Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B037908.270ON61261232650.0
NDAI0J012708.270ON7356336595e-76
YDR118W (APC4)8.270ON6525766475e-75
KAFR0B054608.270ON6105326402e-74
Suva_2.2778.270ON6495736274e-72
Smik_4.3628.270ON6485836143e-70
Skud_4.3788.270ON6525736092e-69
ZYRO0C01474g8.270ON5994785544e-62
Kpol_392.18.270ON4244205345e-61
KNAG0H031908.270ON6225605362e-59
TDEL0F039708.270ON6194325318e-59
TPHA0J007908.270ON6854244152e-42
TBLA0C045708.270ON6084124071e-41
CAGL0B01859g8.270ON6224244062e-41
KLTH0G13508g8.270ON6455113541e-34
Kwal_56.237668.270ON7404183515e-34
SAKL0H16852g8.270ON6444282902e-26
KLLA0F19316g8.270ON671258920.019
AGR078C8.270ON715343910.021
Ecym_43008.270ON715275880.049
KNAG0D037504.76ON81576780.85
KAFR0F032904.138ON770109771.2
SAKL0F16434gsingletonON72978724.4
YOR208W (PTP2)8.623ON750123707.7
KLTH0H04840gna 1ON44339699.4
NDAI0K029006.9ON43890689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03790
         (612 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...  1262   0.0  
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   258   5e-76
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   253   5e-75
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   251   2e-74
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   246   4e-72
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   241   3e-70
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   239   2e-69
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   218   4e-62
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   210   5e-61
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   211   2e-59
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   209   8e-59
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   164   2e-42
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   161   1e-41
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   160   2e-41
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   140   1e-34
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   139   5e-34
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   116   2e-26
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    40   0.019
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    40   0.021
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    39   0.049
KNAG0D03750 Chr4 complement(682937..685384) [2448 bp, 815 aa] {O...    35   0.85 
KAFR0F03290 Chr6 complement(647353..649665) [2313 bp, 770 aa] {O...    34   1.2  
SAKL0F16434g Chr6 (1348589..1350778) [2190 bp, 729 aa] {ON} some...    32   4.4  
YOR208W Chr15 (733925..736177) [2253 bp, 750 aa] {ON}  PTP2Phosp...    32   7.7  
KLTH0H04840g Chr8 complement(431325..432656) [1332 bp, 443 aa] {...    31   9.4  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      31   9.9  

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score = 1262 bits (3265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/612 (100%), Positives = 612/612 (100%)

Query: 1   MSNLTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNY 60
           MSNLTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNY
Sbjct: 1   MSNLTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNY 60

Query: 61  LTVMFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISG 120
           LTVMFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISG
Sbjct: 61  LTVMFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISG 120

Query: 121 LMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGV 180
           LMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGV
Sbjct: 121 LMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGV 180

Query: 181 YKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVL 240
           YKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVL
Sbjct: 181 YKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVL 240

Query: 241 TEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILYGLMAKSLNHW 300
           TEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILYGLMAKSLNHW
Sbjct: 241 TEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILYGLMAKSLNHW 300

Query: 301 LCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASGH 360
           LCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASGH
Sbjct: 301 LCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASGH 360

Query: 361 MQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI 420
           MQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI
Sbjct: 361 MQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI 420

Query: 421 CEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTM 480
           CEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTM
Sbjct: 421 CEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTM 480

Query: 481 KIRGTARSFTENFDEDVTILDIFYCAKYPFLVYLVEKRSNTQDVKASVKYIGTANSINLR 540
           KIRGTARSFTENFDEDVTILDIFYCAKYPFLVYLVEKRSNTQDVKASVKYIGTANSINLR
Sbjct: 481 KIRGTARSFTENFDEDVTILDIFYCAKYPFLVYLVEKRSNTQDVKASVKYIGTANSINLR 540

Query: 541 TISAAKKVNYPLSIDSASIQKVKFLFEKQNNCLTLISTIQSLDQKVSYIMTEVSINRTGD 600
           TISAAKKVNYPLSIDSASIQKVKFLFEKQNNCLTLISTIQSLDQKVSYIMTEVSINRTGD
Sbjct: 541 TISAAKKVNYPLSIDSASIQKVKFLFEKQNNCLTLISTIQSLDQKVSYIMTEVSINRTGD 600

Query: 601 EISLNFLRNDTT 612
           EISLNFLRNDTT
Sbjct: 601 EISLNFLRNDTT 612

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  258 bits (659), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 197/633 (31%), Positives = 320/633 (50%), Gaps = 97/633 (15%)

Query: 9   VSY-NPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFND 67
           +SY NPS+P  L KTS     RRT D  QI  I+IRNM  VIA  W+S    YLT+ F+D
Sbjct: 24  ISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDD 83

Query: 68  GSARIHDIFREGKLMTLLRLQDGF-----QKCMDTGIWSKLEVRQKPNEGEFDRDISGLM 122
           G+ RI+DIF++GKL+TL+R Q        +  +D  IW +L +     E EF+ DI+ LM
Sbjct: 84  GTFRIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLM 143

Query: 123 PSPIKFVNNAGQLEVVPYVVTQTQ--WRNVD-----KPLEVN----------------DI 159
           P+ IKFV ++  + +VPY   + Q  WR        KP+  N                  
Sbjct: 144 PTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRY 203

Query: 160 IDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKT 219
           +D+H+ H  + D + + ING Y++ +   + +    N++ +I+      ++HCF+++   
Sbjct: 204 LDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSI 263

Query: 220 STIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKD 279
            ++  +    ST HV LL +  E+ ++ +Y   HLD+I+  L K   DFL  T I   K 
Sbjct: 264 RSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPT-IFEEKQ 322

Query: 280 ------LSKSLKSFILYGLMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVL 333
                 + + LK  +L G M++ L  WL   +GEKNLKKWKRLSE  Y K IQI SLA++
Sbjct: 323 NGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALI 382

Query: 334 PALEKLSLLSIRCEALVVAIALPASGHMQE------------------------------ 363
           PA E   LLS +C A++ AI +     ++                               
Sbjct: 383 PACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSF 442

Query: 364 LEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN---- 419
           LE  + L++   + C Q L   +K S  EK+ S+F+ W+Q++IF  +DED+VPKL+    
Sbjct: 443 LELIEILQKF-GSRCLQNL---RKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSN 498

Query: 420 --ICEDGSVVPTLMEII--DQFFQDTTKEKSTDGTDLSKN-----------LLKSISDTL 464
             IC D S     + ++  D+  +D  ++++    D  +N           +L+ I+   
Sbjct: 499 PIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLS 558

Query: 465 ENIDSSYVRNMLLKTMKIRGTARSFTEN-FD--EDVTILDIFYCAKYPFLVYLVEKRS-N 520
            +ID   ++  L + + +    +  TE  FD  +++T+ D+        L+YL++ +S +
Sbjct: 559 RSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQVKSLD 618

Query: 521 TQDVKASVKYIGTANSINLRTISAAKKVNYPLS 553
           ++D    + Y+GT N ++L+ I   K + +PL+
Sbjct: 619 SRD----LFYVGTINVVDLKPICHPKLIQFPLT 647

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  253 bits (647), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 160/576 (27%), Positives = 289/576 (50%), Gaps = 18/576 (3%)

Query: 2   SNLTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYL 61
           S + +  + YNP +P    + + G A+ R  D  ++  I IRN++ V    W++    +L
Sbjct: 3   SPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFL 62

Query: 62  TVMFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGL 121
           ++ F DG+ RIHDIF++G+L++ LR+       +  GIW ++ +R +PN  +F  +I   
Sbjct: 63  SIFFKDGTIRIHDIFKDGRLVSFLRIP---STKISKGIWDRIPLRYEPNNRDFACNIIDD 119

Query: 122 MPSPIKFVNNAGQLEVVPYVVTQTQWRNVDK-PLEVNDIIDIHMAHNSNTDEYLLMINGV 180
           +P  I+FV ++ ++ +VPY    + WR  D+  L+ N+ +D+H+  N   D+  +  NG 
Sbjct: 120 LPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGD 179

Query: 181 YKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVL 240
           Y + +  ++ +    N L  II ++    + CFY+D    T++L  L++S   V+LLN +
Sbjct: 180 YAVFLSVDNIEN--ENSLKSIIKVQD-GFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYI 236

Query: 241 TEMKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLN 298
             +K+L  Y++ HL+ I+ +L  P  DF++           L   L++  L G ++  L 
Sbjct: 237 MVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLE 296

Query: 299 HWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPAS 358
            WLCN VGEKN K+WK L    YQK +QI++L  +PA E++ +   +  A++ A ++   
Sbjct: 297 DWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNK 356

Query: 359 -GHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPK 417
             +  +L   + L +++  L    LN       +E     F +W  D + E +DEDY  K
Sbjct: 357 LSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLK 416

Query: 418 LNICEDGSVVPTLMEIIDQFF-QDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNML 476
               +D      L+   D+   +  T+  S     L ++L+ S+SD  ++I  S V + +
Sbjct: 417 FQFEDDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHI 476

Query: 477 LKTMKIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVE--KRSNTQDVKASVK---- 529
            + + +      F + +    + +LD     K+ ++VYL++  K ++ Q+  +       
Sbjct: 477 QQHILVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKL 536

Query: 530 YIGTANSINLRTISAAKKVNYPLSIDSASIQKVKFL 565
           YIGT    NL  IS    V  P    S  +   +F+
Sbjct: 537 YIGTLKDENLGIISKESSVKIPALFKSYRLSSTRFV 572

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  251 bits (640), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 271/532 (50%), Gaps = 13/532 (2%)

Query: 11  YNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSA 70
           YN   P    K   G  V R  D+T I   +I+  + V    W+     YL++ F DGS 
Sbjct: 14  YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGSI 73

Query: 71  RIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIKFVN 130
           RI D+F++GKL+  LR Q    K +D   W ++E +      +F+++I  LMPS I+FV+
Sbjct: 74  RIIDVFKDGKLVAFLRTQ---FKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQFVS 130

Query: 131 NAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPNST 190
           +A +L ++PY  +   WR +D   + N +ID+H  H S TD +L+++NG Y LT++   T
Sbjct: 131 SANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKTPET 190

Query: 191 DENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYI 250
           D +       +I     +++ C YKD     ID ++ + S   + LL  +  +K + +Y 
Sbjct: 191 DLSEKVPACSLIK-SANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYT 249

Query: 251 VDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGEK 308
            +HLD+++  + KP  DFLE         + L   LK   L G ++  L  WL   VG+K
Sbjct: 250 RNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGDK 309

Query: 309 NLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASG-HMQELEYF 367
           N+ +W+ L    YQ+  ++ ++A++ A E++ LLS RC  L++A    +       L   
Sbjct: 310 NVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNSRLHEL 369

Query: 368 DSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNICEDGSVV 427
           + L      +    +   ++++ + +   +F+ W+ D + E +D+DY P+L+I ++ +  
Sbjct: 370 NELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQNSNTC 429

Query: 428 PTLMEIIDQFFQDTTKEKSTD--GTDLSKNLLKSISDTLENIDSSYVRNMLLKTMKIRGT 485
             L +  +   Q+  K+ S D    D+ K+ L+ I   +  +++ Y+  +L   + I   
Sbjct: 430 YKLGKSFEYLLQEGKKD-SEDILNFDIIKHTLEKIEANISRMNTKYIEPILENKIAIDTK 488

Query: 486 ARSFTENFDED--VTILDIFYCAKYPFLVYLVEKRSNTQDVKASVKYIGTAN 535
              F  N+  +  VT+ DI   ++ P+++Y+V+  S T      V+ +GTAN
Sbjct: 489 IPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPTPINEVR-VGTAN 539

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  246 bits (627), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 152/573 (26%), Positives = 280/573 (48%), Gaps = 18/573 (3%)

Query: 4   LTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTV 63
           + +  + YNP +P    +   G A+ R  D  ++  I +RN+  V    W+     +L++
Sbjct: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60

Query: 64  MFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMP 123
            F DG+ RIHDIF++G+L++ LR+    +  +  GIW ++ ++ + +   F  ++  ++P
Sbjct: 61  FFKDGTIRIHDIFKDGRLVSFLRIP---RTKISRGIWDRIPLKYESSNRNFANNVIDVLP 117

Query: 124 SPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVN-DIIDIHMAHNSNTDEYLLMINGVYK 182
             I+FV ++ ++ + PY    + WR  D+    N + +DIH+  N   D+  +  NG Y 
Sbjct: 118 KLIRFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYA 177

Query: 183 LTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTE 242
           + + P S  EN   ++ K +   +   +HCFY D   ST +L  L++S P V LL  +  
Sbjct: 178 ILL-PVSDIEN--EKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMV 234

Query: 243 MKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHW 300
           +K+L  Y++ H++ I+ +L  P  DF++           L   LK   L G +   L+ W
Sbjct: 235 IKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDW 294

Query: 301 LCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALP-ASG 359
           LCN VGEKN K+WK L    YQK +Q+ +LA +P  E++ +   + + ++ A ++     
Sbjct: 295 LCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXX 354

Query: 360 HMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN 419
              +L   + L + +  L N  L       ++E     F++W  D I E +DEDY PK  
Sbjct: 355 XXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFE 414

Query: 420 ICEDGSVVPTLMEIIDQFFQD-TTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLK 478
             +D      L+   ++F  D  T+  S     L ++L+ S++   ++I  + V   + +
Sbjct: 415 FEDDPYFGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQR 474

Query: 479 TMKIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVEKRSNTQDVKASVK------YI 531
            + ++  A  F++ +    + +LD    +K  ++VYL++        +AS++      YI
Sbjct: 475 QVLVQSRADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYI 534

Query: 532 GTANSINLRTISAAKKVNYPLSIDSASIQKVKF 564
           GT    +L  +S    +  P    S  +   +F
Sbjct: 535 GTLKDESLDIVSRESSIKMPELFKSYDLNSARF 567

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  241 bits (614), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 155/583 (26%), Positives = 282/583 (48%), Gaps = 23/583 (3%)

Query: 8   LVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFND 67
            + YNP +P    +T+ G A+ R  D  ++  I IRN++ V    W++    +L++ F D
Sbjct: 9   FIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKD 68

Query: 68  GSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIK 127
           G+ RIHDIF++G+L++ LR+       +  G W ++ +  +   G    +I   +P  I+
Sbjct: 69  GTIRIHDIFKDGRLVSFLRIP---STKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIR 125

Query: 128 FVNNAGQLEVVPYVVTQTQWRNVDK-PLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQ 186
           +V ++ ++ +VPY    + WR  D+   E N+ +DIH+  N   D+  +  NG Y + + 
Sbjct: 126 YVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFV- 184

Query: 187 PNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQL 246
           P   DEN   +  K I   +   +HCFY D    T++L  L+ S P +++L  +  +K+L
Sbjct: 185 PVGADEN--ERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKEL 242

Query: 247 HRYIVDHLDIIDNDLKKPLDDFLEVTNIL-----NIKDLSKSLKSFILYGLMAKSLNHWL 301
             Y+++H++ I+ +L  P   +LE  N L         L   L+   L G ++  L  WL
Sbjct: 243 IGYLLNHIEFINRELVTP---YLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWL 299

Query: 302 CNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPAS-GH 360
           CN VGEKN K+WK L    YQK  QI++L  +PA E++ +   +   ++ A ++      
Sbjct: 300 CNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFND 359

Query: 361 MQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI 420
             +L   D+L + +  L    L       ++E     F +W+ D I E +DEDY  K+  
Sbjct: 360 SSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQF 419

Query: 421 CEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTM 480
            +D      L+           +        L ++L+ S+SD  + I  S V + + + +
Sbjct: 420 EDDPYFGYDLLTYFHNISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHI 479

Query: 481 KIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVE--KRSNTQDV--KASVK--YIGT 533
            +      +++ +    + + D     K+ +++YL++  ++ +TQ+   + S++  YIGT
Sbjct: 480 LVESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGT 539

Query: 534 ANSINLRTISAAKKVNYPLSIDSASIQKVKFLFEKQNNCLTLI 576
               NL  IS    +  P   +  S    +F+ +K  N +  I
Sbjct: 540 LKDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREI 582

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  239 bits (609), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/573 (27%), Positives = 276/573 (48%), Gaps = 18/573 (3%)

Query: 4   LTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTV 63
           + +  + YNP +P    + + G A+ R  D  +I  I +RN+  V    W+     +L++
Sbjct: 5   INDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSI 64

Query: 64  MFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMP 123
            F DG+ RIHDIF++G+L++ LR+       +  GIW ++ ++++ +   F  ++  ++P
Sbjct: 65  FFKDGTVRIHDIFKDGRLVSFLRVP---STKISRGIWDRIPLKREYDSETFAYNVIDILP 121

Query: 124 SPIKFVNNAGQLEVVPYVVTQTQWRNVDK-PLEVNDIIDIHMAHNSNTDEYLLMINGVYK 182
             I+FV ++ ++ +VPY      WR  D+   E  +I+D+H+  N   D+  +  NG Y 
Sbjct: 122 KLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYT 181

Query: 183 LTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTE 242
           + + P    EN    L  ++ ++    +HCFY D    T++L  L+ S P V LL+ +  
Sbjct: 182 ILL-PMDDIEN-ERILESVVKVQD-GFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMV 238

Query: 243 MKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHW 300
           +K+L  Y++ H+++I+ +L  P  DF++           L   L+   L G ++  L  W
Sbjct: 239 IKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDW 298

Query: 301 LCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALP-ASG 359
           LCN VGEKNLKKWK L    YQK  QI++L  +P  E++ +   +    + A ++   S 
Sbjct: 299 LCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSN 358

Query: 360 HMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN 419
           +  +L   + L + +  L N  L         E     F +W  D I E +DEDY  K  
Sbjct: 359 NTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFE 418

Query: 420 ICEDGSVVPTLMEIIDQFFQ-DTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLK 478
             +D      L+   D+     +T+  S     L + L+ ++SD  ++I  + V   + +
Sbjct: 419 FEDDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQ 478

Query: 479 TMKIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVE--KRSNTQDVKASVK----YI 531
            + I      +++ +    V +LD        ++VYL+E  K  NT++V +       Y+
Sbjct: 479 QLLINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYV 538

Query: 532 GTANSINLRTISAAKKVNYPLSIDSASIQKVKF 564
           GT    +L  IS    +  P +  + S    +F
Sbjct: 539 GTLKDESLDIISRESSIRIPEAFKNYSFSNARF 571

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  218 bits (554), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 142/478 (29%), Positives = 249/478 (52%), Gaps = 38/478 (7%)

Query: 4   LTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTV 63
           + ++ V YNP YP  + + + GF+V R  DD +I  I++R+M  V    W+     +L++
Sbjct: 1   MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI 60

Query: 64  MFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEV---RQKPNEGEFDRDISG 120
            + DG+ RI+D FR G+L++LLR          +GIW ++E+    +   +   D D++ 
Sbjct: 61  FYKDGTVRIYDGFRSGRLVSLLR---ASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTE 117

Query: 121 LMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHM--AHNSNTDEYLLMIN 178
           +MP  +KF  ++ QL VVPY +    WR      + N ++D H+   H+S +    +M +
Sbjct: 118 MMPKMVKFARDSRQLCVVPYTLPSDVWRP-QAADDTNALLDAHVIRCHDSLS----VMFD 172

Query: 179 GVYKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLN 238
           G + ++IQ  +      + L K +  +    +  FY+D      DL  L++    + LL 
Sbjct: 173 GEFTISIQLAAI----PSPLVKFVSAQHQ--YLAFYQDGSVERFDLANLVKDPFSLRLLK 226

Query: 239 VLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKD-LSKSLKSFILYGLMAK 295
            +  M+QLHRY+ DH+++I  DL +P D+FLE          D L + L   +L G +  
Sbjct: 227 NVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTP 286

Query: 296 SLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVA--- 352
            L  WL N +GEKNLK+W++L    Y K +Q+++LA LPA E+L  L  RC   +++   
Sbjct: 287 ELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQL 346

Query: 353 -IALPASGHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVD 411
            + LP    +  L++F  LK    A+ +         S +++    F+ W  D + E +D
Sbjct: 347 TLQLPLLPPIDCLQFF--LKNVLEAIAS--------LSSQQRLLGSFLDWFDDRVRESID 396

Query: 412 EDYVPKLNICEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDS 469
           EDY  + N+ ++ S+ P     +    ++++ E S+  +DL+ + L S +D + ++DS
Sbjct: 397 EDYKLRFNLHDNSSLGPDTASYLQLRLRNSSPEFSS-VSDLTHS-LASTTDCVSSLDS 452

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  210 bits (534), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 117/420 (27%), Positives = 227/420 (54%), Gaps = 30/420 (7%)

Query: 11  YNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSA 70
           YNP +   + ++  G AV R +D +Q+  I I++ D V    W+++   +++V   DG+ 
Sbjct: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73

Query: 71  RIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIKFVN 130
           RI+DIF+ G+L++ +R     QK +D+ +W + E         FD +I   +P+ IKFV 
Sbjct: 74  RIYDIFKNGRLVSYIRSSS--QKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFVK 131

Query: 131 NAGQLEVVPYVVTQTQWRNV-------DKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKL 183
           ++  + ++ Y      WR+V       DK ++  +++D+H+ HN N D + +++NGVY++
Sbjct: 132 DSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYEI 191

Query: 184 T--IQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLT 241
              + P+     + +++++++ L     +  FYK+     I+   L+       LL+ + 
Sbjct: 192 NGIVMPDI----SKSEVYQLLKLHNGE-YMSFYKNGHYRKINFNNLLSCNVSNGLLSNIL 246

Query: 242 EMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNI----LNIKDLSKSLKSFILYGLMAKSL 297
           E++ L+RY+ DHLD+I  +L  P  DF++   I      +  L+  L+S +L G +    
Sbjct: 247 EIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEF 306

Query: 298 NHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPA 357
             WL N++G++N KKW++L    ++KI++I++LA++P+ E+  +   R +  +       
Sbjct: 307 KDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL------- 359

Query: 358 SGHMQ-ELEYFD--SLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDY 414
           +G+M+ + +++D  SL+   + L   ++ I    + + K   +F  WI D I E  DEDY
Sbjct: 360 NGYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDY 419

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  211 bits (536), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 146/560 (26%), Positives = 267/560 (47%), Gaps = 27/560 (4%)

Query: 16  PAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSARIHDI 75
           P  + + +    V R  DD+ I    IR+   V++  W++ G   ++VMF DGS RI+D+
Sbjct: 20  PLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIRINDV 79

Query: 76  FREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDI-SGLMPSPIKFVNNAGQ 134
             + KL+ LLR Q   +  +D  +W ++ +  +    E+D DI +  +P  +KF+ +   
Sbjct: 80  MYDAKLVALLRTQ---RTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFMGSDAS 136

Query: 135 LEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTI-QPNSTDEN 193
             + PY+ T   WR  +       I+D+H  H    D  + ++NG Y+L +  P+  D++
Sbjct: 137 PSMSPYLPTNHSWRFPNSG-AAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQS 195

Query: 194 ASNQLHKIIHL--EKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIV 251
              +L KII     K  +++C+YK      +DLT  +E    + LL      +    Y +
Sbjct: 196 ---ELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFL 252

Query: 252 DHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGEKN 309
            HL+ I  +  +P  +F+E    +    + L +SL    L G M + L  WL   +GE+N
Sbjct: 253 AHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGERN 312

Query: 310 LKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPAS--GHMQELEYF 367
           L++WK L  T Y++  Q++ + ++P  E+L +L  + +ALV+   L     G   E+  F
Sbjct: 313 LEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEISEF 372

Query: 368 DSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNICEDGSVV 427
             L      L    L   ++ +++ K   VF+LW+++++   +++DY P  N+ E G   
Sbjct: 373 TDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECGKFG 432

Query: 428 PTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTMKIRGTAR 487
                 +    +    +K+    D S+ +++   D L  +D+ YVR++LL  + +     
Sbjct: 433 FLFTSGLALTLE--PAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKVIVGDPIP 490

Query: 488 SFTENFDED-VTILDIFYCAKYP-FLVYLVEKRSNTQDVKASVKYIGTANSINLRTISAA 545
                + E  VT+LDI   A +P +L+YL    SN  +V           +I+ ++   A
Sbjct: 491 LLNSYYIEHFVTLLDIAQVAAHPAYLIYLCRNMSNRSEV--------LLGAIDCQSNKVA 542

Query: 546 KKVNYPLSIDSASIQKVKFL 565
             +  P +     I+ V+ +
Sbjct: 543 TDIKLPYNHAEMDIEGVRIM 562

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  209 bits (531), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 130/432 (30%), Positives = 220/432 (50%), Gaps = 18/432 (4%)

Query: 11  YNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSA 70
           YNP Y     K + G ++ R  D+ +I  + +R+++ +    W+      +TV + DG+A
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 71  RIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIKFVN 130
           RI+D F+ GKL+ LLR+    +  +D  IW ++E+ ++    +FD  +   MP  I+F  
Sbjct: 71  RIYDAFQAGKLLALLRIS---KTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFAR 127

Query: 131 NAGQLEVVPYVVTQTQWR----NVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQ 186
           +  Q+ ++PY      WR      D      +I+D+H+ H  + +  +LM++G + L + 
Sbjct: 128 DTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQED-NGLVLMLDGDFILRLA 186

Query: 187 PNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQL 246
                   S    K I +    ++HCFY+D    ++ L  L++    + L+     +KQL
Sbjct: 187 -----AGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQL 241

Query: 247 HRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNV 304
           + Y+ DHLD+I  DL  P  +FL          + L + L+S +L G ++  L +W C  
Sbjct: 242 NHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCYT 301

Query: 305 VGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASGHMQEL 364
           VGEKN KKWK++    YQK IQI++L+ +PA E++ LLS RC A + A+ L  S    + 
Sbjct: 302 VGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTDS 361

Query: 365 EYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI---C 421
             F +L   +       +   Q  S +E     F+ W  D + E +DEDY  KL+I   C
Sbjct: 362 SEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNC 421

Query: 422 EDGSVVPTLMEI 433
           + G  + T +++
Sbjct: 422 KIGYQIATYLDL 433

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  164 bits (415), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 110/424 (25%), Positives = 213/424 (50%), Gaps = 30/424 (7%)

Query: 12  NPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSAR 71
           NP Y    +K+  G A+    D + +  I I++   V+   W+S    +L   FNDGS R
Sbjct: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74

Query: 72  IHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGE--FDRDISGLMPSPIKFV 129
           ++DIF+ G+L++  R      KC+    W ++ + +  ++    FD D++  MP+ +KFV
Sbjct: 75  VYDIFKLGRLVSFFRSPLKQIKCV---YWDRIIITETLDQQLKIFDYDLTNSMPTLVKFV 131

Query: 130 NNAGQLEVVPYVVTQTQWRNVDKPLEV-----------NDIIDIHMAHN-SNTDEYLLMI 177
            +   L++VP +     WR +D  L +           +D++DIH+ +  S  D + +++
Sbjct: 132 KDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAVLV 191

Query: 178 NGVYKLTIQPNSTDENASNQ-LHKIIHLEKTAI--FHCFYKDRKTSTIDLTTLMESTPHV 234
           NGVY L+      D +  N+  +K+I L K +   +  FY++     ID+T    +   V
Sbjct: 192 NGVYDLS------DIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRV 245

Query: 235 SLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNI---LNIKDLSKSLKSFILYG 291
           +LLN   +++     + + ++II  +L  P + F+ +  +       +L +S+ + +L G
Sbjct: 246 NLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305

Query: 292 LMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVV 351
            +++    WL N +GE+NL+KWK L      K++QI+SL  +P  EK  + + R +  + 
Sbjct: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365

Query: 352 AIALPASGHMQELEY-FDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECV 410
           A+ L  +  + E +   + L    + +   ++      + ++    +FI WI++ I+  +
Sbjct: 366 AMRLSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTIYLII 425

Query: 411 DEDY 414
           DE+Y
Sbjct: 426 DENY 429

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  161 bits (407), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 199/412 (48%), Gaps = 19/412 (4%)

Query: 12  NPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSAR 71
           NP+ P  L K+  G  V RT D + I+   IRN + +I   W +   NY+ + F  G+  
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 72  IHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGE---FDRDISGLMPSPIKF 128
           I+D  +  +L+ +L   +G +  +D GIW +      PN+ E   FD DI+  MP+ I+ 
Sbjct: 73  IYDGIKTSRLLAML---NGGKPNVDAGIWDRYYF---PNDNEKDIFDSDITLYMPTLIQI 126

Query: 129 VNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPN 188
           + +  ++    Y    + WR   +    N+ +DIH+ H+S  D +  ++NG  KL    N
Sbjct: 127 IRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSN 186

Query: 189 STDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHR 248
           ST    S +   II  E    F CFY+D     ID   L++   +  L++    +  L +
Sbjct: 187 ST----SGRAIGIIKGENNC-FICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLK 241

Query: 249 YIVDHLDIIDNDLKKPLDDFL-EVTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGE 307
           Y+ +H+  I +++  P ++FL  V      + + ++L + ++ G ++  L  W+ N +G 
Sbjct: 242 YLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGI 301

Query: 308 KNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIAL----PASGHMQE 363
           KNL +W  L    Y+K + II+L V+PA E+  +L  R + L+  + +       G    
Sbjct: 302 KNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLN 361

Query: 364 LEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYV 415
             Y +++K        +AL + ++   +++    F+ W  + +   V ++ V
Sbjct: 362 SSYIENVKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDEAV 413

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  160 bits (406), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 116/424 (27%), Positives = 206/424 (48%), Gaps = 31/424 (7%)

Query: 6   EELVSYNPSYPA-KLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVM 64
           +  + YNP Y    + + ++   +RRT D+  IVKI +RN+  ++   W+     YL + 
Sbjct: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67

Query: 65  FNDGSARIHDIFREGKLMTLLRLQD---GFQK-CMDTGIWSKLEVRQKPNEGEF---DRD 117
             DGS RI+DIF  GKL++ LR+     G  K  +D  +W ++ +  K    E    + D
Sbjct: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRI-IIPKSGSSELRIPNND 126

Query: 118 ISGLMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMI 177
           ++  MP+ +KFV +A Q++++P       WR++        ++D+H+ ++ ++ +  ++I
Sbjct: 127 LTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGN--NEKKVVDVHLGYSCSSAQVTILI 184

Query: 178 NGVYKLTIQPNSTDENASNQLHKIIHLEKT------AIFHCFYKDRKTSTIDLTTLMEST 231
           NG Y   I+ + +D    NQ+ K I +         AI+   + D     IDLT ++ + 
Sbjct: 185 NGEY--LIEKSVSD---INQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLND 239

Query: 232 PHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILYG 291
             + L+    +M      I DH ++I+  +  P  +FLE  +I  I DL   L+   L G
Sbjct: 240 DKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLE--SIGGINDLD-VLERLFLIG 296

Query: 292 LMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVV 351
            +   L +W    + EKNLKKW RL    Y    Q++ +  +P  E+L +L+ R   ++ 
Sbjct: 297 ELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIK 356

Query: 352 AIALPASGHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSV-FILWIQDLIFECV 410
            I L  S   QE    D       +  N  L +  + +E+E      F+ W+ D ++E +
Sbjct: 357 GIDLQES---QETSLLDI--SELQSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESI 411

Query: 411 DEDY 414
           + +Y
Sbjct: 412 NNEY 415

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/511 (23%), Positives = 224/511 (43%), Gaps = 28/511 (5%)

Query: 9   VSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDG 68
           V +NP     L       +V R  D  +I  + +R    +I   W         + F +G
Sbjct: 19  VVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNG 78

Query: 69  SARIHDIFREGKLMTLLRLQDGFQKC---MDTGIWSKLEVRQKPNEGE-FDRDISGLMPS 124
           + RI+D    G L  ++ L D  Q     +DT +WS  +  Q   E +  + +I+  +P 
Sbjct: 79  AVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPG 138

Query: 125 PIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLT 184
            ++ V +A QL VVP    + +W  +  P        I + H+  + +YL+ ++G+  + 
Sbjct: 139 MVRLVRDAKQLSVVPLETGKLRW--LADP---GKDAAIFLGHDEKSGDYLMTVDGLLSVR 193

Query: 185 IQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMK 244
           + P+        ++HKI+   +   F     D     + L   + S     L+    +++
Sbjct: 194 V-PSGI-----KKMHKILRQGEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQIR 246

Query: 245 QLHRYIVDHLDIIDNDLKKPLDDFL-EVTNILNIKDLSKSLKSFILYGLMAKSLNHWLCN 303
            L  Y+ +++++   DL +P   FL  + +     +L+   +  IL G + + L  WLCN
Sbjct: 247 FLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDLEDWLCN 306

Query: 304 VVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASG--HM 361
            +G+KN K+WK+LS   Y  +  +++LAV+PA E+L L + + + +   + L   G    
Sbjct: 307 SIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASP 366

Query: 362 QELEYFDSLKRTTA--ALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN 419
           QE E  +  +  T   AL + +L +    + + +  ++F  W  D++ E VDEDY    N
Sbjct: 367 QEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQN 426

Query: 420 ICEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISD---TLENIDSSYVRNML 476
                         +DQ+      E S   T   + L +  +D   +   +D  Y R  +
Sbjct: 427 RDSHQDCYGDRALALDQYISHCW-ENSEVWTRFERLLPQLAADADISATKLDHIYTRAWV 485

Query: 477 LKTMKIRGTARSFTENFDEDVTILDIFYCAK 507
           L+ + +    R+   +    V +LD+  C K
Sbjct: 486 LEQVHVTSPVRACDVD---SVEVLDVQACNK 513

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  139 bits (351), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 113/418 (27%), Positives = 194/418 (46%), Gaps = 27/418 (6%)

Query: 9   VSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDG 68
           V +NP     L  T    AV R  D  QI  + +R+   ++   W    S    V  ++G
Sbjct: 19  VVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNG 78

Query: 69  SARIHDIFREGKLMTLLRLQDGFQKC---MDTGIWSKLEVRQKPNEGE-FDRDISGLMPS 124
             RI+D    G L  ++ L +  Q     +D  +W  +E  + P      D DI+ LMP 
Sbjct: 79  VVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPG 138

Query: 125 PIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLT 184
            ++ V ++ QL + P  + +  W +     +  D   I +AH+  + EY++ I+G  +L+
Sbjct: 139 MVRLVRDSKQLSLAPLDLGKLSWLDG----KYGDAA-IFLAHDCESTEYMVAIDG--QLS 191

Query: 185 IQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTL--MESTPHVSLLNVLTE 242
           ++  S   N    +HKI+    +  F    KD    T+   TL  +E      L+    +
Sbjct: 192 LRFPSGIRN----VHKILPQGGSGSFLAVGKD---GTLQWVTLKFLECALMRELVKSSGQ 244

Query: 243 MKQLHRYIVDHLDIIDNDLKKPLDDFL-EVTNILNIKDLSKSLKSFILYGLMAKSLNHWL 301
           ++ L RY+ +++ +   +L +P   FL  +       DL+  L+  +L G +   L  WL
Sbjct: 245 IRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWL 304

Query: 302 CNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPA---- 357
           CN VG+KN K+WK+LS   Y  +  +++LAV+PA E+L L + R + +  ++ L      
Sbjct: 305 CNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKD 364

Query: 358 -SGHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDY 414
            +G +  +E   +L      L    LN+  + + +     VF  W  D++ E VDEDY
Sbjct: 365 YAGELTTVE-LQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDY 421

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 101/428 (23%), Positives = 183/428 (42%), Gaps = 31/428 (7%)

Query: 6   EELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMF 65
           E+ + +NP     L  T  G AV R  D  +I  + +++   ++   W         V  
Sbjct: 15  EQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCH 74

Query: 66  NDGSARIHDIFREGKLMTLLRLQDG----FQKCMDTGIWSKLEVRQKPNEGEFDRDISGL 121
           ++G  R++D    GK +  + L D      + C     W+            FD +I+ L
Sbjct: 75  SNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWT----FGSKFSNVFDHEITSL 130

Query: 122 MPSPIKFVNNAGQLEVVPYVVTQT--QWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMING 179
           MP  +KFV ++ QL ++P  V     +W  +D          I + ++S   + L+ I+G
Sbjct: 131 MPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSF-----IFLGYDSKRQKILMAIDG 185

Query: 180 VYKLTIQ-------PNSTDENAS--NQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMES 230
            +KL+             DE  S  N +  I+  +    +     D     I    L  +
Sbjct: 186 AFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGE-YLVITDDWYIQKIKFDFLNCN 244

Query: 231 TPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILY 290
                +++    ++ LH+ + + + ++  +L +P   F+E        DL   L   +  
Sbjct: 245 LTR-EMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTELLFT 303

Query: 291 GLMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALV 350
           G +   L  WL N +G+KNL++WK+LS   Y+  ++I+ L ++P  E+L L   R   ++
Sbjct: 304 GSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGII 363

Query: 351 VAIALPASGHMQE-LEYFDSLK---RTTAALCNQALNITQKTSEEEKKCSVFILWIQDLI 406
             + L     +++ LE  ++ K    +  AL N  ++I Q   +       FI W  D++
Sbjct: 364 KGLKLIGLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLH-EAFIDWFHDMV 422

Query: 407 FECVDEDY 414
            E VDEDY
Sbjct: 423 MEAVDEDY 430

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 106/258 (41%), Gaps = 33/258 (12%)

Query: 160 IDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKT 219
           IDI MA +S T++ +L I G   + +            + +II +  +  + C  KD   
Sbjct: 157 IDIFMAIDSKTNKLILSIEGTLNIKV---GEKLKLPKDIKRIIKVS-SGKYMCLGKDWSY 212

Query: 220 STIDLT--------TLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEV 271
             +DLT         L+++T   S L  L  +KQLHR    HL +    L +P  +F+E 
Sbjct: 213 QVLDLTFLQDPNIYKLIKTTQEYSAL--LRYLKQLHR----HLRM---KLTEPYFEFVET 263

Query: 272 TNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGEK-NLKKWKRLSETKYQKIIQIISL 330
              L  ++   +L+     G+    +   L  V  +   L KW  LS       I ++  
Sbjct: 264 ---LLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVA 320

Query: 331 AVLPALEKLSLLSIRCEALVVAIA---LPASGHMQELEYFDSLKRTTAALCNQALNITQK 387
             +P LE++ +L+   EAL  AI     P      E+     L+  T        + T  
Sbjct: 321 CTIPLLERMIVLAASIEALCEAITWIKFP-----NEIWVGSKLRERTVETLKSVRSQTDS 375

Query: 388 TSEEEKKCSVFILWIQDL 405
             + +K   + ++WI+ L
Sbjct: 376 IMKNKKTQELGLMWIRSL 393

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 65/343 (18%), Positives = 133/343 (38%), Gaps = 37/343 (10%)

Query: 38  VKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSARIHDIFREGKL---------------M 82
           + + +R  + ++   W         V    GS +I+     G+L                
Sbjct: 49  IPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIY----RGRLDPEGTEGSEGAELVGT 104

Query: 83  TLLRLQDGFQKCMDTGIWSKLEVR-QKPNEGEFDRDISGLMPSPIKF-VNNAGQLEVVPY 140
            +L   D FQ  M+  +W++++ R ++P  GEFD  +   +P   +  ++  G+L   P 
Sbjct: 105 VVLGRGDAFQ--MEQFVWNRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPL 162

Query: 141 VVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASNQLHK 200
                +W       E N    + +  ++NT + +L I+G +       S       ++  
Sbjct: 163 GYEGPEWNAGLAADESN----MFLTFDNNTRKVVLSIDGTFNFRYGEKS---KFPTKVTS 215

Query: 201 IIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDND 260
           I+   +        +D +   I L        H  L+   + ++ L +YI D+  +I   
Sbjct: 216 ILPGNENHYVFINDEDWQLQVIRLEFTEYHQVH-ELMKCCSHIQFLLKYIRDNHRLIGTK 274

Query: 261 LKKPLDDFLEVTNILNIKDLSKSLKS----FILYGLMAKSLNHWLCNVVGEKNLKKWKRL 316
           L +P   F    ++   +  +K +K     F L     K++ +W    +G      WK+ 
Sbjct: 275 LMEPHATF--TGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQR 332

Query: 317 SETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASG 359
           +   +     ++   ++PA E+L + + R   LV ++ L   G
Sbjct: 333 NHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFG 375

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 57/275 (20%), Positives = 115/275 (41%), Gaps = 24/275 (8%)

Query: 95  MDTGIWSKLEVRQKPN-EGEFDRDISGLMPSPIKF-VNNAGQLEVVPYVVTQTQWRNVDK 152
           M+  +W++++ + +   +G+FD  ++  +P   +  V+  G+L   P      +W     
Sbjct: 115 MEQFVWNRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLS 174

Query: 153 PLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTI-QPNSTDENASNQLHKIIHLEKTAIFH 211
             E N    + + +++ T + ++ I+G +     + N      +N L         A  +
Sbjct: 175 ENESN----MFLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNIL------SGNANNY 224

Query: 212 CFYKDR--KTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFL 269
            F  D   +   I L    ES     L+   ++++ L +Y+ D+  II   L +P   F+
Sbjct: 225 VFLNDEDWQLQIIKLE-FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFI 283

Query: 270 EVTNIL----NIKDLSKSLKSFILYGLMA-KSLNHWLCNVVGEKNLKKWKRLSETKYQKI 324
              N L        L K LK     G  A K++ +W    +G   +  WK+ +   +   
Sbjct: 284 ---NSLFPDEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSS 340

Query: 325 IQIISLAVLPALEKLSLLSIRCEALVVAIALPASG 359
             I+   ++PA E+L +   R + L+ ++ L   G
Sbjct: 341 QGILVTCMIPACERLIVAVKRLQGLIKSLKLNIFG 375

>KNAG0D03750 Chr4 complement(682937..685384) [2448 bp, 815 aa] {ON}
           Anc_4.76 YGL036W
          Length = 815

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 489 FTENFDEDVTILDIFYCAKYPFLVYLVEKRSNTQDVKASVKYIGTANSINLRTISAAKKV 548
           +TE+   DV  + + YC+ +PFL  LV +R+  +  K   + +GT  +  +R  +  K V
Sbjct: 74  YTESTQLDVVAVLVAYCSVFPFLQPLV-RRNAHKWTKIPSRCVGTRRTEGVRVFTVLKIV 132

Query: 549 NYPLSIDSASIQKVKF 564
           +   S+D    Q  KF
Sbjct: 133 SQFSSLDDELFQFYKF 148

>KAFR0F03290 Chr6 complement(647353..649665) [2313 bp, 770 aa] {ON}
           Anc_4.138 YGR003W
          Length = 770

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 29/109 (26%)

Query: 80  KLMTLLRLQDGFQKCMDTGIWSKLEVRQ--------------KPNEGEFD--------RD 117
           KL  LLR +D F+    T + SK  ++Q              K N G F         RD
Sbjct: 433 KLFKLLREKDAFENTY-TQLLSKRLIQQRSALHMERFMVKQIKDNMGSFFTSKMEGMLRD 491

Query: 118 ISG---LMPSPIK-FVNNAGQLEVVPYVVTQTQW--RNVDKPLEVNDII 160
           +S    L  S  K FVN+  ++E VP V+T T W   N+++ ++ ND+I
Sbjct: 492 MSTSIVLSKSFYKNFVNDKEKIEFVPQVLTMTSWPFENINELIDENDVI 540

>SAKL0F16434g Chr6 (1348589..1350778) [2190 bp, 729 aa] {ON} some
           similarities with uniprot|P32319 Saccharomyces
           cerevisiae YBL017C PEP1 Type I transmembrane sorting
           receptor for multiple vacuolar hydrolases cycles between
           the late-Golgi and prevacuolar endosome-like
           compartments
          Length = 729

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 16/78 (20%)

Query: 58  SNYLTVMFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRD 117
           S+++T +F+D SA+I          T++   +GF        WSKL +    ++G +  D
Sbjct: 372 SSFITTIFSDESAKIS---------TVISFDNGF-------TWSKLRIVDPEHKGGYSCD 415

Query: 118 ISGLMPSPIKFVNNAGQL 135
           I  L    ++   N G L
Sbjct: 416 IDDLESCSLQIYGNEGSL 433

>YOR208W Chr15 (733925..736177) [2253 bp, 750 aa] {ON}
           PTP2Phosphotyrosine-specific protein phosphatase
           involved in the inactivation of mitogen-activated
           protein kinase (MAPK) during osmolarity sensing;
           dephosporylates Hog1p MAPK and regulates its
           localization; localized to the nucleus
          Length = 750

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (47%), Gaps = 8/123 (6%)

Query: 139 PYVVTQTQWRN-VDK-PLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASN 196
           P++V Q Q++N +D   +++NDII +H   NS        I  + K   +P+  D+N S 
Sbjct: 592 PFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNS- 650

Query: 197 QLHKIIHLEKTAIFHCFYKDRKTS---TID--LTTLMESTPHVSLLNVLTEMKQLHRYIV 251
           +LH         + HC     +T    T+D  L+ L  +T H + ++V    + L   IV
Sbjct: 651 ELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIV 710

Query: 252 DHL 254
           + L
Sbjct: 711 NEL 713

>KLTH0H04840g Chr8 complement(431325..432656) [1332 bp, 443 aa] {ON}
           similar to uniprot|P34163 Saccharomyces cerevisiae
           YKL140W TGL1 Steryl ester hydrolase one of three gene
           products (Yeh1p Yeh2p Tgl1p) responsible for steryl
           ester hydrolase activity and involved in sterol
           homeostasis localized to lipid particle membranes
          Length = 443

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 148 RNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQ 186
           R V + +  NDI+DI MAH  +  E+L+     Y LT+ 
Sbjct: 51  RLVKEVVHANDILDIAMAHGFDVQEHLVRTQDGYLLTVH 89

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 9   VSYNPSYPAKLYKTS--YGFAVRRTRDDTQIVKIVIRNMDAV----IATC-WNSFGSNYL 61
           +S+NP+   KL   S     A+   ++++ + K  ++  D+V    +  C WN F SN  
Sbjct: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261

Query: 62  TVMFNDGSARIHDIFREGKLMTLLRLQDGF 91
             +  D + ++HD   +  ++  ++  D F
Sbjct: 262 ASVSEDSTLQLHDQREQNTIINSIKTTDPF 291

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,311,573
Number of extensions: 2929216
Number of successful extensions: 10432
Number of sequences better than 10.0: 80
Number of HSP's gapped: 10804
Number of HSP's successfully gapped: 81
Length of query: 612
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 496
Effective length of database: 40,180,143
Effective search space: 19929350928
Effective search space used: 19929350928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)