLAQCTSSSQSRGIHSTSNVG      
Sbjct: 1   MKGTRYSISSTMNILRIPARATVAFNRVPIRGGLLAQCTSSSQSRGIHSTSNVGAEEAAS 60

Query: 61  XXXXXXIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGR 120
                 IPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGR
Sbjct: 61  TTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGR 120

Query: 121 PSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVG 180
           PSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVG
Sbjct: 121 PSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVG 180

Query: 181 GVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLL 240
           GVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLL
Sbjct: 181 GVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLL 240

Query: 241 ADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTT 300
           ADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTT
Sbjct: 241 ADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTT 300

Query: 301 LSSTHGPGIVIDFI 314
           LSSTHGPGIVIDFI
Sbjct: 301 LSSTHGPGIVIDFI 314

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  336 bits (861), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 204/242 (84%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           LSKEQLKKRE+RRLSQRK +A++PA+ HPLYM VV+ALR+IRAAEVGRP GQQTITLT+L
Sbjct: 73  LSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTL 132

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           +V+EKG + LNG++ L RPLK LK+AVFS ++ELL  +K +++C LVGG E +  IK+G 
Sbjct: 133 IVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGT 192

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           ++ +FD AFA+ ++   +++QLGK LGRRG+LPN KKGTVSDDL +L+  K+G++PF+QT
Sbjct: 193 IRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQT 252

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
           GN ISI IGKC+FSD++IL NIIAAR A  +AL+ QK+K+PSIL KTTLSSTHGPGIVID
Sbjct: 253 GNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVID 312

Query: 313 FI 314
           F+
Sbjct: 313 FV 314

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  333 bits (853), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 152/243 (62%), Positives = 196/243 (80%)

Query: 71  PTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLT 130
           P+L+K+Q KKREL+RL QRK EAKRPA+  PLYMPV +ALRY+RAAEVGRP  QQTI LT
Sbjct: 42  PSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLT 101

Query: 131 SLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKN 190
           +LVV E+G APL+G ++ P+PL+ +K+A F+ +E  L  ++EKY  HL+GG +L+ KIK+
Sbjct: 102 TLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKS 161

Query: 191 GEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFR 250
           GE+  DFDKAFA+ D+   L +Q+ + LG RG+LP+ KKGTVSDD+ SLL + +GS+PFR
Sbjct: 162 GEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFR 221

Query: 251 QTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIV 310
           Q GN ISIG+GKC+F+D EIL+NII+AR+A   A+  QKSKKP+IL KTTLSSTHGPGIV
Sbjct: 222 QRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIV 281

Query: 311 IDF 313
           IDF
Sbjct: 282 IDF 284

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  331 bits (848), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 198/243 (81%)

Query: 71  PTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLT 130
           P+L+K+Q KKREL+RL+QRK EAKRPA+ +PLYMPV  ALRY+RAAEVGRP  QQTI LT
Sbjct: 42  PSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLT 101

Query: 131 SLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKN 190
           +LVV E+G APL+G ++ P+PL+ +KVA F+ +E  L  +++KY  HL+GG +L+ +IK+
Sbjct: 102 TLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKS 161

Query: 191 GEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFR 250
           GE+  DFDKAFA+ D+   L +Q+ + LG RG+LP+ KKGTVSDD+ SLL + +GS+PFR
Sbjct: 162 GEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFR 221

Query: 251 QTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIV 310
           Q GN IS+G+GKC+FSD EIL+NII+ARSA   A++ QKSKKP++L KTTLSSTHGPGIV
Sbjct: 222 QRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIV 281

Query: 311 IDF 313
           IDF
Sbjct: 282 IDF 284

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  329 bits (844), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 202/243 (83%)

Query: 71  PTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLT 130
           P+L+KEQ KKREL+RL+QR+ EAKRPA+ +PLYMPV  ALRY+RAAEVGRP  QQTI LT
Sbjct: 42  PSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLT 101

Query: 131 SLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKN 190
           +LVV E+G APL+G ++ P+PL+ +KVAVF+ +E  L  ++EKY  HL+GG +L+++IKN
Sbjct: 102 TLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKN 161

Query: 191 GEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFR 250
           GE+  DFDKA+A++D+   L +Q+ + LG RG+LP+ KKGTVSDD+ SLL + +GS+PFR
Sbjct: 162 GEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFR 221

Query: 251 QTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIV 310
           Q GN IS+GIGKC+F+D E+L+NIIAAR+A   A+S+QKSKKP+IL KTTLSSTHGPGIV
Sbjct: 222 QRGNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIV 281

Query: 311 IDF 313
           IDF
Sbjct: 282 IDF 284

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  318 bits (816), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 194/243 (79%)

Query: 71  PTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLT 130
           P+L+K+Q KKREL+RL+QR+ EAKRPA+  PL+MPV  ALRY+RAAEVGRP  QQTI LT
Sbjct: 42  PSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLT 101

Query: 131 SLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKN 190
           +LVV E+G AP++G+++  +PL+ +KVAVF+ +E  L  ++EKY   +VGG +L+ KIKN
Sbjct: 102 TLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKN 161

Query: 191 GEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFR 250
            E   DFDKAFA+ D+   L +Q+ + LG RG+LP+ KKGTVSDD+ SLL + +GS+PFR
Sbjct: 162 NESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFR 221

Query: 251 QTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIV 310
           Q GN IS+GIGKC+F+D E+L+NII+AR+A   A+  QK+KKPS+L KTTLSSTHGPGIV
Sbjct: 222 QRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIV 281

Query: 311 IDF 313
           IDF
Sbjct: 282 IDF 284

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  316 bits (810), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 140/246 (56%), Positives = 202/246 (82%)

Query: 68  PVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTI 127
           PVV  LSK+QL+KRE+R+L+Q+K  A+RPA+ HPLYMPV +ALR++RAAE G+P  QQT+
Sbjct: 35  PVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTL 94

Query: 128 TLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINK 187
           ++T++V++E+G  PL+G++S P+PLK LK+AVF+ +E+     +EK+ CHLVGG +L+ K
Sbjct: 95  SVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEK 154

Query: 188 IKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSL 247
           IK G V  DFDK+FA+ ++  +L++QLG+ LG RGLLP AKKGTV+++LE LL + +G+L
Sbjct: 155 IKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTL 214

Query: 248 PFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGP 307
           PFRQ GN +S+ +GKC F+D+++L NI+AA+  + +AL+ QK+KKPS+LG+TTL+STHGP
Sbjct: 215 PFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGP 274

Query: 308 GIVIDF 313
           GIVIDF
Sbjct: 275 GIVIDF 280

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  316 bits (809), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 200/241 (82%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           LSK+QLK+RELRRL QRK  A++PA+ HPLYMPV +ALR++RAAEVG+P  QQTI+LT+L
Sbjct: 44  LSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTL 103

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           V++E+G   LNG+IS P+PLK +K+AVF+ +E+ L   +++++CHLVGG ELI KIK GE
Sbjct: 104 VISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGE 163

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           V  DFDKAFA+ D+A  L++QLG+ LG RGLLPNAKKGTV++D+ SL+ D +G+LPFRQ 
Sbjct: 164 VPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQR 223

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
           GNCISI + KC F+D ++L NI+AA+ +   AL+ QK+KKPSILG+TTL++THGPG+VID
Sbjct: 224 GNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVID 283

Query: 313 F 313
           F
Sbjct: 284 F 284

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  315 bits (806), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 142/241 (58%), Positives = 200/241 (82%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           LSK+QLKKRE+RR +Q+K  A+RPAS HPLYMPV +ALR++RAAEVG+P  QQT+++T++
Sbjct: 40  LSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTI 99

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           V++E+G   L+G++S P  LK LK+AVF+ +E+     +EK++CH+VGG EL+ KIK G+
Sbjct: 100 VISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQ 159

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           V  DFDK+FA+ ++A +L++QLG+ LG RGLLP AKKGTVS++LESL+ D +G+LPFRQ 
Sbjct: 160 VPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQR 219

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
           GN ISI +G+C F+D+++L NI+AA+ +V +AL+ QK+KKPS+LG+TTL+ST GPGIVID
Sbjct: 220 GNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVID 279

Query: 313 F 313
           F
Sbjct: 280 F 280

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  314 bits (804), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 144/241 (59%), Positives = 193/241 (80%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           L+KEQL+KRELR++ QR+ +AK PAS HPLYMPV  ALRY+RA EVG+P+ QQTITLT+L
Sbjct: 25  LTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTL 84

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           VV E+GV PL G++S  +PLK +KVAVF+ +E     MK+KY  HLVGG +L+++IK GE
Sbjct: 85  VVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGE 144

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           V  DFDKAFA+ D+   L++Q+G+ LG RGLLP AKKGTV++DLE L+ D + S+PFRQ 
Sbjct: 145 VSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQR 204

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
           GN IS+G+ K HF+D+E+L N++A + A  ++++ Q++KKPSIL +TTL+STHGPGIVID
Sbjct: 205 GNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVID 264

Query: 313 F 313
           F
Sbjct: 265 F 265

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  304 bits (779), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/239 (58%), Positives = 193/239 (80%)

Query: 75  KEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVV 134
           K++LK+RELRR S+RK +A++PAS +PLYMP+ +ALRY+RAAEVG+P  QQ IT+T+ VV
Sbjct: 42  KDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVV 101

Query: 135 NEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVK 194
           +E+G   LNG+IS   P+K +K+AVFS + E L ++KE+++CHL+GG +L+ KIK+G+  
Sbjct: 102 SERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQP 161

Query: 195 TDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGN 254
            DFDKAFA+ D++ +L++QL + LG RG+LP  KKGTVS+D+ SL+   IG +PFRQTGN
Sbjct: 162 VDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGN 221

Query: 255 CISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313
            IS+ +G+C+FSD++IL NIIA RSA    LS QKSKKPS+LGKTT++STHGPGI IDF
Sbjct: 222 SISVSVGRCNFSDKQILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDF 280

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  300 bits (767), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/247 (58%), Positives = 190/247 (76%), Gaps = 1/247 (0%)

Query: 67  IPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQT 126
           I  V  LSK+QLKKRELRR + RK EAK PA+ HPLYM V +ALR++RAAEVG+P  QQT
Sbjct: 32  IAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQT 91

Query: 127 ITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELIN 186
           I LT+LVV+EKG   L G I+   PLK +K+A+F+ +E  +   KEK++C++VGG ELI+
Sbjct: 92  INLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELIS 151

Query: 187 KIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGS 246
           KIKNGE++ DFDKAFA+ D+   L + + + LG RG+ P+ KKGTVS+++E L+   +GS
Sbjct: 152 KIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGS 210

Query: 247 LPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHG 306
           +PFRQ GNCIS+ IGKC+FSD +IL N+I+ R A   ++S QK+KKPSILGKT LS+THG
Sbjct: 211 IPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHG 270

Query: 307 PGIVIDF 313
           PGIVIDF
Sbjct: 271 PGIVIDF 277

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  298 bits (764), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 188/242 (77%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           L+KEQL+KRE+RR ++RK EAK+PA  HPLYMP   ALRY+RA EVG P+ QQ IT+T+ 
Sbjct: 36  LTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYLRAVEVGYPASQQVITVTTS 95

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           VV ++G  P+ G++SLP PLK + VAVFS +E+ L+  ++K+ CHLVGG ++I KIK GE
Sbjct: 96  VVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGE 155

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           +  DFDKAFA+ D+A  L++Q+ + LG + +LP AK+GTV+ DLE L+ D  GS+PFRQ 
Sbjct: 156 IPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQK 215

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
           GN IS+ + KC FSD ++L N++A ++A  +A+S QK+K+PSILG+TTL++THGPGIVID
Sbjct: 216 GNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVID 275

Query: 313 FI 314
            +
Sbjct: 276 LV 277

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  288 bits (737), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 186/243 (76%)

Query: 71  PTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLT 130
           P L+KEQL++RELR++ + K  AKRPAS   +Y+ V EA+R +RA EVG+P+ QQTITLT
Sbjct: 42  PKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLT 101

Query: 131 SLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKN 190
           ++VV+EKGV PL+G + LP PLK +++A FS + ELL R++E+    +VGG ELI+++K+
Sbjct: 102 TMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKS 161

Query: 191 GEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFR 250
           GEV   FDKAFA+ D+A  L+++LG  LGRRGLLPN KKGTV  DL +++  K+G++PFR
Sbjct: 162 GEVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFR 221

Query: 251 QTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIV 310
           Q    ++ GI KCHFSD ++L N+IAAR A   A+  QKSKK SILG++TLSSTHGPGIV
Sbjct: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281

Query: 311 IDF 313
           ID 
Sbjct: 282 IDL 284

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  286 bits (732), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 187/244 (76%)

Query: 70  VPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITL 129
           V  LSK+QLKKRE+RRL+QRK  AK+  S HPLYM +  ALR++RAAEVG+P  QQTITL
Sbjct: 32  VSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFLRAAEVGQPQTQQTITL 91

Query: 130 TSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIK 189
           T+ VV E+GV  L G +S P+PLK +K+AVFS +E+ L   +EK++CHLVGG E+I KIK
Sbjct: 92  TTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREKFNCHLVGGTEIIEKIK 151

Query: 190 NGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPF 249
           +GE+  DFDKAFA+ D+A  L++QL + LG RG+LP  KKGTV+ D+  L+ D +GS+PF
Sbjct: 152 SGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVATDVSRLVQDSMGSMPF 211

Query: 250 RQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGI 309
           RQ GN ISI +GK  FSD +IL N IA   AV +AL+ Q SKK S+LGKTTLSSTHGPGI
Sbjct: 212 RQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKTSLLGKTTLSSTHGPGI 271

Query: 310 VIDF 313
           VIDF
Sbjct: 272 VIDF 275

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  282 bits (722), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 140/242 (57%), Positives = 191/242 (78%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           LSK+QLKKRELRRL+QRK  A+RPAS  PLYMPV +ALR++RAAEVG+P+ QQTI++ ++
Sbjct: 33  LSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPATQQTISVNTM 92

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           V+ +KG A L+G ++LP P++  KVAVF+ + E     + KY C+LVGG EL+ ++K+GE
Sbjct: 93  VIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQLKSGE 152

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           VK DFDKAFA+ D+A +++A+LG+ LG +GLLP+ KKGTV+ DL  LL D I S PF+Q 
Sbjct: 153 VKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINSTPFKQR 212

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
            NCIS+ IGKCHFSD +I+ N++A ++A   A++ QK+KK S+ G TTL+STHGPGIVID
Sbjct: 213 NNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLTSTHGPGIVID 272

Query: 313 FI 314
           F+
Sbjct: 273 FL 274

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  276 bits (707), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 182/241 (75%)

Query: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132
           LSKEQ+KK+ELR L Q++  AK+    HPLYMPV +A R++RAAEVG+P  QQTI+LT++
Sbjct: 34  LSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTV 93

Query: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192
           VV++KG   L+G+I  P PL+ +KVAVF+ N+E     +E++ CHLVGG ELI  IKNG+
Sbjct: 94  VVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNGD 153

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
              DFDKA A+ D+   L++QL   LG R LLP  KKGTVS+++ +L+ + + ++PFRQ 
Sbjct: 154 TPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQR 213

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
           G  +S+ +GKC FSD+++L+NI+A + A  +AL++Q+ KK SILGKTT++STHGPGIVID
Sbjct: 214 GPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVID 273

Query: 313 F 313
           F
Sbjct: 274 F 274

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  273 bits (699), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 177/242 (73%), Gaps = 1/242 (0%)

Query: 74  SKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLV 133
           +K+Q KK+ LR   + + +A+ PAS HPLYM V +ALR++RA EVG+P  QQTITLT+LV
Sbjct: 39  NKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLV 98

Query: 134 VNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKY-HCHLVGGVELINKIKNGE 192
           ++EKGV P+ G++ LP PL+  KV V S + + L  +++ + + HLVGG EL++K KN +
Sbjct: 99  ISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNED 158

Query: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252
           ++ DFDK  A+ D+ N  +  LGK  G +GLLPN KKGTVS++L  L+ + + S+PFRQ 
Sbjct: 159 IEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQR 218

Query: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312
             CIS+GIGK  FSD++IL NIIA R A +  LS QK+KK S LGKTTL+STHGPGIVID
Sbjct: 219 AGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVID 278

Query: 313 FI 314
           FI
Sbjct: 279 FI 280

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  273 bits (698), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 188/248 (75%), Gaps = 6/248 (2%)

Query: 72  TLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTS 131
           TL+KEQ KKRE++RL+ +K EAK+PA+IHPLYMP+  ALRY+R+AEVGRP+  QTIT+T+
Sbjct: 42  TLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTT 101

Query: 132 LVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKY--HCHLVGGVELINKIK 189
           LVV +KG A L G+I  P PLK +K+A+FS N+E L  +K KY     + GG ++I  IK
Sbjct: 102 LVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIK 161

Query: 190 NGEVKTD-FDKAFASSDMANILSAQLGKTLGRRGLLPNAKK---GTVSDDLESLLADKIG 245
           +G++K D  +K FA+ ++   +++QLG+ LG +GL+PN KK    TV +DL+SL+ + +G
Sbjct: 162 SGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLG 221

Query: 246 SLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTH 305
            + FRQ GN +S+ +G+C+FSD +IL NIIA R+A  +++S Q +KKPSILGKTT+S+T 
Sbjct: 222 QVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTA 281

Query: 306 GPGIVIDF 313
           GPGIVIDF
Sbjct: 282 GPGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  189 bits (480), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 141/215 (65%), Gaps = 2/215 (0%)

Query: 100 HPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAV 159
           HPL M V  ALRY+RA E GR S +QT+TL ++V   +G  PL G I+    ++   +AV
Sbjct: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88

Query: 160 FSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLG 219
           F+++ E   ++ ++    ++GG ELI+KI +GE K  F  AFA++DM   L A++ + LG
Sbjct: 89  FTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146

Query: 220 RRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARS 279
           ++ +LP  KK TV D++  LL DK+  +PF +  + IS  +GKC F+DEEILRN+I AR 
Sbjct: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206

Query: 280 AVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI 314
            + KAL EQ +KKPS + K TL+STHGPGI ID  
Sbjct: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDLF 241

>SAKL0C04422g Chr3 complement(431806..438456) [6651 bp, 2216 aa] {ON}
            similar to uniprot|P25356 Saccharomyces cerevisiae
            YCR032W BPH1
          Length = 2216

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 197  FDKAFASSDMANIL-SAQLGKT-LGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGN 254
            FDK F S  +  +   AQ G    G R L  N  +  V    ESL    I ++  RQ G+
Sbjct: 1095 FDKEFCSYILLFLARYAQSGAGGSGPRALALNCFRTIVLHRSESL--RDIATIISRQEGD 1152

Query: 255  CISIGIGKCHFSDEEILRNIIAARSA 280
            C+   + KC  SD+E L  ++ +R A
Sbjct: 1153 CVFQLLAKCMCSDDEELYGLLTSREA 1178

>TPHA0E02540 Chr5 (539071..541722) [2652 bp, 883 aa] {ON} Anc_3.544
           YGL227W
          Length = 883

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 267 DEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSS 303
           +E+ L NII+    +++ +SEQ  K PS+  K+T+ S
Sbjct: 822 NEDSLENIISYTRTMLQTMSEQNIKNPSVANKSTIES 858

>Smik_15.429 Chr15 complement(743819..745075) [1257 bp, 418 aa] {ON}
           YOR245C (REAL)
          Length = 418

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 61/150 (40%), Gaps = 26/150 (17%)

Query: 145 HISLPRP-LKALKVAVFSQNEELLTRMKEKYHCHLVGGVE------------LINK---- 187
           HI L R  L AL ++  S+   L T  K +  C +VGG              ++NK    
Sbjct: 232 HIPLYRDYLLALGISSVSRKNALRTLGKNQSICIVVGGARESLLSSTNGEQLILNKRKGF 291

Query: 188 ----IKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLES--LLA 241
               I+ G +      AF   D  N+LS +   TLG+  L      G       +  L  
Sbjct: 292 IKLAIQTGNINLVPVFAFGEVDCYNVLSTKKDSTLGKMQLWFKENFGFTIPIFYARGLFN 351

Query: 242 DKIGSLPFRQTGNCISIGIGKCHFSDEEIL 271
              G LPFR     I++ +G+  + +++IL
Sbjct: 352 YDFGLLPFRAP---INVVVGRPIYVEKQIL 378

>KNAG0E01330 Chr5 (264229..265761) [1533 bp, 510 aa] {ON} Anc_5.21
           YMR300C
          Length = 510

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 9/97 (9%)

Query: 137 KGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTD 196
           K V P+N +    RP    +   F++ + +L  +   YH  L  GV+L   IK      +
Sbjct: 248 KQVVPINSY----RP-DLFEYVYFARPDSVLDGIS-VYHTRLAMGVKLAENIKRRLAADE 301

Query: 197 FDKAFASSDMANILSAQLGKTLG---RRGLLPNAKKG 230
            D   A  D A   + Q   TLG   R G + N   G
Sbjct: 302 VDVVMAVPDTARTCALQCANTLGKPYREGFVKNRYVG 338

>ZYRO0A09856g Chr1 (798939..799844) [906 bp, 301 aa] {ON} highly
           similar to uniprot|P38988 Saccharomyces cerevisiae
           YDL198C GGC1 Mitochondrial GTP/GDP transporter essential
           for mitochondrial genome maintenance has a role in
           mitochondrial iron transport member of the mitochondrial
           carrier family (putative) mitochondrial carrier protein
          Length = 301

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%)

Query: 180 GGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLG 219
           GG   +N+  N   K DFD AF S     + SA  G  +G
Sbjct: 91  GGQPFVNEFLNKNYKADFDNAFGSKTGKALRSATAGSLIG 130

>TBLA0H00550 Chr8 complement(105982..106887) [906 bp, 301 aa] {ON}
           Anc_8.445 YDL198C
          Length = 301

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 21/44 (47%)

Query: 176 CHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLG 219
            +  GG   +N+  N   K DFD AF +     ++SA  G  +G
Sbjct: 86  VYKYGGQPFVNEYLNKNFKKDFDNAFGAKTGKAMISATAGSLIG 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,958,385
Number of extensions: 1066254
Number of successful extensions: 3127
Number of sequences better than 10.0: 33
Number of HSP's gapped: 3205
Number of HSP's successfully gapped: 33
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)