Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B007808.774ON47247223950.0
NDAI0E006308.774ON49049515550.0
KAFR0D014908.774ON44347013620.0
Kpol_1010.138.774ON49950013430.0
CAGL0A03828g8.774ON47647613121e-178
TPHA0G012108.774ON49450013081e-177
TDEL0B033508.774ON42647312651e-172
Smik_15.4828.774ON42546712631e-172
YOR301W (RAX1)8.774ON43546412621e-171
ZYRO0F12232g8.774ON42646712421e-168
Skud_15.4688.774ON42346412211e-165
SAKL0B05456g8.774ON43246811731e-158
KNAG0G031008.774ON46348711221e-150
TBLA0D008408.774ON57758110631e-139
Suva_8.3528.774ON46742910511e-139
KLTH0H15070g8.774ON43847310361e-137
KLLA0F24904g8.774ON42446210131e-134
Kwal_34.159438.774ON43245910011e-132
AFR532W8.774ON4224729591e-126
Ecym_14768.774ON4534878931e-115
TBLA0H034508.514ON42066751.1
Smik_4.5945.383ON151036698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00780
         (472 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.7...   927   0.0  
NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {O...   603   0.0  
KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.7...   529   0.0  
Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {O...   521   0.0  
CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...   509   e-178
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...   508   e-177
TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {O...   491   e-172
Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301...   491   e-172
YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Prote...   490   e-171
ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...   483   e-168
Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301...   474   e-165
SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} simila...   456   e-158
KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.7...   436   e-150
TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.7...   414   e-139
Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W ...   409   e-139
KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} simi...   403   e-137
KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]...   394   e-134
Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {...   390   e-132
AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic ...   374   e-126
Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar t...   348   e-115
TBLA0H03450 Chr8 (842545..843807) [1263 bp, 420 aa] {ON} Anc_8.5...    33   1.1  
Smik_4.594 Chr4 (1062328..1066860) [4533 bp, 1510 aa] {ON} YDR33...    31   8.1  

>NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.774
           YOR301W
          Length = 472

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/472 (95%), Positives = 452/472 (95%)

Query: 1   MVPNKMEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMT 60
           MVPNKMEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMT
Sbjct: 1   MVPNKMEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMT 60

Query: 61  HLRLCKDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEG 120
           HLRLCKDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEG
Sbjct: 61  HLRLCKDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEG 120

Query: 121 HFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXX 180
           HFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDD                    
Sbjct: 121 HFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDSNRNRSSNNNSNSNNNNLSS 180

Query: 181 ILDDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLI 240
           ILDDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLI
Sbjct: 181 ILDDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLI 240

Query: 241 QRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKS 300
           QRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKS
Sbjct: 241 QRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKS 300

Query: 301 QASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTI 360
           QASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTI
Sbjct: 301 QASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTI 360

Query: 361 VPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFI 420
           VPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFI
Sbjct: 361 VPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFI 420

Query: 421 FGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           FGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV
Sbjct: 421 FGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472

>NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {ON}
           Anc_8.774 YOR301W
          Length = 490

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/495 (60%), Positives = 366/495 (73%), Gaps = 33/495 (6%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           ME D++KIQTERLPTLYEVL+QKT+ PVDLWSFYTFLSQFPYAINYLDFW+DLM HLRLC
Sbjct: 1   MELDYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWIDLMAHLRLC 60

Query: 66  KDYVDGIRESLVVNNERQGNSSL-----LNNEHAQQVEADA----------------DDS 104
           KDY+ GIRES+  N     NS +       +E + Q E  +                DD+
Sbjct: 61  KDYISGIRESITYNQNEARNSRIRHHLQYTSEESIQHETQSIQHHDDPEGGDEDDDDDDN 120

Query: 105 ASVRTSVLLNALLEEGHFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXX 164
            SV TSVLLNALL+EGH D  NP  VSQ LQG   +SPKL+QL++DW RHS   +D    
Sbjct: 121 ISVTTSVLLNALLDEGHLDFENPERVSQFLQGNTEYSPKLSQLLEDWKRHSIANNDSNRK 180

Query: 165 XXXXXXXXXXXXXXXX------ILDDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSP 218
                                 ++DDIL++QSQ EE+ K+TTKQLLN+ALKICS+YL SP
Sbjct: 181 GSLNRNNSNVRSRETNGAALPDVVDDILRKQSQQEERAKITTKQLLNNALKICSIYLQSP 240

Query: 219 EQSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHN 278
           E+SERYLTN+PD++RLKA+NL+Q   RHDP+VF+ELKS+++QFLE+DCFPKFLSTVALHN
Sbjct: 241 ERSERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKSIAFQFLEMDCFPKFLSTVALHN 300

Query: 279 IHDEISDWRFHAHSTGGNRNKSQASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGV 338
           IHDEISDWRFH+++   N  +   SL    +++  HISKSPFSTYT LSR +FGLLWLG+
Sbjct: 301 IHDEISDWRFHSNARSHNLTRVDKSL----IKNHDHISKSPFSTYTLLSRTIFGLLWLGI 356

Query: 339 GFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVT 398
           GFWIGYTLIFLKYDRGIRVVTIVPF IG+YF++CG+Y+VDI+YSWFG+TQRLLYK  +  
Sbjct: 357 GFWIGYTLIFLKYDRGIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLLYKHNEKN 416

Query: 399 EDGYDGNVPVDVKESKD-KIPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLIST 457
            D  D  V +D K  K+  +  I  +LGGR+RLI ++HPFI+  L +RGLWC  LVL+ST
Sbjct: 417 RDA-DREVQMDEKNGKNHHVSGILALLGGRSRLIRIEHPFIKNILMKRGLWCLFLVLLST 475

Query: 458 GVFTVVFSCVPGHRV 472
           G+FTV+FSCVPG+R+
Sbjct: 476 GIFTVIFSCVPGYRI 490

>KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.774
           YOR301W
          Length = 443

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/470 (54%), Positives = 335/470 (71%), Gaps = 30/470 (6%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           ME DF KIQ ERLPTLYEVL+QKT  PVDLWSFYT+LSQFPYAINYLDFW+DLM HLRL 
Sbjct: 1   MELDFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWIDLMAHLRLS 60

Query: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLT 125
           KDY++GIR SL+   E    + L N + +Q+ +    ++ SV TSVLLNAL+EEGH D  
Sbjct: 61  KDYINGIRGSLL---EESNFNELENQQSSQEDQNSNSENVSVTTSVLLNALMEEGHLDFE 117

Query: 126 NPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDI 185
           NP  VS+ LQG+ ++SPKL+QL+D W RHS   D                     +LD++
Sbjct: 118 NPDRVSKFLQGKADYSPKLSQLLDGWKRHSGIYD-------ANNNLNIDNGNLPTLLDEM 170

Query: 186 LKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSR 245
           LK +S+  E  ++TTKQLLN+AL+IC+ YL S E+S +YL+NI +E R+K ++ +   +R
Sbjct: 171 LKNKSKRNETSQITTKQLLNNALQICNTYLYSTEKSAKYLSNISEETRMKVLDSVVNQNR 230

Query: 246 HDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLT 305
           +DPEVF+ELK+ +YQ LE DCFPKFLSTVALHNIHDE+SDWRFH+               
Sbjct: 231 YDPEVFEELKATTYQLLETDCFPKFLSTVALHNIHDELSDWRFHSEKGA----------- 279

Query: 306 EKDLESMRHI-SKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFC 364
             D  ++R+  S+SPFS +TTLSR++FGL+WLG+GFWIGY LIFLKY R IRVVT+VPF 
Sbjct: 280 -IDNTTLRYRGSRSPFSNHTTLSRLIFGLVWLGIGFWIGYVLIFLKYSRAIRVVTVVPFA 338

Query: 365 IGSYFVVCGLYQVDILYSWFGITQRLLYK--DRKVTEDGYDGNVPVDVKESKDKIPFIFG 422
           IG Y ++CG+YQVDI+YSWFG+TQ L YK  D K+     + +       +K+K+PF+  
Sbjct: 339 IGCYLIICGMYQVDIIYSWFGVTQVLTYKDSDSKILRSNDEEHTT-----TKEKVPFLIA 393

Query: 423 ILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           +LGG  R ++++H FI+K L +RGLWC LLV+IST +FTV+FSCVPG R+
Sbjct: 394 LLGGGKRTVKIEHTFIKKLLQRRGLWCLLLVVISTAIFTVIFSCVPGFRI 443

>Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {ON}
           complement(27385..28884) [1500 nt, 500 aa]
          Length = 499

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/500 (50%), Positives = 349/500 (69%), Gaps = 42/500 (8%)

Query: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68
           DF++IQ ERLPTLYEVL+QKT +PVDLWSFYTFLSQFP+A+NYL+FW+DLM+H+RLCKDY
Sbjct: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65

Query: 69  VDGIRESLVVNNER---QGNSSLLNNEHAQQVEADAD------------DSASVRTSVLL 113
           + GIRES+++ NE    +  S +  N     +E + D            D+ SV +S+L+
Sbjct: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125

Query: 114 NALLEEGHFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXX 173
           +AL++EG+ D  NP  V++ LQG + +SP+L+QL+DDW RHS  +D              
Sbjct: 126 DALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDN 185

Query: 174 XXXXXXXILDDILKRQSQL-EEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEV 232
                   +D +L+  +++ +E+P+VT K LL +A  ICSLYL+SPE+SE+YL N+P+ +
Sbjct: 186 KIVSA---VDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHI 242

Query: 233 RLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHA-- 290
           R + + L++   RHDPEVF+ ++S++YQFLEIDCF KFL+ VALHNIHD+ISDW++H   
Sbjct: 243 RNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVK 302

Query: 291 -HSTGGNR---------------NKSQASLTE--KDLESMRHISKSPFSTYTTLSRIMFG 332
            HS   N                N S AS  E   ++E  RH S+SPFS YTT+SRI FG
Sbjct: 303 PHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFG 362

Query: 333 LLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLY 392
             W+G+GFWIGY LIFL Y+RGIRVVTIVPF IGSYF+VCG+YQVD++YSWFG+TQ L++
Sbjct: 363 TFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMF 422

Query: 393 KDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLL 452
           + +   E+  +G+ P+++ ++   +P I  +LGG++RLI + H FIR  LF+RGLWCC +
Sbjct: 423 RHKSSDEE--NGH-PMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479

Query: 453 VLISTGVFTVVFSCVPGHRV 472
           + IST +FTV+FSCVPG RV
Sbjct: 480 ITISTAIFTVIFSCVPGRRV 499

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score =  509 bits (1312), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 247/476 (51%), Positives = 326/476 (68%), Gaps = 18/476 (3%)

Query: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68
           DF++IQ +RLPTLYEV + KT  PVDLWSFYT+LSQFPYAINYLDFW+DLM H+RLCKDY
Sbjct: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66

Query: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128
           V  +R+S+V  +  +   +L    +  +   + D+ ASV TS+L+N LL EG+ D  NP 
Sbjct: 67  VSTVRQSVVQGSALEEFRNLDERSNVNR-HMNNDEDASVTTSILMNTLLSEGYLDFENPE 125

Query: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXX------XXXXXXXXXIL 182
            VSQ LQG  + SP + ++I DW  H++                              I+
Sbjct: 126 KVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIV 185

Query: 183 DDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQR 242
           D+ LKRQSQL EK  +TTKQL N+A +IC+ YL+S + S RYL NIPD+++ + ++  + 
Sbjct: 186 DEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKA 245

Query: 243 NSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQA 302
           N RHDPEVF ELK V+YQFLE DCFPKFL  VALHNIHDE+SDWRFH  +   +R  S  
Sbjct: 246 NRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSS-P 304

Query: 303 SLTEKDLESMR-----HISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRV 357
           S ++++L   +     HIS SPFSTYT+LSR++FG +W+G+GFWIGY LIFL Y R IRV
Sbjct: 305 SGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRV 364

Query: 358 VTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVT-EDGYDGNVPVDVKESKDK 416
            T+VPF +G Y++VCG+YQVDI+YSWFG+TQRL+Y  +K   E+G      V      D 
Sbjct: 365 TTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQ----VYGATYNDD 420

Query: 417 IPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           +P IF +LGG++RLI ++HPFI+K L++RGLWC  LV+I T +FTV+F CVPG R+
Sbjct: 421 VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score =  508 bits (1308), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 259/500 (51%), Positives = 344/500 (68%), Gaps = 39/500 (7%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           M  DFEK+Q ERLPTLYEVL+ KT  PVDLWSFYTFLSQFP+AINYL+FW+DLM H+RLC
Sbjct: 1   MAIDFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWIDLMAHIRLC 60

Query: 66  KDYVDGIRESL--VVNNER----QGNSSLLNNEHAQQVEA------------DADDSASV 107
           KDY++ IR S+  VV+  R     GN +   +    + E+            DADDSASV
Sbjct: 61  KDYLENIRSSVIEVVDESRVSDEYGNLTTAGDHRKHKEESSSDRYGPGGNDGDADDSASV 120

Query: 108 RTSVLLNALLEEGHFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQ---------NV 158
            +S+L+NAL+ EG+ D  +P  V++ LQG + +SP+L+QL+ +W RHS          N 
Sbjct: 121 TSSLLINALMNEGYLDFQDPDQVNRFLQGDIEYSPQLSQLLAEWRRHSGIPGKRNDDVNE 180

Query: 159 DDXXXXXXXXXXXXXXXXXXXXILDDILKR----QSQLEE--KPKVTTKQLLNSALKICS 212
            +                     +DD+LK     Q+   E  KP++TTKQL ++A +IC+
Sbjct: 181 SEIDENTGEKKNQVGYENKILSAIDDLLKNHVSGQNNAGETIKPQITTKQLHHNAAQICT 240

Query: 213 LYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLS 272
           LYLLSPE+S++YL NIP+ VR   +  IQ + R+DP+VF+ELK++SYQFLEIDCF KFL 
Sbjct: 241 LYLLSPERSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKNISYQFLEIDCFTKFLG 300

Query: 273 TVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKDLESMRHISKSPFSTYTTLSRIMFG 332
            VALHN+HD+ISDWRFH  ST    N+     T +  + +RH S+S FS+YTTLSR+M G
Sbjct: 301 RVALHNLHDQISDWRFHNSSTRFLPNEE----THEKKKQLRHHSRSLFSSYTTLSRVMLG 356

Query: 333 LLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLY 392
           L ++G+GFWIGY LIFL Y RGIRVVTIVPF IGSYF+VCG+YQ+DI Y+ FGITQ L+Y
Sbjct: 357 LFFMGIGFWIGYALIFLNYARGIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGITQELMY 416

Query: 393 KDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLL 452
           K ++  ++  + +  ++ K+   +I  +F ILGG+ RLI++KHPFIR  +++RGLWC L 
Sbjct: 417 KHKRSPDEETNHSDNLEAKDG--EISGLFKILGGQTRLIKIKHPFIRNLIYKRGLWCLLW 474

Query: 453 VLISTGVFTVVFSCVPGHRV 472
           VLISTGVFTV+F+CVP  RV
Sbjct: 475 VLISTGVFTVIFACVPSRRV 494

>TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {ON}
           Anc_8.774 YOR301W
          Length = 426

 Score =  491 bits (1265), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 331/473 (69%), Gaps = 49/473 (10%)

Query: 2   VPNKMEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTH 61
           + + ME D+E+IQ ERLPTLYEVL+Q T+APVD W FYT+LSQFPYAI+YLDFW+DLM H
Sbjct: 1   MKDPMEQDYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWIDLMAH 60

Query: 62  LRLCKDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGH 121
           +RLCKDYV G+RES+  N         + + +  +V  + DD+ SV +SVLL+ALL EG+
Sbjct: 61  IRLCKDYVKGVRESVEFNET-------IASRNRDEVNIE-DDNESVSSSVLLDALLNEGY 112

Query: 122 FDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXI 181
            D  N   VSQ LQG  N SP++++L+D W R S   D                     +
Sbjct: 113 LDFQNTKRVSQFLQGDTNDSPRVSRLVDGWKRQSGIADGQNHPLAL-------------M 159

Query: 182 LDDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQ 241
           +D++L+++++  ++PK+T KQL+N+AL+IC++YLL   +  +YL N+P+ V+ + +  +Q
Sbjct: 160 VDEMLRKETRKLKQPKITRKQLVNNALQICNIYLLKSAEDNKYLINVPERVKNQVLYDVQ 219

Query: 242 RNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQ 301
           +  RHDP VF+ LK+V+YQFLEIDCFPKFLSTVALHNIHD+IS+WR+    + G R    
Sbjct: 220 QEQRHDPAVFEPLKTVAYQFLEIDCFPKFLSTVALHNIHDQISNWRYQ---SPGLR---- 272

Query: 302 ASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIV 361
                      RH SKSPFS YT LSR++ GL+WLG+GFWIGYTLIFL Y R IRVVTIV
Sbjct: 273 -----------RHRSKSPFSNYTVLSRVLIGLIWLGIGFWIGYTLIFLHYSRAIRVVTIV 321

Query: 362 PFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKD--KIPF 419
           PF +GSY +VCGLYQVDILY++FG+TQ L+Y+++       DG+   D K S D  +IP 
Sbjct: 322 PFALGSYSIVCGLYQVDILYAFFGLTQALMYQEK-------DGS-QTDRKHSHDYSEIPT 373

Query: 420 IFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           IF +LGGR+RLI+++H FI+K L++R LWC  L  ++T + TV+FSCVPG+R+
Sbjct: 374 IFKLLGGRSRLIKIQHDFIKKLLWKRALWCGFLTTLATAILTVIFSCVPGYRL 426

>Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301W
           (REAL)
          Length = 425

 Score =  491 bits (1263), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 250/467 (53%), Positives = 312/467 (66%), Gaps = 50/467 (10%)

Query: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68
           DFEKIQ ERLPTLYEVL+Q+T  PVDLW+FYTFLSQFPYAINYLDFW+DLM H RLCK Y
Sbjct: 6   DFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCKSY 65

Query: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128
           V+ + +SL+   +  G                    AS  T  LLNAL+EEGH DL  P 
Sbjct: 66  VELVTKSLINFPKENGG-------------------ASTTTLDLLNALIEEGHLDLEAPG 106

Query: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDILKR 188
            + +     +  SPKL QL+ DW R S    D                    I+D+ILKR
Sbjct: 107 RLLKSDGQDMPFSPKLNQLLGDWKRQSGMSQDSLRRDDIAL-----------IVDEILKR 155

Query: 189 QSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDP 248
           +SQ +  P++TTKQL +SA+ +C+ YL+SPEQSERYL+NIP E R + +  IQ   ++D 
Sbjct: 156 RSQQDGIPQITTKQLFHSAVGLCNTYLVSPEQSERYLSNIPTETRNRIIEDIQVQQKYDI 215

Query: 249 EVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFH---AHSTGGNRNKSQASLT 305
           EVFD++K+++YQFLE+DCFPKFLS VALHNIHDEISDWRFH   A +  G R + QA   
Sbjct: 216 EVFDDIKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSVNATNEKGKRFRGQA--- 272

Query: 306 EKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCI 365
                   HIS+SPFS +T++SRI FGLLWLG+GFWIGY LIFL Y R IRVVT+VPF +
Sbjct: 273 --------HISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYGRAIRVVTVVPFAL 324

Query: 366 GSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILG 425
           G Y +VCG+YQVDI+YSWFG+TQRLL++ +  + D  DG     V    D +P +  + G
Sbjct: 325 GCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNSSSD-QDG-----VSAGSDHVPVLLAVFG 378

Query: 426 GRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           G+ RL  VKHPF R+ L +RGLWC LLV+ +T  FTV+FSCVPG RV
Sbjct: 379 GKRRLTRVKHPFTRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV 425

>YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Protein
           involved in bud site selection during bipolar budding;
           localization requires Rax2p; has similarity to members
           of the insulin-related peptide superfamily
          Length = 435

 Score =  490 bits (1262), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/464 (53%), Positives = 313/464 (67%), Gaps = 41/464 (8%)

Query: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68
           +FE IQ ERLPTLYEVL+Q+T  PVDLW+FYTFLSQFPYAINYLDFW+DLMTH RLCK+Y
Sbjct: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72

Query: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128
           ++ +R+SL+            N    QQ     + S S  T  LLNAL+EEGH D   P 
Sbjct: 73  IELVRKSLI------------NFPQEQQ----QNGSTSTATFDLLNALIEEGHLDPEAPD 116

Query: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDILKR 188
            + +     V  SPKL +L+ DW +H   +                      I+D+I+KR
Sbjct: 117 KLLENSGPDVPFSPKLNELLGDW-KHQSGIGQEALRNEDVAL----------IVDEIMKR 165

Query: 189 QSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDP 248
           +SQ + KP++TTKQLL+SA+ +C+ YL+SPEQSERYL+NIP E R + +  +Q   ++D 
Sbjct: 166 RSQQDGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDI 225

Query: 249 EVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKD 308
           E+FD+LK+++YQFLE+DCFPKFLS VALHNIHDEISDWRF  HS G    KS  S     
Sbjct: 226 EIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRF--HSVGVTNEKSNRS----- 278

Query: 309 LESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSY 368
                HIS+SPFS +T++SRI FGLLWLG+GFWIGY LIFL Y R IRVVT+VPF +G Y
Sbjct: 279 -RGQTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFTLGCY 337

Query: 369 FVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRN 428
            +VCG+YQVDI+YSWFG+TQRLL++ +        GN   D     D +P I  + GGR 
Sbjct: 338 CIVCGMYQVDIVYSWFGVTQRLLHRHKNA------GNDEGDASSDTDHVPMILAVFGGRR 391

Query: 429 RLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           RL  ++HPF R+ L +RGLWC LLV+ +T  FTV+FSCVPG RV
Sbjct: 392 RLTRIEHPFTRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV 435

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score =  483 bits (1242), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 236/467 (50%), Positives = 321/467 (68%), Gaps = 41/467 (8%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           ME DF  I+ +RLPTLYEVL+++T  PVDLWSFYTFLSQFPYAI++LDFW+DLM H+RLC
Sbjct: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60

Query: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLT 125
           +DYV G++ES+   N                 E  ADD+ S  ++VLL+ALL EG+ D  
Sbjct: 61  RDYVRGVKESIEARNS----------------ELIADDAHSDESNVLLDALLTEGYLDFK 104

Query: 126 NPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDI 185
           N   VSQ L+G V  S ++++L+D + +  +                        ++DD+
Sbjct: 105 NARRVSQFLRGNVEESMRISRLLDTFKQDHR---------LSTQSDREADEFLAAMVDDM 155

Query: 186 LKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSR 245
           LK++   +++PK+T KQL+N+A +IC  YLLSP++S RYL N+PDE+R+KA++ +Q   R
Sbjct: 156 LKQKIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERR 215

Query: 246 HDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLT 305
            DPE+F++L+++SY FLE+DCFPKFL+ VALHN+HD++SDWRF   +  G         +
Sbjct: 216 FDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQTTAAIGK--------S 267

Query: 306 EKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCI 365
           + D+   R  S SP STY+ L RI  GL WLG+GFWIGY LIFL Y R IRV TIVPF I
Sbjct: 268 KGDIRGQR--SASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGI 325

Query: 366 GSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILG 425
           G YF VCG+YQVDILYSWFG+TQRL+Y ++K+  D  +     DV +S+ ++P IF +LG
Sbjct: 326 GCYFSVCGIYQVDILYSWFGVTQRLMY-EKKLPSDREE-----DVPKSRTRVPTIFALLG 379

Query: 426 GRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           GR+RL+ V HPFI+K L +RG+WC LLV++ST V TV+FSCVPG R+
Sbjct: 380 GRSRLMPVHHPFIKKLLLRRGMWCFLLVVVSTAVLTVLFSCVPGKRI 426

>Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301W
           (REAL)
          Length = 423

 Score =  474 bits (1221), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 246/464 (53%), Positives = 311/464 (67%), Gaps = 46/464 (9%)

Query: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68
           DFE++Q  RLPTLYEVL+Q+T  PVDLW+FYTFLSQFPYAINYLDFW+DLM H RLC+ Y
Sbjct: 6   DFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWIDLMAHTRLCQSY 65

Query: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128
           V+ +R+SLV            N    QQ     +  ASV+T  LL+AL+EEGH D   P 
Sbjct: 66  VELVRKSLV------------NYPQEQQ----ENGGASVKTHDLLSALVEEGHLDPETPE 109

Query: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDILKR 188
            + Q     +  SPKL QL++ W R S   +D                    I+D+ILKR
Sbjct: 110 KLLQNSGPDLPFSPKLNQLLEGWKRQSGISEDSLRNEDMTL-----------IVDEILKR 158

Query: 189 QSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDP 248
           +SQ +  P++TTKQLL+SA+ +C+ YL S EQ ERYL+NIP E R + V  +Q   R+D 
Sbjct: 159 RSQQDGVPQITTKQLLHSAMGLCTTYLASSEQRERYLSNIPTETRNRIVKDVQVKRRYDI 218

Query: 249 EVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKD 308
           EVFD++K+++YQFLE+DCFPKFLS VALHNIHDEISDWRFH+      +NK         
Sbjct: 219 EVFDDVKNLAYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSVGATNEKNKR-------- 270

Query: 309 LESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSY 368
           +    HIS+SPFS +T++SRI FGLLWLG+GFWIGY LIFL Y R IRVVT+VPF +G Y
Sbjct: 271 VRGQTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFALGCY 330

Query: 369 FVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRN 428
            +VCG+YQVDI+YSWFG+TQRLL++ +    DG D     D  E  D +P I      ++
Sbjct: 331 CIVCGMYQVDIVYSWFGVTQRLLHRHK----DGSDNE--DDSSEDFDHVPAIL-----KS 379

Query: 429 RLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           RL  V+HPFIR+ L +RGLWC LLV+ +T  FTV+FSCVPG RV
Sbjct: 380 RLTCVQHPFIRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV 423

>SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 432

 Score =  456 bits (1173), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 323/468 (69%), Gaps = 37/468 (7%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           ME +  K+Q++RLPTLYEVL Q+T  PVDLWSFYT+LSQFP+AINYLDFW+D+M HLRLC
Sbjct: 1   METESTKLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWIDIMAHLRLC 60

Query: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLT 125
           KDYV GIRES++V  E   N      +H   V  +    +SV TS+LL AL+ +G  D  
Sbjct: 61  KDYVKGIRESVLVWEE--ANRPPRIPKHDSGVSDNY--RSSVSTSLLLEALMNDGVLDFQ 116

Query: 126 NPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDI 185
           +   VSQ LQGQ + SP+L+QL+++W R S   D+                    +LDD 
Sbjct: 117 DSKRVSQFLQGQTD-SPRLSQLMENWKRQSALEDNDRLTE---------------VLDDF 160

Query: 186 LKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSR 245
           LK++ +  ++P++TTKQLLN+AL+I ++YL SP+QS ++L N+P+++RL A++ +Q   R
Sbjct: 161 LKQEMKESQQPRITTKQLLNNALQIVNMYLSSPQQSPKFLVNVPEKIRLDAIHTVQVQQR 220

Query: 246 HDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLT 305
           HDP+VF+ LKSV++QFLE+DCFPKFL  VALHN+HD+++D   H+   GG    +Q    
Sbjct: 221 HDPDVFESLKSVAFQFLEMDCFPKFLGCVALHNLHDDMTD---HSSPLGGKTATTQ---- 273

Query: 306 EKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCI 365
                  RH   S FSTYT LSR+  GLL LG+GFWIGY LIFL Y RGIRVVTIVPF +
Sbjct: 274 -------RHRKSSLFSTYTILSRVFLGLLLLGIGFWIGYVLIFLDYSRGIRVVTIVPFFL 326

Query: 366 GSYFVVCGLYQVDILYSWFGITQRLLY-KDRKVTEDGYDGNVPVDVKESKDKIPFIFGIL 424
           G Y+VVCG+YQ+D++Y+ FG+TQ L+  KD++  E GY  N       +  ++P IF +L
Sbjct: 327 GFYYVVCGIYQLDVVYALFGVTQNLVTNKDKRDLELGYQRN--SSKSSNVRRLPVIFRVL 384

Query: 425 GGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           GGR RL++V+HPF+ + L +R +WC  L+L+ T +FTV+FSCVPGHR+
Sbjct: 385 GGRGRLVKVRHPFVDRILKRRSVWCWFLILLGTAIFTVIFSCVPGHRL 432

>KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.774
           YOR301W
          Length = 463

 Score =  436 bits (1122), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 238/487 (48%), Positives = 316/487 (64%), Gaps = 44/487 (9%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           M+ +F +IQ ERLPTLYEVL+QK+ AP+DLWSFYT+LSQFP+AINYLDFW+DLM H+RLC
Sbjct: 1   MDRNFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWIDLMAHIRLC 60

Query: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLT 125
           KD++ G+R S+    ER        NE  QQ    ADD+ASV TSVL+  ++EE   DL 
Sbjct: 61  KDFIKGVRRSIGEAAER--------NEE-QQGGGGADDTASVTTSVLMQTIMEEAQLDLN 111

Query: 126 NPA-------------GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXX 172
            P              G+   L+    +S +++Q++D+WN  + +               
Sbjct: 112 RPDDVYSFFRNSHQQDGLGDNLRASSRYSARVSQMLDEWNGRTSH-------RYTGHSVD 164

Query: 173 XXXXXXXXILDDILKRQSQL--EEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPD 230
                   ++D+ L   S+   +    +TTKQLL++A  +C  YL+S E+SERYLTNIP 
Sbjct: 165 ISNGNLTTLMDEFLNEHSKTRGDGGAYITTKQLLHNATHMCRTYLISREESERYLTNIPT 224

Query: 231 EVRLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHA 290
           E+R   +  +    ++DP +FD+LK+++YQFLEIDCFPKFLS VALHN+HDEIS+WRF+ 
Sbjct: 225 EIREYILVGVLDAKKYDPGIFDDLKTLTYQFLEIDCFPKFLSQVALHNLHDEISNWRFNK 284

Query: 291 -----HSTGGNRNKSQASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYT 345
                +S GG    +     EKD    R  + +PFS YTTLSRI+FGLLWLG+GFWIGYT
Sbjct: 285 LDSTKYSGGGG---ALTGDPEKDAVGYRG-AHTPFSNYTTLSRILFGLLWLGIGFWIGYT 340

Query: 346 LIFLKYDRGIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGN 405
           LIFLKY R IRVVT+VPF +G Y+ +CGLYQVDI+YS FG+TQRLL   R+    G D  
Sbjct: 341 LIFLKYSRAIRVVTVVPFALGCYYCICGLYQVDIIYSIFGVTQRLL--QRETAAAGED-- 396

Query: 406 VPVDVKESKDKIPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFS 465
            P     +  K+P +  + GGR RL++++H F R+ L +RGLWC LLV  ST  FTV+FS
Sbjct: 397 PPTHTDATTAKVPSLLVLFGGRGRLLKIEHEFTRRLLLRRGLWCLLLVTFSTAAFTVIFS 456

Query: 466 CVPGHRV 472
           CVPG+RV
Sbjct: 457 CVPGYRV 463

>TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.774
           YOR301W
          Length = 577

 Score =  414 bits (1063), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 227/581 (39%), Positives = 324/581 (55%), Gaps = 118/581 (20%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           M  D+++IQ ERLPTLYEVL+QK+ AP DLWSFYT+LSQFPYAINYL+FW+DLM H RLC
Sbjct: 1   MSIDYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWIDLMNHNRLC 60

Query: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQV---------------------------- 97
           +  ++ I+ SL+ NN+   N+  LN E  Q++                            
Sbjct: 61  RHLINEIKNSLIQNNK---NNPHLNEEDLQKIIDKYSNNDILPPSMPLPQAVSTPPADFD 117

Query: 98  ----------------EADAD---DSASVRTSVLLNALLEEGHFDLTNPAGVSQLLQGQV 138
                           E D D   D+ S+ +S+LLN L+ EG+ +  +   +S+  QG +
Sbjct: 118 TIDEVERESLSNMPIPEQDEDIDNDNDSITSSILLNVLMNEGYLNPDDHYRMSKFFQGNI 177

Query: 139 NHSP--KLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXX-------------XXILD 183
             S   +++QL+ +W RH+ N +                                  ++D
Sbjct: 178 GGSNDYRMSQLMQNWQRHNDNSNSNNTRQTNTGETNNAGNNSNSNSYTNNTTERFAAMVD 237

Query: 184 DILKR-------------QSQLEEKPK------------VTTKQLLNSALKICSLYLLSP 218
           ++L+              Q  ++E+              +TT+ L+ +A  IC+LYL+SP
Sbjct: 238 ELLQNNRIPMPSPILPNTQENIQEQEDQANASSSSFLNGLTTRDLIKNARNICNLYLISP 297

Query: 219 EQSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHN 278
           E+S++YL NIP+ ++   +  I+  +R DP +FD+L++++Y FLE+DCFPKFLS +ALHN
Sbjct: 298 EKSKKYLINIPETIKFDIIKKIKFENRFDPLIFDDLQNLTYNFLEVDCFPKFLSKIALHN 357

Query: 279 IHDEISDWRFHA--HSTGGNRNKSQASLTEKDLESM----------------------RH 314
           IHD+ISDWRFH+    T  NR KS   L+E D  S                        H
Sbjct: 358 IHDQISDWRFHSSFKLTSQNR-KSNRGLSENDNSSSTDNEKNYQSDNDDNDSMIYNIDNH 416

Query: 315 ISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVCGL 374
           IS+SPFS YT +SR+  G +WLG+GFWIGYTLIFL Y RGIRV T+ PF  G Y+++CGL
Sbjct: 417 ISRSPFSNYTIISRLFVGFIWLGIGFWIGYTLIFLNYSRGIRVTTLPPFLFGCYYIICGL 476

Query: 375 YQVDILYSWFGITQRLLYKDRKV---TEDGYDGNVPVDVKESKDKIPFIFGILGGRNRLI 431
           YQ+DI YS FG+TQ L+++ ++         D     ++K  K  IPF F + GG+ RLI
Sbjct: 477 YQLDIFYSLFGVTQDLMFQPKRNLLHANKKIDKTTKKNLKHLKRGIPFFFNLFGGKKRLI 536

Query: 432 EVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           ++ HP+IR  LF+RG+WC +LV +ST   TV+FS VPG RV
Sbjct: 537 KIDHPYIRNLLFKRGIWCAILVALSTAGLTVIFSVVPGWRV 577

>Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W
           (REAL)
          Length = 467

 Score =  409 bits (1051), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 221/429 (51%), Positives = 288/429 (67%), Gaps = 48/429 (11%)

Query: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68
           DFEKIQ ERLPTLYEVL+Q+T  PVDLW+FYTFLSQFPYAINYLDFW+DLM H RLC+ Y
Sbjct: 6   DFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCQSY 65

Query: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128
           V  +R+SL          +    EH Q+     D SA+  T  LL+AL+EEGH +L +P 
Sbjct: 66  VKMVRKSL----------ANFPQEHQQK----GDGSAT--TFNLLDALIEEGHLNLQSPE 109

Query: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDILKR 188
            + Q     V  SPKL +++ +W  HS    D                    ILD+ILKR
Sbjct: 110 NLLQNEPSDVPFSPKLNEMLGNWKHHSGISQDALQNEDMAL-----------ILDEILKR 158

Query: 189 QSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDP 248
           +SQ +  P++TTKQLL+SA+ +C+ YL+SPEQSERYL+NIP E R + +  IQ + ++D 
Sbjct: 159 RSQQDGVPQITTKQLLHSAMGLCTTYLVSPEQSERYLSNIPAETRTRILEDIQVDRKYDV 218

Query: 249 EVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKD 308
            +FD++K+++YQFLE+DCFPKFLS VALHNIHDEISDWRFH+ ++   R++ Q       
Sbjct: 219 AIFDDVKALTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSKNS---RSRGQT------ 269

Query: 309 LESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSY 368
                HIS+SPFS +T++SRI  GLLWLG+GFWIGY LIFL Y R IRVVT+VPF +G Y
Sbjct: 270 -----HISRSPFSNHTSISRIGLGLLWLGIGFWIGYVLIFLAYGRAIRVVTVVPFALGCY 324

Query: 369 FVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRN 428
            VVCG+YQVDI+YSWFG+TQRLL++ +       + N         D +P +  + GG++
Sbjct: 325 CVVCGMYQVDIVYSWFGVTQRLLHRHK-------NSNDDAGAATDADHVPGVLAVFGGKS 377

Query: 429 RLIEVKHPF 437
           RL  V+HPF
Sbjct: 378 RLTSVQHPF 386

>KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 438

 Score =  403 bits (1036), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 305/473 (64%), Gaps = 41/473 (8%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           M P    +  +RLPTLYEVL ++T APVDLWSFYTFLSQ+PYAIN+LDFW+D M HLRLC
Sbjct: 1   MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC 60

Query: 66  KDYVDGIRESLVV---NNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHF 122
           KDYV G+RES V    + ER G +    + H        D+  S+ +S+LL AL+ +G  
Sbjct: 61  KDYVKGVRESFVEWEDSQERSGANRDSRDSH--------DNRDSLSSSLLLEALMNDGFL 112

Query: 123 DLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXIL 182
           D  +   VS+ LQGQ + SP+L +L+D+W + +++  D                    ++
Sbjct: 113 DYEDSKRVSRFLQGQTD-SPRLTKLLDNWQKQTEHDSDAPFKSPLTG-----------LV 160

Query: 183 DDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQR 242
           D+ LK Q+Q  +K ++T+K+LLN+A  I   YLL+PE+S RYL N+PD +R  AV+++  
Sbjct: 161 DEFLKTQAQDFQKARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLE 220

Query: 243 NSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQA 302
             RHDP+VF++LK++S+QFLE+DCFPKFLS VALHN+HD+I         T  + +   A
Sbjct: 221 EKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDI---------TSSSLSDPLA 271

Query: 303 SLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVP 362
            L      S     +S F+ YTTLSR++ G+++L +G W+GYTL+FL Y RGIRV TIVP
Sbjct: 272 ILG----SSAPGRRRSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSRGIRVTTIVP 327

Query: 363 FCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTED---GYDGNVPVDVKESKDKIPF 419
           F +G YF+ CG+Y++DILY+  G+TQ L+  +   ++D   G + N  V  K  +   P 
Sbjct: 328 FFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNA-VHNKTRQSTSP- 385

Query: 420 IFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           +F + GG +RL+ ++ PF+   L +R LWC +LVL  T +FTV+FSCVPGHR+
Sbjct: 386 VFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFSCVPGHRL 438

>KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]
           {ON} similar to uniprot|Q08760 Saccharomyces cerevisiae
           YOR301W RAX1 Protein involved in bud site selection
           during bipolar budding localization requires Rax2p
          Length = 424

 Score =  394 bits (1013), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 213/462 (46%), Positives = 290/462 (62%), Gaps = 48/462 (10%)

Query: 14  QTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDYVDGIR 73
           Q  RLPTLYEVL Q+T AP+DLWSFYT+LSQ+P+AI YLDFW D+M +LRLCKDYV GIR
Sbjct: 8   QRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWTDVMAYLRLCKDYVKGIR 67

Query: 74  ESLVVNNERQGNSSLLNNEHAQQVEADADDS-ASVRTSVLLNALLEEGHFDLTNPAGVSQ 132
           ES++  N+ +  + L         E + DD   SV +++LL AL+ +G+ D  +   VSQ
Sbjct: 68  ESVLDVNKLETPTVL--------QEGNGDDKRESVSSAMLLEALMNDGYLDYNDSQRVSQ 119

Query: 133 LLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDILKRQSQL 192
            L+G+ + SP+L+QL+ DW + + +  D                     +D ++K     
Sbjct: 120 FLKGETD-SPRLSQLLQDWKQVNNDQIDFSD-----------------FVDGLVKSNVTK 161

Query: 193 EEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFD 252
           + KPK+TTKQL++SA  I S YLLS EQS+R+L  IP  +R   + LI    RHDPEVF+
Sbjct: 162 DHKPKLTTKQLISSAQDIVSTYLLSQEQSDRFLFEIPAYLRNDTIRLIMEEKRHDPEVFE 221

Query: 253 ELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKDLESM 312
            +K + YQFLE+DCFP+FL  VALHN+HDEI   R         +NKS  S         
Sbjct: 222 PIKEIVYQFLEVDCFPRFLGCVALHNLHDEIVLQR-------PKKNKSYNSR-------- 266

Query: 313 RHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVC 372
              S SPFS ++T SR+  GL W  VG WIGYTLIF+ Y +GIRVV IVPF +GSY+++C
Sbjct: 267 ---SNSPFSQWSTASRLTIGLAWWLVGLWIGYTLIFMNYSKGIRVVCIVPFFLGSYYIIC 323

Query: 373 GLYQVDILYSWFGITQRLLYKDRKV--TEDGYDGNVPVDVKESKDKIPFIFGILGGRNRL 430
           G+Y VDI+Y++ G+TQ L+ K RK+   E     N   +   S +++P+   I GGR+RL
Sbjct: 324 GIYLVDIIYAFSGVTQTLVSK-RKLDDLELRSMNNHRSNSLHSSNEVPWWLTIFGGRSRL 382

Query: 431 IEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
            +VKHPF+   + +R LWC LLVLI T + T +F+ VPG R+
Sbjct: 383 CKVKHPFVNSIMIRRALWCLLLVLIMTAILTAIFAAVPGRRI 424

>Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {ON}
           YOR301W (RAX1) - Similar to B-chains of the
           insulin-related hormone superfamily. [contig 272] FULL
          Length = 432

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/459 (47%), Positives = 304/459 (66%), Gaps = 40/459 (8%)

Query: 17  RLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDYVDGIRESL 76
           RLPTL+EVL +++ APVDLWSFY FLSQ+PYAIN+LDFW+D+M HLRLCKDYV GIRES+
Sbjct: 11  RLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWIDVMAHLRLCKDYVKGIRESV 70

Query: 77  VVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPAGVSQLLQG 136
           +     +   SL      ++  A+ D   S+ +S+LL AL+ +G+ D  +   VS+ LQG
Sbjct: 71  I-----EWEDSL------ERSGANRDSRDSLSSSLLLEALMNDGYLDYEDSKRVSRFLQG 119

Query: 137 QVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILDDILKRQSQLEEKP 196
             + SP+L +L+D+W +H+                         ++DD LK Q+    K 
Sbjct: 120 HTD-SPRLTRLLDNWQKHADQ----------DSAGAPFKSPLTGLVDDFLKTQAHDFHKA 168

Query: 197 KVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDELKS 256
           ++T+K+LLN+A  I + YLLSPE S RYL N+PD +R   + +++   RHDPE+F++LKS
Sbjct: 169 RITSKELLNNAQNIVNTYLLSPETSVRYLINLPDHMRENTLRMVRDEKRHDPELFEQLKS 228

Query: 257 VSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKDLESMRHIS 316
           +++QFLE+DCFPKFL++VALHN+HD+I+     A  T  +    + S T       RH  
Sbjct: 229 LAFQFLEMDCFPKFLTSVALHNLHDDITTPPLTAPQTPAH----EPSFTR------RH-- 276

Query: 317 KSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVCGLYQ 376
            SPF+ +TTLSR+  G+L+L +G W+GYTLIFL Y RGIRV TIVPF +G YF+ CG+Y+
Sbjct: 277 -SPFAHHTTLSRVALGMLFLWMGLWLGYTLIFLDYSRGIRVTTIVPFFLGFYFICCGIYR 335

Query: 377 VDILYSWFGITQRLLYKDR---KVTEDGYDGNVPVDVKESKDKIPFIFGILGGRNRLIEV 433
           +DILY+  G+TQ L+  ++   K  E G + N  V+ + S +  PF+F ILGG  RL+ +
Sbjct: 336 IDILYALAGVTQTLVSNEQVSLKDLEIGLNRN-SVNHRMSHNA-PFVFRILGGTGRLVRI 393

Query: 434 KHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           KHPFI K L +RG WC LLVL  TGVFTV+FSCVPG R+
Sbjct: 394 KHPFINKLLKKRGYWCLLLVLTLTGVFTVIFSCVPGRRL 432

>AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR301W (RAX1)
          Length = 422

 Score =  374 bits (959), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 204/472 (43%), Positives = 290/472 (61%), Gaps = 55/472 (11%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           ME +  ++Q+ERLPTL+EVL  +T APVD WSFYTFL Q+P A+NY+DFW+D+M HLRLC
Sbjct: 1   METEEWRLQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLC 60

Query: 66  KDYVDGIRESLVV--NNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFD 123
           KDYV GIRES+++    E+QG S         +     +   S+ +SVLL+ALL +G+ D
Sbjct: 61  KDYVKGIRESMMLLEVEEQQGRSR-------GRPAGSTEKRQSLSSSVLLDALLNDGYLD 113

Query: 124 LTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXXXXXXXXXXXXXILD 183
             +   +SQ L+G    S +L+QL +     S                         +LD
Sbjct: 114 YHDNRRISQFLKGD-GESARLSQLFEGRGGDSSG-----------EKAPTEEPHLSLMLD 161

Query: 184 DILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPE--QSERYLTNIPDEVRLKAVNLIQ 241
           + L RQ +  ++PK+TTKQL+ SA  I   YL+S +  +SER LT +P+ +RL+ +NL++
Sbjct: 162 EFLVRQMKESQRPKLTTKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVK 221

Query: 242 RNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQ 301
              R+DP+VF+ LK +S+QFLEI CFPKFLS+VALHN+H +I                  
Sbjct: 222 GEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDI------------------ 263

Query: 302 ASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIV 361
            SL++K        S+SP+S  TTL+R+  G  +  VGFW+GY+LIFL Y R +R VT+V
Sbjct: 264 -SLSQK-------ASRSPYSQCTTLARVATGFFFWAVGFWVGYSLIFLDYPRRVRTVTLV 315

Query: 362 PFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDR-KVTEDGYDGNVPVDVKESKDKIPFI 420
           PF IGSY++VCG+Y +DI+Y+  G+TQ L+   R +  E G D       + S  K+PF 
Sbjct: 316 PFLIGSYYIVCGVYHLDIIYAVCGVTQTLISPRRYEEPELGLDQK-----QNSATKVPFF 370

Query: 421 FGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472
           F  LGGR RL +V+HPF+   + +R LWC  LV+++T V TV+F+ VP  R+
Sbjct: 371 FTFLGGRKRLTKVRHPFVLNIMRKRALWCLFLVIVTTAVLTVIFTAVPSVRL 422

>Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar to
           Ashbya gossypii AFR532W
          Length = 453

 Score =  348 bits (893), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 299/487 (61%), Gaps = 54/487 (11%)

Query: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65
           ME +  + Q+ERLPTLYEVL  +T APVD WSFYTFL Q+P A+NY+DFW+D+M HLRLC
Sbjct: 1   METEERRFQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLC 60

Query: 66  KDYVDGIRESLVV----------NNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNA 115
           KDYV GIRES+++           + ++ +S +         + + ++  SV +S+LL+A
Sbjct: 61  KDYVRGIRESMLLLEVEEQQQQQKHRQKRHSQVSAAGSDAAADNNNNNRMSVSSSLLLDA 120

Query: 116 LLEEGHFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDXXXXXXXXX-----X 170
           LL +G+ D  +   +SQ L+G+ + S + +QL+++    ++  +                
Sbjct: 121 LLNDGYLDYHDNKRISQFLKGEAD-SDRFSQLLENLPHGAEGGEGNNKGYDGEEPGHGDY 179

Query: 171 XXXXXXXXXXILDDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPE--QSERYLTNI 228
                     +LD+ L RQ +  ++PK+TTKQL+ SA  I   YL++ +  +SER LT++
Sbjct: 180 ATAEDAHLSVMLDEYLVRQMKESQRPKLTTKQLIASANAIVDRYLVAKDNMRSERLLTSV 239

Query: 229 PDEVRLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRF 288
           P+ +RL+ +N+++   R+DP+VF+ LK +S+QFLEI CFPKFLS+VALHN+H ++S    
Sbjct: 240 PEHMRLEVINMVKGEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDVS---- 295

Query: 289 HAHSTGGNRNKSQASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIF 348
                          LT+K          SP+S  TTLSR+  G  + G+GFW+GYTLIF
Sbjct: 296 ---------------LTQK-------TRTSPYSQCTTLSRVATGFFFWGIGFWVGYTLIF 333

Query: 349 LKYDRGIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPV 408
           L Y+R +R VT++PF +G Y++VCG+Y +DI+Y+  G+TQ L+   R    +       +
Sbjct: 334 LDYNRKVRTVTLLPFFVGCYYIVCGIYHLDIIYAICGVTQTLVSPRRFAEPE-------L 386

Query: 409 DVKESKD---KIPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFS 465
            +K+SK    K+P +F +LGGRNRL +V+HPF+   + +R LWC  LVL++T V T +F+
Sbjct: 387 GLKKSKTNSAKVPLLFSLLGGRNRLTKVRHPFVLNIMRKRALWCLFLVLVTTAVLTTIFT 446

Query: 466 CVPGHRV 472
            VP  R+
Sbjct: 447 AVPSTRL 453

>TBLA0H03450 Chr8 (842545..843807) [1263 bp, 420 aa] {ON} Anc_8.514
           YBR161W
          Length = 420

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 93  HAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWN 152
           H   V  D DD    R   LL     +     T+P GVS  + G + H P   +L++  N
Sbjct: 133 HYGGVYIDLDDGCERRLDPLLTV---QAFVRKTSPVGVSNDVMGSIPHHPFYLKLMNSLN 189

Query: 153 RHSQNV 158
           ++ +NV
Sbjct: 190 KYRKNV 195

>Smik_4.594 Chr4 (1062328..1066860) [4533 bp, 1510 aa] {ON} YDR334W
            (REAL)
          Length = 1510

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%)

Query: 218  PEQSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDE 253
            P+Q ER L    DE  +KA NL  R    D E FDE
Sbjct: 1435 PKQLERLLAQAEDEDDVKAANLAMREVEIDNEDFDE 1470

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,917,017
Number of extensions: 2078209
Number of successful extensions: 6642
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6729
Number of HSP's successfully gapped: 34
Length of query: 472
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 359
Effective length of database: 40,524,141
Effective search space: 14548166619
Effective search space used: 14548166619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)