Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B038008.269ON56555627460.0
NDAI0J013108.269ON57957617660.0
Suva_2.2768.269ON56556417630.0
YDR117C (TMA64)8.269ON56555916930.0
Skud_4.3778.269ON56256916910.0
Smik_4.3618.269ON56556216650.0
TDEL0F039608.269ON55855716350.0
CAGL0B01837g8.269ON56956215570.0
ZYRO0C01496g8.269ON56756315390.0
TPHA0J007808.269ON58357415320.0
KAFR0B054708.269ON56255814720.0
Kwal_56.237718.269ON56255714430.0
KLTH0G13530g8.269ON57456914420.0
SAKL0H16874g8.269ON56355614400.0
Kpol_392.28.269ON56656913940.0
KLLA0F19294g8.269ON57056911681e-154
KNAG0H032008.269ON56156711531e-151
TBLA0I032008.269ON56358211421e-150
Ecym_43018.269ON56457110841e-141
AGR079W8.269ON54256510021e-129
Kpol_1060.306.269ON151380742.6
Smik_22.7singletonON43661723.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03800
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...  1062   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   684   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   683   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   656   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   655   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   645   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   634   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   604   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   597   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   594   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   571   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   560   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   560   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   559   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   541   0.0  
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   454   e-154
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   448   e-151
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   444   e-150
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   422   e-141
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   390   e-129
Kpol_1060.30 s1060 complement(71627..76168) [4542 bp, 1513 aa] {...    33   2.6  
Smik_22.7 Chr22 (6518..7828) [1311 bp, 436 aa] {ON} YNR058W (REAL)     32   3.1  

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/556 (93%), Positives = 520/556 (93%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPSIVKQTNFQTPTTIGTIYTDEK 60
           MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPSIVKQTNFQTPTTIGTIYTDEK
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPSIVKQTNFQTPTTIGTIYTDEK 60

Query: 61  NIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDEK 120
           NIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDEK
Sbjct: 61  NIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDEK 120

Query: 121 LKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKID 180
           LKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKID
Sbjct: 121 LKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKID 180

Query: 181 LKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDVD 240
           LKPPVVDVQKGSV                    TTKEMSTATNVEDLAEVLDHLSVQDVD
Sbjct: 181 LKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDVD 240

Query: 241 YFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKHX 300
           YFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 
Sbjct: 241 YFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSIT 360
                          TVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSIT
Sbjct: 301 EKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSIT 360

Query: 361 FYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGMV 420
           FYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGMV
Sbjct: 361 FYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGMV 420

Query: 421 NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEMK 480
           NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEMK
Sbjct: 421 NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEMK 480

Query: 481 IGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIIID 540
           IGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIIID
Sbjct: 481 IGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIIID 540

Query: 541 HLNKLGVPTKWIDYEN 556
           HLNKLGVPTKWIDYEN
Sbjct: 541 HLNKLGVPTKWIDYEN 556

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/576 (63%), Positives = 418/576 (72%), Gaps = 30/576 (5%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTC--PSIVKQTNFQT--PTTIGTIY 56
           MF+KEPHIKALSNLKNSDRKKL QTI  QT  + Y     +I+KQTNFQT  P +IGTI+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 57  TDEKNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPP 116
           T++ NIPIWFK KH+  LY TV+TCWN  D+LP  LSHDFVIQEKLFNGANLMISGTIPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 117 FDEKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKS 176
           FD +L  GTLCG+AS QDP R+V+AIG+V M++P F+KVVGE+GVAV++IHHFEDELFK 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKI-DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLS 235
           FK  DLKP         V                      KE +  +N  D  EVLDH  
Sbjct: 181 FKCNDLKPDEF------VKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDF-EVLDHFK 233

Query: 236 VQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAK 295
            +DVDYFITR+LYYTIT DTK+ LPISASNFISQHINKNLPD+ HNEVNIKK+SWKKTAK
Sbjct: 234 TEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAK 293

Query: 296 FLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNG-----ENKGAKKEGD 350
           FLKH                TVVGMNKTKDELKNFVPYK+G S        +     + D
Sbjct: 294 FLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSD 353

Query: 351 SQSGMMYSITFYKPINLAKDLIKE-SGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKM 409
           ++ GMMYS TFYKPIN AKDL+K    +P K LY   EIRD V +YI  KNL+D KNKKM
Sbjct: 354 TK-GMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKM 412

Query: 410 VLLDDLLFGMVNKKRTDPTVS-RSISRAQILEPTLKNNFTEHFQIYDSQG---------T 459
           +LLDDLLF MV+K++++   + R++ R  ILEP L NNFTEH+QIY  +           
Sbjct: 413 ILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVE 472

Query: 460 PLFKSPMRGSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGET 519
           PLFKSP RG  P+I ILTEMKIGRKVITKVSNFE FGI+ + LAADLRK+CSGSTTIGET
Sbjct: 473 PLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGET 532

Query: 520 MTSPKTAEVQVQGPHGQIIIDHLN-KLGVPTKWIDY 554
           MTSPKT EVQVQGPHGQIIIDHLN K GVPTKWI+Y
Sbjct: 533 MTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/564 (60%), Positives = 417/564 (73%), Gaps = 15/564 (2%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59
           MF+KEPHIKALSNLKNS+RKKL QT   QT N++YT P S +KQTNF    ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N PI FKEKH+ +L+ TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           + K+GTLCGVAS Q P ++V A+GIV MDLP + +V+GE+GVAV+I+HHF D L K+FK+
Sbjct: 121 RCKIGTLCGVASRQAP-KIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKV 179

Query: 180 DLKPPVV-DVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTAT-NVEDLAEVLDHLSVQ 237
            L+PP   DV   S                     T + +  A  N+E++AEVLDHLSV 
Sbjct: 180 KLEPPAAFDV--ASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVS 237

Query: 238 DVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFL 297
           DVDYFITRALYYT+T D  L+LPISASNFIS HI +NLP +DHNEVN+K++SWKK+AKFL
Sbjct: 238 DVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFL 297

Query: 298 KHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSN-----GENKGAKKEGDSQ 352
           KH                T+VG N  KDELKNFVPYKLG +N     GEN  +K   +  
Sbjct: 298 KHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSK---EKT 354

Query: 353 SGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLL 412
           SGMMYS+T YKP NLAKDL+KE+ +P +  Y   +IR  +  YI++KNLVD K+K  V++
Sbjct: 355 SGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVM 414

Query: 413 DDLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPR 472
           DDLL+ MVNKK+ DP V+R I RAQIL+P L NNFTE +QIY +  T L ++PM+GSPPR
Sbjct: 415 DDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPR 474

Query: 473 IKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQG 532
           IKI+TEMKIGRKVITKVSNFE   I+PE LAADLRK+CSGSTTIGE+ T  K+AEVQVQG
Sbjct: 475 IKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQG 533

Query: 533 PHGQIIIDHLNKLGVPTKWIDYEN 556
           PHGQ+IIDHLNK GVP KWID+EN
Sbjct: 534 PHGQLIIDHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/559 (58%), Positives = 398/559 (71%), Gaps = 5/559 (0%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTC-PSIVKQTNFQTPTTIGTIYTDE 59
           MF+KEPHIKALSNLKNS+RKKL QT   QT N++Y+   S +KQTNF    ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N PI FKEKH  +L+ TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           + K+GTLCG+AS Q P   V AIGIV +DLP F+KV+GE+GVAV+IIHHF D L K FK+
Sbjct: 121 RCKIGTLCGIASKQAP-ETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKM 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
            L+PP V   +                              + +VE++AEVLDH +V DV
Sbjct: 180 KLEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDV 239

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           DYFITRALYYT+T D  L LPISASNFIS HI +NLP +DHNEVN+KK+SWKK+AKFLKH
Sbjct: 240 DYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKH 299

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNG--ENKGAKKEGDSQSGMMY 357
                           T+VG N  KDELKNFVPYKLG S    E++ +    +  SGMMY
Sbjct: 300 FEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMY 359

Query: 358 SITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLF 417
           S+T YKP NLAKDL+KE  +     Y   +IR  V+ YI++KNL D K+K  V++DDLLF
Sbjct: 360 SLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419

Query: 418 GMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILT 477
            MVNKK+     SR I+R +IL P L NNFTE +QI+ S  T LFK+PM+GS P IKI+T
Sbjct: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479

Query: 478 EMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQI 537
           EMKIGRKVIT+VSNFE F ++PE+LAADLRK+CSGSTTI E+ T  K AEVQVQGPHGQ 
Sbjct: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538

Query: 538 IIDHLNKLGVPTKWIDYEN 556
           IIDHLNKLG+P+KWID+EN
Sbjct: 539 IIDHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/569 (57%), Positives = 409/569 (71%), Gaps = 14/569 (2%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59
           MF+KEPHIKALSNLKNS+RKKL QT   QT ND+YT P S +KQTNF +  ++G +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N PI FKEKH+ +L+ TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           + KVGTLCGVAS + P +VV AIGIV MDLP +++V+GE+GVAV++IHHF D L K+ K+
Sbjct: 121 RSKVGTLCGVASREAP-KVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
            L PP+       +                      K      +VE+LAEVLDH SV DV
Sbjct: 180 KLDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQK---AQVHVEELAEVLDHFSVSDV 236

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           DYFITRALYYT+T D  L LPIS SNFIS HI +NLP +DHNEVN+KK+SW+K+AKFLKH
Sbjct: 237 DYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH 296

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSS-----NGENKGAKKEGDSQSG 354
                           T+VG    KDELKNFVPYK+GSS     +GE+  +K   +   G
Sbjct: 297 FEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSK---EKTPG 353

Query: 355 MMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDD 414
           MMYS+T YKP ++AKD +KE+ +  +  Y   +IR  ++ YI+  NL D K+K  V++DD
Sbjct: 354 MMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413

Query: 415 LLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIK 474
           LLF MVNKK+ +   +R + RAQIL+P L NNFTE +QI+ +  + LFK+P++GSPPRIK
Sbjct: 414 LLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIK 473

Query: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPH 534
           I TEMKIGRKVIT+VSNFE F I+PE+LA DLRK+CSGSTTIGE+ T  K+AEVQVQGPH
Sbjct: 474 ITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPH 532

Query: 535 GQIIIDHLNKLGVPTKWIDYENKLKAKKK 563
           GQ+IIDHLN LGVP KWID+ENKLK KK+
Sbjct: 533 GQLIIDHLNNLGVPNKWIDFENKLKKKKR 561

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/562 (59%), Positives = 413/562 (73%), Gaps = 11/562 (1%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59
           MF+KEPHIKALSNLKNS+RKKL QT   QT N++YT P SI+KQTNF    ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            NIPI FKEKH  +LY TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +  VGTLCGVA  Q P +VV AIG+V +DLP +++V+GE+GVAV++IHHF D LFK+FK+
Sbjct: 121 RCNVGTLCGVAGKQSP-KVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
            L+PPVV   +                             TA ++E++AEVLDHL+V DV
Sbjct: 180 KLEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDV 239

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           DYFITRALYY++T D  L LPISAS FIS HI +NLP +DHNEVN+KKSSWKK+AKFLKH
Sbjct: 240 DYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKH 299

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSN-----GENKGAKKEGDSQSG 354
                           T+VG N  KDELKNFVPYKLG S+     GEN  +K   D  SG
Sbjct: 300 FEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSK---DRTSG 356

Query: 355 MMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDD 414
           MM+S+T YKP +LAKDL++E+ +     Y   ++R+ V+ YI++KNL D K+K+ V++DD
Sbjct: 357 MMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDD 416

Query: 415 LLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIK 474
           LLF MVNKK+  P  +R I+R++IL+P L NNFTE +QI+ +  T LF+ PM+G PPRIK
Sbjct: 417 LLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIK 476

Query: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPH 534
           I+TEMKIGRKVITKVSNFE F I+PE LAADLRK+CSGSTTIGE+ T  K+AEVQVQGPH
Sbjct: 477 IVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPH 535

Query: 535 GQIIIDHLNKLGVPTKWIDYEN 556
           GQ IID+LNK G+P+KWID+EN
Sbjct: 536 GQFIIDYLNKSGIPSKWIDFEN 557

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/557 (56%), Positives = 401/557 (71%), Gaps = 10/557 (1%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYT-CPSIVKQTNFQTPTTIGTIYTDE 59
           MF+KEPHIKALSNLKNS+RKKL Q+   QTG   Y    SIVKQTN++   + GT+YTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N+PIWFKEKH   L+ TVY+CW   +LLPI L+HDFVI+E+LFNGANLM++GT+PPFDE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +     +CG+AS  DP +V+ AIG+V ++LP +  V+G+ G+AV+++H+F D L ++FKI
Sbjct: 121 RCVPAKVCGIASRTDP-KVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
           D++P V+  +                          +   T  ++ED+A+VLD LSV+DV
Sbjct: 180 DIEPAVLSSEPVEEEEEEEGKEKLTESPKR------ETFHTEISIEDVAQVLDELSVEDV 233

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           D+F TRALYYT T DT L++PI+ASNFIS HI  NLP VD ++VN+KK+SWKKTAKFLKH
Sbjct: 234 DHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKH 293

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359
                            +VG+NK KDELKNFVPYK        K + K  DS  GMMYS 
Sbjct: 294 FEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNK--DSSPGMMYSE 351

Query: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419
             YKPINL KD I+ S +P KNLY  TE++D VN YIT K LVD+KNKKMVLLDDLLF M
Sbjct: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDM 411

Query: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479
             +K+      R +SRAQI++P + NNFTE +Q++  + TPLFK+P+RG  PR+KI+TEM
Sbjct: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEM 471

Query: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539
           KIGRKV+T+VS+FE F ++PE LAA+LRK+CSGSTTIGET+TSPK AEVQVQG HG +II
Sbjct: 472 KIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLII 531

Query: 540 DHLNKLGVPTKWIDYEN 556
           D+LNK G+PTKWID+E+
Sbjct: 532 DYLNKQGIPTKWIDFES 548

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/562 (55%), Positives = 399/562 (70%), Gaps = 10/562 (1%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59
           MF+KEPHIKALSNLKNS+RKKL +    QT N++Y+  S  +KQTNF+  TTIGTIYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N PIWFKEKHD +LY TV  CW C +L+P+ L+H  V+++ +FNGANLMISGTIPPFDE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +L VGT+CG+A  + P  +V A+GIV M+LP F +V+GE+GVAVQI+HH EDELFK FK+
Sbjct: 121 RLTVGTVCGIADKRTPNLIV-AVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
             +PP   +Q  S                      +      +N++D+AEVLD L ++D+
Sbjct: 180 KEEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDI 239

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLP-DVDHNEVNIKKSSWKKTAKFLK 298
           DYFITRALYYTI+ DTKL  P SASNF+S HIN NLP   +  EVNIKKSSWKKTAKFLK
Sbjct: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLK 299

Query: 299 HXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYS 358
           H                T+V +NK KDE+K F+PY +  + G N G+  EG +    +  
Sbjct: 300 HFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGS--EGGNAKTTIKI 357

Query: 359 ITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFG 418
           +T YKPINLAKD I  + +P+K LY+  EI++ +N YIT+K+LVD K+KK VL+DD+L  
Sbjct: 358 VTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLMT 417

Query: 419 MVNKKRTD-PTVSRSISRAQILEPTLKNNFTEHFQIYDSQG---TPLFKSPMRGSPPRIK 474
           M+ KK+ D  T SR I RA IL+P L+NNF +++ ++   G   TPL K+P++G PP+I 
Sbjct: 418 MIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKIN 477

Query: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSP-KTAEVQVQGP 533
           I+TEMKIGRKVITKVSNFE F I+PE  AAD+RK CSGSTTIGET +S  KTAEVQVQGP
Sbjct: 478 IVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQGP 537

Query: 534 HGQIIIDHLNKLGVPTKWIDYE 555
           HGQ+I+ +LN LG+P KWID+E
Sbjct: 538 HGQLIMSYLNDLGIPNKWIDFE 559

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/563 (53%), Positives = 394/563 (69%), Gaps = 14/563 (2%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59
           MF+K+PH+KALSNLKNS+ KKL  T  AQTGN +Y+ P+ ++KQTNFQ  + IGT+YTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N PIWFKEKH   LY TV+ CW+   LLP+ L+H FV++E+LFNGANLM++GT+ PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +LK GT+CG+AS   P  VV A+G+V +DLP ++ V+G++GVAVQ++H+  D L K FK+
Sbjct: 121 RLKPGTVCGIASKNAPD-VVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
           + +PPV                             ++E   A +++D+AEVLD   ++DV
Sbjct: 180 NAEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQE--KAVDIDDIAEVLDEFRLEDV 237

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           D F+TRALYYT+T DTKL LPISASNFIS HIN NLP VDH +VN+KKSSWKKTAKFLK+
Sbjct: 238 DQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKN 297

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGA-----KKEGDSQSG 354
                           T++G+NK K EL+NF PY++   +G    +     KK+G  Q  
Sbjct: 298 FEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQ-- 355

Query: 355 MMYSITFYKPINLAKDLIKESGM-PMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLD 413
            +   T YKPINLAKD I+++ + P   LY   E+++ +N+YI   NL D+KNKKMV+LD
Sbjct: 356 -LRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILD 414

Query: 414 DLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRI 473
           DLL+ +VNKK+ D T  R +SRA I+EP L N+FT HFQIY     PLFK+P RG+ P I
Sbjct: 415 DLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNI 473

Query: 474 KILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGP 533
           +I+TEMKIGRKVIT+VS FE F I+ + LAA LR++CSGSTTIGETMTSPK  EV VQGP
Sbjct: 474 EIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGP 533

Query: 534 HGQIIIDHLNKLGVPTKWIDYEN 556
           HG +IIDHLN LG+PTKWI ++N
Sbjct: 534 HGPLIIDHLNSLGIPTKWIKFDN 556

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/574 (52%), Positives = 395/574 (68%), Gaps = 16/574 (2%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59
           MF+K P++KA SNLKNS+RKKL Q+   Q  +  Y  PS I+KQ N++  T+ GT+YTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
           +N+PIWFKEKH   L+ +VYTCW    LLPI +++ +VI+EK+ NGANLMISGT+ PFDE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +L  G LCG+AS + P  VV AIGIV +DL  + KVVGE+GVAV ++H+  D L  SFK+
Sbjct: 121 RLICGALCGIASYKKPN-VVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKM 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNV---EDLAEVLDHLSV 236
           +L+PP    + G+                     T      A +    +DLAEVL+ L V
Sbjct: 180 NLEPP----ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPV 235

Query: 237 QDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKF 296
             +D FIT++LYY++T D KL  PISASNFIS +I  NLP VD++ VN+KKSSWKKTAKF
Sbjct: 236 DIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKF 295

Query: 297 LKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSG-- 354
           L+H                 + G NK K ELK+FVPY+ G+ N       K  D+     
Sbjct: 296 LRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGD 355

Query: 355 MMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDD 414
           MM S+++YKPI+L KDLI+ES  P K+LY   E+RD +  YI  KNLVD+KNKKM+L+DD
Sbjct: 356 MMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415

Query: 415 LLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIY----DSQGTPLFKSPMRGSP 470
           L++ +V KK+ +    R ISRA ++EP  KNNF EHFQIY    +    PLFK P+RGS 
Sbjct: 416 LMYSLVYKKK-NSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSI 474

Query: 471 PRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQV 530
           P+++I+TEMKIGRKVIT+VSNFE F I+ ETLAADLRK+C+G+TTIGET+TSPKTAEVQV
Sbjct: 475 PKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQV 534

Query: 531 QGPHGQIIIDHLNKLGVPTKWIDYENKLKAKKKR 564
           QGPH Q+II HLN L +PTKWID++N +K K+K+
Sbjct: 535 QGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/558 (51%), Positives = 375/558 (67%), Gaps = 7/558 (1%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDK--YTCPSIVKQTNFQTPTTIGTIYTD 58
           MF+KEP IKALS LKNSDRKKL Q++ AQ  +D+        + QTNF + T  GTIYTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 59  EKNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFD 118
             +IPI FK KH   LY T +  W+   LL    +H  V++  +FNGA+LMI+GT+PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 119 EKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFK 178
             L +GT+C VA+ + P  V  A+GIV ++LP++++V+G++GVAV+I+HHFED LF +FK
Sbjct: 121 STLTIGTICAVATKEAPD-VAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFK 179

Query: 179 IDLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQD 238
             L+ P     K  +                     T+  S +   +D+AEVLD L+V+D
Sbjct: 180 AKLEIPAS--VKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVED 237

Query: 239 VDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLK 298
           VDYFI RALY+T+  D  L+LP+ AS F+S HI +NLPDVDH +VNIK++SWKKTAKFLK
Sbjct: 238 VDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLK 297

Query: 299 HXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYS 358
           +                 +VGMNK KDELKNFVPYK+G++  +         +Q   + S
Sbjct: 298 YFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVSVSS 357

Query: 359 ITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFG 418
           +  YKPINL +  IKES +    +Y   EIR+ +N+YI  KNLVD K+KKMV+LDDLLF 
Sbjct: 358 VNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFA 417

Query: 419 MVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTE 478
           MVN+K  +P   R I RA ILEP + NNF E+FQ+Y    TPLFK+P++G  P+I I+TE
Sbjct: 418 MVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTE 477

Query: 479 MKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQII 538
           MKIGRKV+T+VSNFE F I+PE LAADLRK+CSGSTTI E  T  K +EVQVQGPHGQ+I
Sbjct: 478 MKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHGQLI 535

Query: 539 IDHLNKLGVPTKWIDYEN 556
           IDH NK G+P+K+I +EN
Sbjct: 536 IDHFNKSGIPSKFIQFEN 553

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/557 (50%), Positives = 376/557 (67%), Gaps = 5/557 (0%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59
           MF+KEP IKALSNLKNS+RKKL      Q     Y+ PS ++KQT F+TP T GT+YTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
           KNIPIWFKEK    LY TV++CW+ +DL+PI L+H++V++EKL  GANLM+ GT+PPFDE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +     + GVAS   P  VV AIGIV ++LP++ +V+GESGVAV+I+H F+DEL K+FK+
Sbjct: 121 RCVKTKMVGVASTHSPD-VVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
            L+PP                             +        N++D AE L  LSV+DV
Sbjct: 180 KLQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDV 239

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           D+F TRALYYT+T D+KL +P SASNF+S HI +NLP +DH +VN+KK+SWKKTAKFLKH
Sbjct: 240 DHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKH 299

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359
                           T+VG++KTKDELK+FVPY+ G ++G + G++     Q+ MM ++
Sbjct: 300 FEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSES---EQNSMMKAL 356

Query: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419
             YKP++ AK  +  + +   +++ P E++  V+ YI  K LV   NK  V LDDLLF +
Sbjct: 357 VIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSL 416

Query: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479
           VN+        R+I RAQI+ P LK NF EHF +    GTPLFK P++G  P+I+I+TEM
Sbjct: 417 VNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEM 476

Query: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539
           KIGRKV+TKVSNFE+F ++ + LA  LRK CSGSTTIGET TSPKT EV VQGPHG  +I
Sbjct: 477 KIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAVI 536

Query: 540 DHLNKLGVPTKWIDYEN 556
           + LN+L +PTKWI++ N
Sbjct: 537 ELLNQLAIPTKWINFVN 553

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/569 (48%), Positives = 377/569 (66%), Gaps = 21/569 (3%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59
           MF+KEP IKALSNLKNS+RK +      QTG+ +Y  PS ++KQT F+TP T GT++TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
           KN+PIWFKEK    LY TV+TCW+   LLPI L+H++V++EKL  GANLM+ GT+PPFDE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +     +  VAS   P  VV AIGIV ++LP++ +V+GESGVAV+I+H F DEL K FK+
Sbjct: 121 RCVKTRMVSVASTAAPD-VVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTA-----------TNVEDLA 228
            L+PP     +GS                     +  E   A            NVED++
Sbjct: 180 KLQPP-----EGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDIS 234

Query: 229 EVLDHLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKS 288
           E L  L V+DVD+F TR+LYY++  D KL  PISASNF+S HI +NLP +DH +VN+KK+
Sbjct: 235 EQLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKT 294

Query: 289 SWKKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKL-GSSNGENKGAKK 347
           SWKKTAKFLK+                T++G+++TK ELKNF PY++ G ++   KGA  
Sbjct: 295 SWKKTAKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASS 354

Query: 348 EGD--SQSGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNK 405
             +   Q+ +M +++ Y+PI+  K  +  + +P   ++   +I+  V+ YI+ KNLV   
Sbjct: 355 VANEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPD 414

Query: 406 NKKMVLLDDLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSP 465
           NK  V LDDLL+ +VN+        R+I+RAQI+ P LK NF+EHF I  + GTPLFK P
Sbjct: 415 NKSAVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHP 474

Query: 466 MRGSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKT 525
           ++GS P+++I+TEMKIGRKV+TKVSNFE+F ++ + LA  LRK CSGSTTIGE  TSPKT
Sbjct: 475 VKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKT 534

Query: 526 AEVQVQGPHGQIIIDHLNKLGVPTKWIDY 554
            EV VQGPHG  +I+ LN+ G+PTKWI++
Sbjct: 535 LEVTVQGPHGPAVIELLNESGIPTKWINF 563

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 382/556 (68%), Gaps = 6/556 (1%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59
           MF+K+PHIKALSNLKNS+RKKL  ++  Q     Y  P+ +VKQT F+  T+ GT+YTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
           +N+PIWFKEKH   ++ TV+TCW+  D+LP+  +H  V++EKL  GA+LM+ G +PPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           K   G+L GVAS + P RV+ AIGIV +DLP + +V+GE+GVAV IIH F+D L K+FK+
Sbjct: 121 KCSKGSLVGVASTRSP-RVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKM 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
            L+PP       S                     TT+  +   N ED +E L+ LS +D+
Sbjct: 180 KLEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQ--ARMVNTEDASEQLNELSAEDI 237

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           D+F+TR+LYYT+T D +L LP++ASNF+S HI  NLP VDHN++N+KKSSWKK+AKFLKH
Sbjct: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359
                            VVG+NK KDELK FVPY++GS +GE    K +    S MM ++
Sbjct: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGS-HGEPTQTKAKAQENSNMMQAV 356

Query: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419
           + YKPI+ AK+  K   +P   ++   E++  +++YI  KNLV+  +KKMVLLDD LF M
Sbjct: 357 SLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPM 416

Query: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479
           +N+        R+ISRAQI+ P L NNFTEHFQI      PLFK+ ++G+ P I+I+TEM
Sbjct: 417 INRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIVTEM 475

Query: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539
           KIGRKV+TKVSNFE+F ++ ETLAA+LRK CSGSTTIGETM+SPKT EV VQGPHG I+I
Sbjct: 476 KIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVI 535

Query: 540 DHLNKLGVPTKWIDYE 555
             LN+ G+PTKWI+++
Sbjct: 536 GMLNEYGIPTKWINFQ 551

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/569 (51%), Positives = 387/569 (68%), Gaps = 9/569 (1%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59
           MF+K PHIK+LSNLKNS+RKKL Q+  AQTG+  Y  P S++KQTNF   T++G IYTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
           +  P+WFKEKH   L+ TVYTCW    LLPI L+HD VI E +FNGANLMISGT+PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +L   T+CG+A+  +P  +V A+G+V +D+P +  V+G++GVAV ++H++ D +  +FK+
Sbjct: 121 RLVPATICGIATRNNPNTIV-AVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKM 179

Query: 180 DLK-PPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQD 238
               P +V  +  SV                     +    ++ +V +LA+    L+V+D
Sbjct: 180 KRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVED 239

Query: 239 VDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLK 298
           +D+FITR+LYYT+T D KL+ PI +S+FIS HI +NLP VDHN VNIKK+SWKK++KFLK
Sbjct: 240 IDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLK 299

Query: 299 HXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSG--MM 356
           H                T+VG NK K+ELK F PY++ +S+  N G K   + Q    MM
Sbjct: 300 HFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSS-SNSGKKINSNRQESENMM 358

Query: 357 YSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLL 416
           YS+ FY P   AK  +  + +P KN Y   E+++ V  YI  K LVD KN KM  LDD L
Sbjct: 359 YSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRL 418

Query: 417 FGMV-NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKI 475
           + M   KK T+P   R I+RA ++E    NNFTE +Q++ +  TPL K+P+RGSPPRIKI
Sbjct: 419 YDMCYTKKSTNP--PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKI 476

Query: 476 LTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHG 535
           +TEMKIGRK++T+VSNFE FGI+ + LA DLR++CSGSTTIGET TSPKT EVQVQGPH 
Sbjct: 477 VTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHS 536

Query: 536 QIIIDHLNKLGVPTKWIDYENKLKAKKKR 564
           +IIIDHLN L +PTKWID+ENKLK KK R
Sbjct: 537 KIIIDHLNSLSIPTKWIDFENKLKPKKIR 565

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  454 bits (1168), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 252/569 (44%), Positives = 349/569 (61%), Gaps = 22/569 (3%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59
           MF KEPHIK LSNLKNSDRKKL  TI  Q  N++Y  P +++KQT+FQ     G+IYTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCE-DLLPICLSHDFVIQEKLFNGANLMISGTIPPFD 118
            N PIWFK K + +LY T+++ WN +  LLPI L+HDFVI++ +  GA LM+ GT+PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 119 EKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFK 178
             +K G++ G+AS +DP  +V AIGI  MDL     V+G  G+AV+++H+ +D LFK+FK
Sbjct: 120 SNVKRGSIVGIASTKDP-LLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFK 178

Query: 179 IDLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATN-VEDLAEVLDHLSVQ 237
           ++L+PP V      +                       E S++ + V ++A+ L+ +S++
Sbjct: 179 LELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238

Query: 238 DVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFL 297
           DVD+ + RA+ Y+I  D K++LPI AS FIS H+ KNLPDVD N VNIKKSSWKK  K L
Sbjct: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298

Query: 298 KHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKL-------GSSNGENKGAKKEGD 350
           K+                TV+ +NK   +L N   YK         S +  N+  K +  
Sbjct: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358

Query: 351 SQSGMMYSITFYKPINLAKDLIK--ESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKK 408
           + SG       YKP++  +  I    + +P ++ Y   E++  ++ Y+   NL+D +NK 
Sbjct: 359 AYSGE----NLYKPMSACQRFITGITADVP-QSYYTQQELKKLLDLYVANNNLIDPENKS 413

Query: 409 MVLLDDLLFGMVNKKRTDPTVSRSISRAQILEPT-LKNNFTEHFQIYDSQGTPLFKSPMR 467
           +V  DD L+ M N+   +  + + I+R  I+ PT L  NF  + QIY   G PL K P +
Sbjct: 414 LVKYDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEK 472

Query: 468 GSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAE 527
           G  P ++I+TE KIGRKVIT+V+NFE+F I+ E LAA LRK CSGSTTIGE+  S KTAE
Sbjct: 473 GPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAE 531

Query: 528 VQVQGPHGQIIIDHLNKLGVPTKWIDYEN 556
           VQVQGPHG I+I  LN  G+PTKWI +EN
Sbjct: 532 VQVQGPHGSIVISILNDYGIPTKWISFEN 560

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  448 bits (1153), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 252/567 (44%), Positives = 349/567 (61%), Gaps = 26/567 (4%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYT-CPSIVKQTNFQTPTTIGTIYTDE 59
           MF+K PHIK LSNLKNS+++KL Q +  Q G D++    + VKQTNFQ+ T++GTIY ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 60  KNIPI--WFKEKHDPR-LYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPP 116
           + IP+  +FKEKH    L+ +VY CW+   LLPI L+H  VI++ LFNGANLMISGT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 117 FD-EKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQI--IHHFEDEL 173
           FD   L  G  CG+A+ + P  V+ A+G + MDL  F          V +   HHF D L
Sbjct: 121 FDVAHLHKGRPCGIANYKSPD-VIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGL 179

Query: 174 FKSFKIDLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDH 233
             +F++ L  P                              T  ++    V+DLAEVL+ 
Sbjct: 180 ADAFRLKLDIP---------DKLESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLET 230

Query: 234 LSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLP-DVDHNEVNIKKSSWKK 292
           LSV+DVDYF+TRALYYT+T + KL+LPI+ASNF+S H+ K LP  +D  EVN+KKSSWKK
Sbjct: 231 LSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKK 290

Query: 293 TAKFLKHXXXXXXXXXXXXXXXXTVVGM--NKTKDELKNFVPYKLGSSNGENKGAKKEGD 350
           TAK+LKH                 VVG   +KT   LK+FVPY +G+S  E+    K   
Sbjct: 291 TAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAES--GPKSQT 348

Query: 351 SQSGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMV 410
           +   +M+++T ++P + A+  +   G   +  +   EIR+ +N YIT   L    N KMV
Sbjct: 349 TNGPVMFAVTSFQPDSTAQTALPLGG---QRYFSGPEIREVLNEYITANKLAQPNNPKMV 405

Query: 411 LLDDLLFGMVNKKRTD-PTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGS 469
           LL+D LFGMV K   +  T  R ++R +ILE  +K +F   +Q++  + TPL K P +G 
Sbjct: 406 LLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGE 465

Query: 470 PPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQ 529
           PP++ I+TEMKIGRKV+T+V NF+   I     AADLRK+CS STTIG+T+++P  +E+Q
Sbjct: 466 PPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQ 525

Query: 530 VQGPHGQIIIDHLNKLGVPTKWIDYEN 556
           VQG HG +IIDHL +LGVP+ W+ +EN
Sbjct: 526 VQGAHGPLIIDHLRELGVPSSWVVFEN 552

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  444 bits (1142), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 241/582 (41%), Positives = 341/582 (58%), Gaps = 38/582 (6%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59
           MF+K   I  LSNLKNS+ + + QT      N++Y  P S VKQT F++    G IYTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N+PIWFK+K+   +  TVYT W   + +PI  +HDF+I+ K+FNGANLMI GT+ P DE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
           +LK G +CG+AS + PG ++ AIG+   D+   +  +G++GVAV+++H + DEL   FKI
Sbjct: 121 RLKPGKICGIASTKVPGTIL-AIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKI 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTA---------------TNV 224
            L PP +                            T+E+S A               +N 
Sbjct: 180 KLNPPTI-----------MNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNA 228

Query: 225 EDLAEVLDHLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVN 284
           +DLAE L+ L V+D+D F+T++LYYTIT +T L LPI +S F+S ++ KNLP+VDHN+VN
Sbjct: 229 DDLAETLEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVN 288

Query: 285 IKKSSWKKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKG 344
           IKKSSWKKTAKFLKH                T+ G NK K +LK FVPY++G   G    
Sbjct: 289 IKKSSWKKTAKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPS 348

Query: 345 AKKEGDSQSGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDN 404
             K+ +     +  +T Y P           G+  K+ +   EI   +  YI  KNL + 
Sbjct: 349 KDKQDN--KNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANP 406

Query: 405 KNKKMVLLDDLLFGMV--NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLF 462
           K+K  + +DD+LF +V  N K      +R+I R+Q++EP L NNF  + Q++      L 
Sbjct: 407 KDKAKISMDDVLFDLVITNNK---ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLS 463

Query: 463 KSPMRGSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTS 522
           K P +GSPP +K++TE     KVIT+VSNFE F I+ + ++ +L+ +CSGST+I E    
Sbjct: 464 KHPKKGSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL--- 520

Query: 523 PKTAEVQVQGPHGQIIIDHLNKLGVPTKWIDYENKLKAKKKR 564
           P  +EVQVQGPHG I++++  K G+P KW DY NK+K KK+R
Sbjct: 521 PNGSEVQVQGPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  422 bits (1084), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 231/571 (40%), Positives = 344/571 (60%), Gaps = 15/571 (2%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYT-CPSIVKQTNFQTPTTIGTIYTDE 59
           MF+K+P IK+ SNLKNS+RKKL   + AQ  N ++    +IVKQ  F+TPT  GTI+TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            N PI+FKEKH   L  T+ TCW    LL + L+H  V+  KL NGA+LM+ GTIPPF +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
               G L GVAS + P  VV AIG+  ++L    KVVGE+GVAV+++H   D L++ FK+
Sbjct: 121 NCTRGKLVGVASSETP-FVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKM 179

Query: 180 DLKPP--VVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTA-----TNVEDLAEVLD 232
            ++PP  ++  QK  V                     T + ++       ++ ++AE L+
Sbjct: 180 SVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLE 239

Query: 233 HLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKK 292
            LS++ VD+F+T+A+YYT+  D  L LPI ASNFI+ H+ KNLP +   +V++K+SSW +
Sbjct: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299

Query: 293 TAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQ 352
            +KFLK+                TVV +NK K E+K+F PY+  +       + K  D  
Sbjct: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR--TIQKSVSTSSKNNDKH 357

Query: 353 SGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLL 412
              +  + +Y+P+N AK  +   G     +    +I+  +N Y+T K LV+  +++++LL
Sbjct: 358 D--VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILL 415

Query: 413 DDLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPR 472
           DD LF +  KK    + +R + RA++ +  L  +FTE F I+   G PL   P++     
Sbjct: 416 DDTLFSLAYKKSASDS-TRKVLRAKMFDLILSTSFTEVFFIF-KDGKPLSSKPLKSKNRN 473

Query: 473 IKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQG 532
           + ++TEMKI RK++T++SNFE +G++PE L+ +LRK CSGS+T+ E  T   T EVQVQG
Sbjct: 474 VSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQG 533

Query: 533 PHGQIIIDHLNKLGVPTKWIDYENKLKAKKK 563
           PHG   I+ LN+ G+P+K+ID++NKL  KKK
Sbjct: 534 PHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  390 bits (1002), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/565 (38%), Positives = 321/565 (56%), Gaps = 24/565 (4%)

Query: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPSI-VKQTNFQTPTTIGTIYTDE 59
           MF+KEP++   SN KNS+RK+L  +I  Q   + Y   S  +K   F+T +T+GT+YTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119
            NIP+WF+ KHD     TVY+CW+  DLLP+  +H+ V++ KL  GA+LM+ GT+PPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179
             + G + G+AS + PG VV A+GI  MDL     V   +GVAV+++H + D L + FK+
Sbjct: 121 GTRRGRVVGIASTRAPG-VVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKV 179

Query: 180 DLKPPVVDVQKGSVXXXXXXXXXXXXXXXXXXXXTTKEMSTATNVEDLAEVLDHLSVQDV 239
             + P     KG+                        E       E LAE L+ L+++DV
Sbjct: 180 QREAPEASEAKGA---------------SPEAREPEAEPPKTAPGEGLAEELERLTMEDV 224

Query: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299
           D+ +TRA+YYTI  D +L LP++AS FI++H+ KNLP +D ++V +K+SSW K AK LKH
Sbjct: 225 DHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKH 284

Query: 300 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359
                           TVV +N   + LK+F PY+   S+  + G+K    +QS  +  +
Sbjct: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRT-VSDKASTGSKNSSTTQS--LEIV 341

Query: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419
             Y P       +   G+   +     +IRD +  Y+  +  VD  +K M+ LDD L  +
Sbjct: 342 YHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQL 401

Query: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479
           ++K   +    RS+ R + L   L  +F+E+F +   +G      P +G  P IK+  E 
Sbjct: 402 LHKN-VNADTPRSLPRPEALAALLSRSFSEYFVVM--RGDAPLSKPQKGRAPPIKVTNER 458

Query: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539
           KI +KV+TKVSNFE +G++PE LAA+LR  CSGSTTI +   + K  EVQVQGPH   I+
Sbjct: 459 KIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQGPHEATIV 517

Query: 540 DHLNKLGVPTKWIDYENKLKAKKKR 564
             LNK G+P+K+I  + K++ KKK+
Sbjct: 518 SILNKHGIPSKYITLDCKVQPKKKK 542

>Kpol_1060.30 s1060 complement(71627..76168) [4542 bp, 1513 aa] {ON}
            complement(71627..76168) [4542 nt, 1514 aa]
          Length = 1513

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 13/80 (16%)

Query: 454  YDSQGTPLFKSPMRGSPPRIKILTEMKIGRKVITKVSNFEQF--GINPETLAADLRKMCS 511
            Y+ +   L    M    PR++IL+E     KVI   + F+++   I P+ +  D+ K CS
Sbjct: 1125 YEQESERLIYEDMLSVRPRLEILSE-----KVIQITNKFQEYLKYIEPDDMIVDILKQCS 1179

Query: 512  GSTTIGETMTSPKTAEVQVQ 531
               +I      P+T  V ++
Sbjct: 1180 DDKSI------PRTGRVTLE 1193

>Smik_22.7 Chr22 (6518..7828) [1311 bp, 436 aa] {ON} YNR058W (REAL)
          Length = 436

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPH 534
           IL E+ +G     K+  FE  GI P+ +    + + +G  T+  T+T+ K  ++   GP 
Sbjct: 255 ILDEVAVGLGRTGKLFGFEHAGIVPDIVCLG-KTLTAGYLTLSATVTTRKIGDLISNGPE 313

Query: 535 G 535
           G
Sbjct: 314 G 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,092,323
Number of extensions: 2636740
Number of successful extensions: 7702
Number of sequences better than 10.0: 37
Number of HSP's gapped: 7773
Number of HSP's successfully gapped: 39
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)