Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B037808.272ON58958926770.0
TDEL0F039908.272ON6313851441e-08
NDAI0J012808.272ON6943821431e-08
Skud_4.3798.272ON759811332e-07
Smik_4.3638.272ON765891234e-06
YDR119W (VBA4)8.272ON768781207e-06
KAFR0B054508.272ON625841208e-06
Suva_2.2798.272ON775811153e-05
SAKL0H16808g8.272ON657711101e-04
Kwal_26.6669singletonON5901261082e-04
Kwal_56.237548.272ON5891771037e-04
Kpol_543.448.272ON64379970.004
AGR076C8.272ON686108960.005
KLTH0G13464g8.272ON593112930.011
ZYRO0C01430g8.272ON590113900.031
TPHA0A017508.272ON636112900.032
Ecym_42988.272ON67860810.33
Skud_7.1716.155ON496147780.69
SAKL0A02926gna 1ON572122742.1
SAKL0F16478gsingletonON49566742.4
Kwal_14.16256.155ON506136706.2
Suva_7.1636.155ON496149706.3
KLTH0H05698g6.155ON503104697.5
KLLA0A04631g8.272ON579180699.7
NOTE: 2 genes in the same pillar as NCAS0B03780 were not hit in these BLAST results
LIST: TBLA0F03040 KNAG0H03180

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B03780
         (589 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...  1035   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    60   1e-08
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    60   1e-08
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...    56   2e-07
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...    52   4e-06
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...    51   7e-06
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    51   8e-06
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...    49   3e-05
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    47   1e-04
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    46   2e-04
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    44   7e-04
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    42   0.004
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    42   0.005
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    40   0.011
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    39   0.031
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    39   0.032
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    36   0.33 
Skud_7.171 Chr7 complement(313034..314524) [1491 bp, 496 aa] {ON...    35   0.69 
SAKL0A02926g Chr1 complement(267564..269282) [1719 bp, 572 aa] {...    33   2.1  
SAKL0F16478g Chr6 (1357813..1359300) [1488 bp, 495 aa] {ON} weak...    33   2.4  
Kwal_14.1625 s14 (395421..396941) [1521 bp, 506 aa] {ON} YBR241C...    32   6.2  
Suva_7.163 Chr7 complement(303502..304992) [1491 bp, 496 aa] {ON...    32   6.3  
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    31   7.5  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    31   9.7  

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/589 (87%), Positives = 514/589 (87%)

Query: 1   MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPEESTPLLKT 60
           MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPEESTPLLKT
Sbjct: 1   MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPEESTPLLKT 60

Query: 61  SNHETSTPAEKEMPDKRDLKFPAPSFSTQYRNMALNIQDASAAQDPVPLPTEELRQQXXX 120
           SNHETSTPAEKEMPDKRDLKFPAPSFSTQYRNMALNIQDASAAQDPVPLPTEELRQQ   
Sbjct: 61  SNHETSTPAEKEMPDKRDLKFPAPSFSTQYRNMALNIQDASAAQDPVPLPTEELRQQITS 120

Query: 121 XXXXXXXXXXXXXXXLYARTTDGYGSIHGQSSNTSDIDLHVDTESSAPQADLMTCXXXXX 180
                          LYARTTDGYGSIHGQSSNTSDIDLHVDTESSAPQADLMTC     
Sbjct: 121 SDTTTIYTDNNTTSSLYARTTDGYGSIHGQSSNTSDIDLHVDTESSAPQADLMTCVKSKL 180

Query: 181 XXXXXXXXXFMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFALIGLTLSALIEYPKL 240
                    FMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFALIGLTLSALIEYPKL
Sbjct: 181 LLTVLSLGLFMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFALIGLTLSALIEYPKL 240

Query: 241 CTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAIGAALIIYTTFTTNLMAHELCK 300
           CTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAIGAALIIYTTFTTNLMAHELCK
Sbjct: 241 CTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAIGAALIIYTTFTTNLMAHELCK 300

Query: 301 KYVYYLISMLGAVCGTITSGVFCDLWRKIYIIPTILAIIQIVLLFLYFPLDDITNKDEIS 360
           KYVYYLISMLGAVCGTITSGVFCDLWRKIYIIPTILAIIQIVLLFLYFPLDDITNKDEIS
Sbjct: 301 KYVYYLISMLGAVCGTITSGVFCDLWRKIYIIPTILAIIQIVLLFLYFPLDDITNKDEIS 360

Query: 361 ISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQA 420
           ISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQA
Sbjct: 361 ISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQA 420

Query: 421 RYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIMANTKNMRDF 480
           RYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIMANTKNMRDF
Sbjct: 421 RYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIMANTKNMRDF 480

Query: 481 AVGILVGGSATIILCQGLFTRTLHDTLRDNXXXXXXXXXXXXXXXXXXXXXXXNPQWALI 540
           AVGILVGGSATIILCQGLFTRTLHDTLRDN                       NPQWALI
Sbjct: 481 AVGILVGGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLKKKELLKILEKTIKNPQWALI 540

Query: 541 DAPAITRGAITNSFALAIHQXXXXXXXXXXXXXXXXXXXXTHSDDNEAQ 589
           DAPAITRGAITNSFALAIHQ                    THSDDNEAQ
Sbjct: 541 DAPAITRGAITNSFALAIHQIFLSLLVISIFIIISSCLVSTHSDDNEAQ 589

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 91/385 (23%), Positives = 147/385 (38%), Gaps = 97/385 (25%)

Query: 1   MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPEESTPLLKT 60
           MG+KDKQR KLREF + K+ Q+  +N +                       EE+ PL+  
Sbjct: 1   MGKKDKQRNKLREFTRQKQLQQAKKNDML----------------------EETRPLVAP 38

Query: 61  SNHETSTPAEKEM--PDKRDLKFPAPSFSTQYRNMALNIQDASAAQDPVPLPTEELRQQX 118
           S+ E   P E  +  P K ++                 +QD S   D      EE+ QQ 
Sbjct: 39  SSAE---PIEASLLLPIKPEI-----------------LQDPST--DLPGFVAEEIGQQ- 75

Query: 119 XXXXXXXXXXXXXXXXXLYARTTDGYGSIHGQSSNTSDIDLHVDTESSAPQADLMTCXXX 178
                                  +GYGSI      T   D    +E     A+ ++    
Sbjct: 76  -------------------EEVANGYGSI------TDPHDGDNKSERPVSTAEEISGARL 110

Query: 179 XXXXXXXXXXXFMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFALIGLTLSALIEYP 238
                      F+   + + +   S+ + S F++ S+++  + +S+ L   T   L  Y 
Sbjct: 111 RVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSW-IATSYLLSSATFQPL--YG 167

Query: 239 KLCTL---KSSIIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAIGAALIIYTTFTT---- 291
           K+  +   K  ++  NVAF++G L+   SK ++   + R +  +G   +   +  T    
Sbjct: 168 KVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSSITITDL 227

Query: 292 -----NLMAHELCKKYVYYLISMLGAVCGTITSGVFCD---LWRKIYIIPTILAIIQ--I 341
                  M   +C   V+Y    LG  CG I  G F D    WR  ++I   L+ I   +
Sbjct: 228 VPLRERAMYQGICN--VFY---GLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAISLLV 282

Query: 342 VLLFLYFPLDDITNKDEISISRKNL 366
           ++L L  P    T   + SI RK L
Sbjct: 283 IILHLKLPSKRATRNQDNSIKRKLL 307

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 5/146 (3%)

Query: 329 IYIIPTILAIIQIVLLFLYFPLDDITNKDEISISRKNLLDLLPNMFSMLALIATLIYLPV 388
           + +I ++L+ +  + + L    D I     ++I R  L   L N F M+A + T  YLP+
Sbjct: 344 LMLISSLLSCLVFIYVELRVAADPILPLRFLAI-RSVLGSSLSNWFCMMATMTTSYYLPI 402

Query: 389 YSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARYAKK----YNTSLLGSLVGLIGYYQLY 444
           Y + V N S   +  R++P + S+    L    Y KK    Y  SL+   V ++G  Q+ 
Sbjct: 403 YFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQIL 462

Query: 445 SLDKSTPDWFHFVAGCIPLIGVTSVI 470
            +D   P W  ++   +P +G + +I
Sbjct: 463 LIDPKIPTWRQYILLLVPGVGTSVLI 488

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 90/382 (23%), Positives = 150/382 (39%), Gaps = 37/382 (9%)

Query: 1   MGRKDKQRKKLREFAKLKEKQRL------------LENKIHHATPNGTQKPTSELNT--V 46
           MGRKDKQRK+LR+FAKLKEKQR             L+NK+   + N   +   E  T  +
Sbjct: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60

Query: 47  QQLEPEESTPLLKTSNHETSTPAEKEMPDKRDLKFPAPSFSTQYRNMALNIQDASAAQDP 106
           +  +  E TPLL     E    A  E      LK        +    +L  Q      D 
Sbjct: 61  EDNDSTELTPLLLKKQSENHI-AVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDD 119

Query: 107 VPLPTEELRQQXXXXXXXXXXXXXXXXXXLYART-TDGYGSI-----HGQSSNTSDIDLH 160
             L  E  R Q                   + +  +  YGSI     H + + T ++   
Sbjct: 120 NQLIEEPSRPQSSREEISSSASTNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEV--- 176

Query: 161 VDTESSAPQADLMT-CXXXXXXXXXXXXXXFMIFFEFSAMIELSSFILSGFDRFSQLALS 219
           VD E++     L+                 F I F+F+  + LS+   S   + S  +  
Sbjct: 177 VDLETNNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSNSSWI 236

Query: 220 LGSSFALIGLTLSALIEYP---KLCTLKSSIIAGNVAFVVG-SLLIFNSKLYFSFGLGRC 275
           + S   LI + +S L+      K    K+    G + F++G S+L   +  ++   + R 
Sbjct: 237 IAS--YLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARF 294

Query: 276 INAIGAALIIYTTFTTNLMAHELCKKYV-----YYLISMLGAVCGTITSGVFCDLWRKIY 330
           I  + +  +IY   T  +    L K++       + I ++G +     + +F   W+ +Y
Sbjct: 295 ILGLASGSLIYVMLTI-INKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQNVY 353

Query: 331 IIPTILAIIQIVLLFLYFPLDD 352
            +  I +   + L+  YFP ++
Sbjct: 354 FLLAIFSFFTLFLIMFYFPSNE 375

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 76/179 (42%), Gaps = 28/179 (15%)

Query: 349 PLDDITNKDEISISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPI 408
           PLD I NK             L   F+ ++LI  + Y P Y     N S   +  R  P+
Sbjct: 454 PLDFIENK-------VIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPM 506

Query: 409 YLSMFAVVLIQARYAKKYNTSLLG-----SLVGLIGYYQLYS-LDKSTPD---WFHFVAG 459
           +L++  +++  +R     NT   G      ++GLIG   L + +   T D   W   + G
Sbjct: 507 FLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIG 566

Query: 460 CIPLIGVTSVIMANTKNMRD-----------FAVGILVGGSATIILCQGLFTRTLHDTL 507
            +P++G T +++A   ++ D           FAV  L G    I +   +F + L+D L
Sbjct: 567 ILPILGSTFLVIATLMDVTDDKKLPIISTSSFAVSTL-GSILGICISGFIFNQGLYDEL 624

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
          (REAL)
          Length = 759

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 1  MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSE--------LNTVQQLEPE 52
          MG+KD+QRKKLREFAKLK +Q+ L+N + +   N  Q+   E        +   +  E +
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQQKLQNSVQNL-KNEVQREVGESENPNPIAIENDKSEENK 59

Query: 53 ESTPLLKTSNHETSTPAEKEM 73
          E+TPLL TS+        K +
Sbjct: 60 ENTPLLLTSSERREDDGSKPL 80

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 4/134 (2%)

Query: 374 FSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSM----FAVVLIQARYAKKYNTS 429
           F   AL+  + +   Y TIV N + LQ++ R+LP + S+    F+V        + Y   
Sbjct: 533 FCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLK 592

Query: 430 LLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIMANTKNMRDFAVGILVGGS 489
            + S V LI Y  L  +  S P W  +V   +P +G + ++   +    ++        S
Sbjct: 593 FVLSGVTLILYITLMGVGLSLPVWKQYVCLSLPFLGSSMLLTLLSSLYHEYHEQRKSLNS 652

Query: 490 ATIILCQGLFTRTL 503
            +I+ C G    T+
Sbjct: 653 GSIVYCFGAIGGTI 666

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
          (REAL)
          Length = 765

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 15/89 (16%)

Query: 1  MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPT-SELNTVQQLEPE------- 52
          MG+KD+QRKKLREFAKLK +QR L+  + +      QK   SE   + QLE +       
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQRNLKESVQNLKKEVQQKAVCSEHLDLVQLENDKSEEIND 60

Query: 53 ------ESTPLLKTSNHETSTPAEKEMPD 75
                E+ PLL T   +      K +PD
Sbjct: 61 ESEEINENVPLLSTHGGQKEEKVSK-VPD 88

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
          of unknown function with proposed role as a basic amino
          acid permease based on phylogeny; GFP-fusion protein
          localizes to vacuolar membrane; physical interaction
          with Atg27p suggests a possible role in autophagy;
          non-essential gene
          Length = 768

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 1  MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQL--------EPE 52
          MG+KD+QRKKLREFAKLK +QR L   +     N  Q+      T  Q+        E  
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQRNLRKSV-QTLKNEVQREAKVPRTSNQIALGNDKIEEIN 59

Query: 53 ESTPLLK--TSNHETSTP 68
          E++PLL   +   E S P
Sbjct: 60 ENSPLLSAPSKQEEVSIP 77

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 9/149 (6%)

Query: 337 AIIQIVLLFLYFPLDDITNKDEISISRKNLLDLLPNM----FSMLALIATLIYLPVYSTI 392
            II   +LF      D      IS+S +    L+  M    F   AL+  + +   Y  I
Sbjct: 491 VIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFII 550

Query: 393 VWNESYLQLSIRVLPIYLSM----FAVVLIQARYAKKYNTSLLGSLVGLIGYYQLYSLDK 448
           V N S LQL+ R+ P + S+    F+V        + +    + S   L+ Y  L  +  
Sbjct: 551 VLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVSL 610

Query: 449 STPDWFHFVAGCIPLIGVTSVIMANTKNM 477
           + P W  ++   +P +G +S+I+    N+
Sbjct: 611 NLPVWKQYICLSLPFLG-SSMILTLLSNL 638

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
          {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 22/84 (26%)

Query: 1  MGRKDKQRKKLREFAKLKEKQRL---------------------LENKIHHATPNGTQKP 39
          MG+KDKQRK+LR+F +LKE QRL                     LE K++   P   ++P
Sbjct: 1  MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP 60

Query: 40 TSELNTVQQ-LEPEESTPLLKTSN 62
            EL  +++  E    +P L TSN
Sbjct: 61 DHELQRIKKGTESCLFSPKLTTSN 84

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
          (REAL)
          Length = 775

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 11/81 (13%)

Query: 1  MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELN-------TVQQLEPEE 53
          MG+KD+QRKKLREFAKLK +Q+ L   +        +K  +  N        +++ E  E
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFGNLKREEASE 60

Query: 54 STPLLKTSNHETSTPAEKEMP 74
          ++PLL       S P E   P
Sbjct: 61 NSPLLPA----PSEPREGSGP 77

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 8/138 (5%)

Query: 336 LAIIQIVLLFLYFPLDDITNKDEISISRKNLLDLLPNM----FSMLALIATLIYLPVYST 391
             II   +LF +   ++      IS+S +    L+  +    F   AL+  + +   Y T
Sbjct: 507 FVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTIMGISFCFAALMCIIPFGTTYFT 566

Query: 392 IVWNESYLQLSIRVLP----IYLSMFAVVLIQARYAKKYNTSLLGSLVGLIGYYQLYSLD 447
           IV N S LQ++ R+LP    I +  F+V        K Y   ++   V LI Y  L    
Sbjct: 567 IVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMKNYLLEVVLGGVTLILYIALMGAS 626

Query: 448 KSTPDWFHFVAGCIPLIG 465
            S P W  +V   +PL+G
Sbjct: 627 LSLPVWKQYVCLSLPLLG 644

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
          {ON} weakly similar to uniprot|Q04602 Saccharomyces
          cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 4  KDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPEESTPLLKTSNH 63
          K+KQRKKL+ F KLKE+QR L N           K   + N    +EP E+TP L+    
Sbjct: 8  KNKQRKKLQAFVKLKERQRQLLND--------EPKVVIQQNPAHSIEPTETTPFLQPIRR 59

Query: 64 ETSTPAEKEMP 74
          E       ++P
Sbjct: 60 ELVLDPTSDLP 70

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 4/113 (3%)

Query: 362 SRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQAR 421
           +R  L   L N FSM+ ++ T  +LPVY   V N     +  R +P + S     L    
Sbjct: 398 NRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGY 457

Query: 422 YAK---KYNTSLLG-SLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI 470
           Y K   KY   L+    + ++G  Q+  ++ +   W  ++   IP  G++ +I
Sbjct: 458 YMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLI 510

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 11/126 (8%)

Query: 349 PLDDITNKDEISISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPI 408
           P+  + NK+ +  S       L N F M+ ++    YLP+Y + V N+  +Q+  + +P 
Sbjct: 339 PISFLRNKNVLGSS-------LANWFCMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPS 391

Query: 409 YLSMFAVVLIQARYAKK----YNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLI 464
           + SM       A Y +K    Y   +   L+ + G  Q+  +    P W  ++   +P  
Sbjct: 392 FFSMALGSFGTAYYVQKNGTYYRLLMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGF 451

Query: 465 GVTSVI 470
           GV+ +I
Sbjct: 452 GVSILI 457

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 10/177 (5%)

Query: 298 LCKKYVYYLISMLGAVCGTITSGVFCDLWRKIYIIPTILAIIQIVLLFLYFPLDDITNKD 357
           +C  +++ L+S LG       S +F  L     ++ +I A ++     LY  +D +    
Sbjct: 284 VCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVE-----LYVAVDPVLPIA 338

Query: 358 EISISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSM----F 413
            +   R  L   L N F+M++++ T  YLPVY   V N     +  R +P + S+     
Sbjct: 339 FLKY-RSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSL 397

Query: 414 AVVLIQARYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI 470
              +   R  K Y   L    +G++G  ++  L  +TP W  ++   +P  G++ +I
Sbjct: 398 GAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLI 454

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
          (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MGRKDKQRKKLREFAKLKEKQRLLENKIHHATP---NGTQKPTSELNTVQQL--EPEEST 55
          MG+KDKQRKKLR F K K KQ   + +     P   +GT+     L    QL  E +E++
Sbjct: 1  MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENS 60

Query: 56 PLLKTSNHETSTPAEKEMP 74
           LL   +     P+  E+P
Sbjct: 61 VLLPIRDELLQDPS-TELP 78

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%)

Query: 363 RKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARY 422
           R  L   L N F M+AL+    YLP+Y   V N     +  R++P + S     L    Y
Sbjct: 393 RSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYY 452

Query: 423 AKK 425
            KK
Sbjct: 453 MKK 455

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 47/108 (43%), Gaps = 4/108 (3%)

Query: 362 SRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQAR 421
           +R  L   L N F M+ ++ T  Y+PVY   V N     +  R++P + S     L    
Sbjct: 405 NRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGY 464

Query: 422 YAK---KYNTSLLG-SLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIG 465
           Y K   KY   LL   LVG++G  Q+  +  S   W  +    IP  G
Sbjct: 465 YMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFG 512

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 2  GRKDKQRKKLREFAKLKEKQRLLENK 27
          G K KQR +LREFAK KE+QR L  +
Sbjct: 7  GLKTKQRDRLREFAKRKERQRALAGQ 32

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 11/113 (9%)

Query: 247 IIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAIGAALI-----IYTTFTTNLMAHELCKK 301
           ++  N+ F +G+L+   SK  +   LGR +  IG   +     I TT    L +  L + 
Sbjct: 208 LVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQG 267

Query: 302 YVYYLISMLGAVCGTITSGVFCDL---WRKIYI--IPTILAIIQIVLLFLYFP 349
                   LG  CG +  G+F D    WR  ++  +P  L     + LFL  P
Sbjct: 268 ICNVFFG-LGTACGGLVGGLFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLP 319

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 4/112 (3%)

Query: 363 RKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSM----FAVVLI 418
           R  L   L N F M++++ T  YLPVY + V       +  R +P + S+        L 
Sbjct: 347 RSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLY 406

Query: 419 QARYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI 470
             R  K Y   L   ++ + G  Q+  +    P W  ++   +P  GV+ +I
Sbjct: 407 MKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLI 458

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 362 SRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQAR 421
           +R  L     N F M+A++ T  YLP+Y + V N +  ++  R++P + S     L    
Sbjct: 344 NRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGY 403

Query: 422 YAKK----YNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI 470
           Y K+    Y  ++    + L+G+ Q+  +      W  F+   IP  G + +I
Sbjct: 404 YMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLI 456

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 48/112 (42%), Gaps = 4/112 (3%)

Query: 363 RKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARY 422
           R  L   L N F+M+ L+    YLP+Y T V       +  R LP + S+    L    Y
Sbjct: 374 RSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYY 433

Query: 423 AKK----YNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI 470
            KK    Y       LV +IG  Q+Y ++     W  ++   +P +G   +I
Sbjct: 434 MKKTGKYYWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLI 485

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
          similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 2  GRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPE---ESTPLL 58
          G K K+R +L+EFAKLK +QR L++     T  G +  T       +   E   E+ P L
Sbjct: 7  GIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQGETIPFL 66

>Skud_7.171 Chr7 complement(313034..314524) [1491 bp, 496 aa] {ON}
           YGL104C (REAL)
          Length = 496

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 64/147 (43%), Gaps = 34/147 (23%)

Query: 220 LGSSFA-----LIGLTLSALIEYPKLCTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGR 274
           LGS FA     + G   S+L+     CTL           +VGSL+IFNS  Y S  +GR
Sbjct: 104 LGSYFATSFANIYGRKFSSLMN----CTLN----------IVGSLIIFNSNTYKSLIIGR 149

Query: 275 CINAIGAALIIYTTFTTNLMAHELCKKYVYYLISMLGAVC---GT-ITSGVFCDL----- 325
            +  I    +I    T  L   E+       L+  +  +C   G  +T GV   L     
Sbjct: 150 VLVGISCGALI---VTIPLFIKEVAPNGWEGLLGSMTQICIRLGVLLTQGVALPLTDSYR 206

Query: 326 WRKIYIIPTILAIIQIVLLFLYFPLDD 352
           WR I     ++A++    LF++F +D+
Sbjct: 207 WRWILFGSVLIAVLN---LFMWFKVDE 230

>SAKL0A02926g Chr1 complement(267564..269282) [1719 bp, 572 aa] {ON}
           similar to uniprot|P39709 Saccharomyces cerevisiae
           YAL067C SEO1 Putative permease member of the allantoate
           transporter subfamily of the major facilitator
           superfamily mutation confers resistance to ethionine
           sulfoxide
          Length = 572

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 23/122 (18%)

Query: 297 ELCKKYVYYLISMLGAV--CGTITSGVFCDL--------WRKIYIIPTILAIIQIVLLFL 346
           E+ ++  +Y +     +   G I S VF  L        WR  +II  I++I+  +L F 
Sbjct: 247 EMVRRSAFYYLGQYAGILSAGGIQSAVFASLDGVNGLSGWRWNFIIDAIVSIVIGILGFY 306

Query: 347 YFPLDDIT------NKDEISISRKNLL-------DLLPNMFSMLALIATLIYLPVYSTIV 393
             P D           DEI ++RK L        D    +F +      +    VY   +
Sbjct: 307 MLPGDPYNCYSIFLTDDEIRLARKRLKENNTEKSDFASKVFDLEVWKRIVFDWKVYILTL 366

Query: 394 WN 395
           WN
Sbjct: 367 WN 368

>SAKL0F16478g Chr6 (1357813..1359300) [1488 bp, 495 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260w TNA1
          Length = 495

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 311 GAVCGTITSGVFC-------DLWRKIYIIPTILAIIQIVLLFLYFPLDDITNKDEISISR 363
           GA  G I +G+         + WR +YII  +++I   V LF   P DD+ N   ++   
Sbjct: 193 GAFGGLIATGLASVKKTGGLEGWRWLYIIEGLISICACVWLFFGLP-DDVNNMKFLNERE 251

Query: 364 KNLLDL 369
           K L+++
Sbjct: 252 KQLMEI 257

>Kwal_14.1625 s14 (395421..396941) [1521 bp, 506 aa] {ON} YBR241C -
           Hypothetical ORF [contig 238] FULL
          Length = 506

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 27/136 (19%)

Query: 255 VVGSLLIFNSKLYFSFGLGRCINAI--GAALIIYTTFTTNLMAHELCKKYVYYLISMLGA 312
           V+GSL++F +  Y S  +GR I  I  G+ +++     T L  +E+  K +   +  +  
Sbjct: 122 VIGSLILFRANSYASLLIGRLIVGISCGSCIVV-----TPLFINEISPKELRGSLGSMNQ 176

Query: 313 VCGTITSGV---------FCD--LWRKIYIIPTILAIIQIVLLFLYFPLDDITNKDEISI 361
           VC  I  G+         + D   WR + +    LA+IQ +LLF          +  + +
Sbjct: 177 VC--INIGILLTQLLALRYADSYRWRWLMLAGAGLALIQFLLLF-------AIEESPLWL 227

Query: 362 SRKNLLDLLPNMFSML 377
           + +  LD   N+ S+L
Sbjct: 228 ASRGDLDGAENVLSIL 243

>Suva_7.163 Chr7 complement(303502..304992) [1491 bp, 496 aa] {ON}
           YGL104C (REAL)
          Length = 496

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 66/149 (44%), Gaps = 38/149 (25%)

Query: 220 LGSSFA-----LIGLTLSALIEYPKLCTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGR 274
           LGS FA     + G   S+L+     CTL           ++GSL+IFNS  Y S  +GR
Sbjct: 104 LGSYFAASLANIYGRKFSSLMN----CTLN----------IIGSLIIFNSNSYRSLIIGR 149

Query: 275 CINAI--GAALIIYTTFTTNLMAHELCKKYVYYLISMLGAVC---GT-ITSGVFCDL--- 325
            +  I  GA ++I   F       E+       L+  +  +C   G  +T GV   L   
Sbjct: 150 FLVGISCGALIVIIPLFI-----KEVAPSGWEGLLGTMTQICIRLGVLLTQGVALPLTDS 204

Query: 326 --WRKIYIIPTILAIIQIVLLFLYFPLDD 352
             WR I     ++A++    LF++F +D+
Sbjct: 205 YRWRWILFGSFLIAVLN---LFMWFKVDE 230

>KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} similar
           to uniprot|P53142 Saccharomyces cerevisiae YGL104C VPS73
           Mitochondrial protein involved in vacuolar protein
           sorting
          Length = 503

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 20/104 (19%)

Query: 255 VVGSLLIFNSKLYFSFGLGRCINAI--GAALIIYTTFTTNLMAHELCKKYVYYLISMLGA 312
           ++GSLL+F +  Y     GR I  I  G+ +++     T L  +E+  K +   +  +  
Sbjct: 121 IIGSLLLFRANSYAQLIAGRFIAGISCGSCIVV-----TPLFINEISPKELRGSLGSMNQ 175

Query: 313 VCGTITSGV---------FCD--LWRKIYIIPTILAIIQIVLLF 345
           VC  I  G+         + D   WR + +   ILA+IQ +LLF
Sbjct: 176 VC--INVGILLTQLLALKYADSYRWRWLMLAGAILALIQFLLLF 217

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 73/180 (40%), Gaps = 24/180 (13%)

Query: 302 YVYYLISMLGAVCGTITSGVFCDLWRKIYIIPTILAIIQIVLLFLY------FPLDDITN 355
           + + L S LG       S +F     K+ ++ TIL+    + + LY       P+  +TN
Sbjct: 279 FAFMLASSLGGKEIPYNSNIF-----KLLVVATILSGTAFIYVELYISDDPILPIRFLTN 333

Query: 356 KDEISISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAV 415
           +  +  S         N F M++ +    Y+PVY + V N     +  R+ P + S  A 
Sbjct: 334 RSILGAS-------FANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFST-AF 385

Query: 416 VLIQARYAKKYNTSLLGSLV---GL--IGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI 470
             I A Y  K      G L+   GL  +G  Q+  +      W  ++   +P  G + +I
Sbjct: 386 GSIGAGYYMKKTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLI 445

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,909,441
Number of extensions: 1965439
Number of successful extensions: 8092
Number of sequences better than 10.0: 77
Number of HSP's gapped: 8435
Number of HSP's successfully gapped: 90
Length of query: 589
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 474
Effective length of database: 40,294,809
Effective search space: 19099739466
Effective search space used: 19099739466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)