Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B00320na 1ON26922410041e-138
NCAS0G00540singletonON3022257297e-96
NCAS0B07880singletonON3281332214e-20
NDAI0B00680singletonON7861391911e-15
NCAS0A00140singletonON1128961592e-11
NCAS0G04320singletonON1651011265e-08
NCAS0F02360singletonON937971317e-08
NCAS0F02550singletonON750971263e-07
NCAS0F02540singletonON1377971032e-04
NCAS0C00240singletonON43887930.003
NDAI0I00800na 2ON86755900.008
NCAS0B05660singletonON53276840.043
NDAI0K02500singletonON47636830.057
CAGL0E00231gsingletonOFF1864132830.062
Kpol_1054.64singletonON1793133820.095
Kpol_1054.65singletonON3231133810.11
Kpol_1054.67singletonON2284115810.13
NCAS0C05130singletonON53431790.16
Kpol_324.1singletonON5451123790.24
Smik_2.200na 3ON21055760.27
KNAG0I02500singletonON1096137750.56
NCAS0C05460singletonON52743740.68
TBLA0C00110singletonON1013137731.1
NCAS0E03100singletonON52927711.6
NCAS0F02620singletonON130836711.7
TBLA0A011407.123bON23578691.9
CAGL0L10092gsingletonON141663712.2
NCAS0E03550singletonON52827702.5
NCAS0J00380singletonON60360692.7
KNAG0I02620singletonON1196137693.4
NDAI0F00150na 4ON68627683.8
ADR378W7.43ON102143684.4
TPHA0I021407.161ON24471665.1
NCAS0G02790singletonON1150126676.7
CAGL0C00968gsingletonON103465667.1
CAGL0C01133gsingletonON103682668.4
NOTE: 1 genes in the same pillar as NCAS0B00320 were not hit in these BLAST results
LIST: NDAI0D00100

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00320
         (269 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00320 Chr2 complement(39886..40695) [810 bp, 269 aa] {ON}       391   e-138
NCAS0G00540 Chr7 (92284..93192) [909 bp, 302 aa] {ON}                 285   7e-96
NCAS0B07880 Chr2 (1494639..1495625) [987 bp, 328 aa] {ON}              90   4e-20
NDAI0B00680 Chr2 (152736..155096) [2361 bp, 786 aa] {ON}               78   1e-15
NCAS0A00140 Chr1 complement(7200..10586) [3387 bp, 1128 aa] {ON}       66   2e-11
NCAS0G04320 Chr7 complement(802990..803487) [498 bp, 165 aa] {ON}      53   5e-08
NCAS0F02360 Chr6 complement(467592..470405) [2814 bp, 937 aa] {O...    55   7e-08
NCAS0F02550 Chr6 (511178..513430) [2253 bp, 750 aa] {ON}               53   3e-07
NCAS0F02540 Chr6 (504855..508988) [4134 bp, 1377 aa] {ON}              44   2e-04
NCAS0C00240 Chr3 (28852..30168) [1317 bp, 438 aa] {ON}                 40   0.003
NDAI0I00800 Chr9 complement(178142..180745) [2604 bp, 867 aa] {O...    39   0.008
NCAS0B05660 Chr2 complement(1074748..1076346) [1599 bp, 532 aa] ...    37   0.043
NDAI0K02500 Chr11 (558027..559457) [1431 bp, 476 aa] {ON}              37   0.057
CAGL0E00231g Chr5 complement(15452..21046) [5595 bp, 1864 aa] {O...    37   0.062
Kpol_1054.64 s1054 (170299..175680) [5382 bp, 1793 aa] {ON} (170...    36   0.095
Kpol_1054.65 s1054 (175616..182530,182532..185309) [9693 bp, 323...    36   0.11 
Kpol_1054.67 s1054 (185410..192264) [6855 bp, 2284 aa] {ON} (185...    36   0.13 
NCAS0C05130 Chr3 complement(1045330..1046934) [1605 bp, 534 aa] ...    35   0.16 
Kpol_324.1 s324 (1..16356) [16356 bp, 5451 aa] {ON} (1..16356) [...    35   0.24 
Smik_2.200 Chr2 complement(353976..354085,354146..354668) [633 b...    34   0.27 
KNAG0I02500 Chr9 complement(483170..486460) [3291 bp, 1096 aa] {...    33   0.56 
NCAS0C05460 Chr3 (1108362..1109945) [1584 bp, 527 aa] {ON}             33   0.68 
TBLA0C00110 Chr3 complement(1..3039) [3039 bp, 1013 aa] {ON}           33   1.1  
NCAS0E03100 Chr5 complement(615182..616771) [1590 bp, 529 aa] {O...    32   1.6  
NCAS0F02620 Chr6 complement(530092..534018) [3927 bp, 1308 aa] {...    32   1.7  
TBLA0A01140 Chr1 (260819..261526) [708 bp, 235 aa] {ON}                31   1.9  
CAGL0L10092g Chr12 (1084445..1088695) [4251 bp, 1416 aa] {ON} no...    32   2.2  
NCAS0E03550 Chr5 complement(706081..707667) [1587 bp, 528 aa] {O...    32   2.5  
NCAS0J00380 Chr10 (55926..57737) [1812 bp, 603 aa] {ON}                31   2.7  
KNAG0I02620 Chr9 (505371..508961) [3591 bp, 1196 aa] {ON}              31   3.4  
NDAI0F00150 Chr6 complement(16653..18713) [2061 bp, 686 aa] {ON}       31   3.8  
ADR378W Chr4 (1382492..1385557) [3066 bp, 1021 aa] {ON} Syntenic...    31   4.4  
TPHA0I02140 Chr9 (475414..476148) [735 bp, 244 aa] {ON} Anc_7.16...    30   5.1  
NCAS0G02790 Chr7 (508184..511636) [3453 bp, 1150 aa] {ON}   null...    30   6.7  
CAGL0C00968g Chr3 (96914..100018) [3105 bp, 1034 aa] {ON} some s...    30   7.1  
CAGL0C01133g Chr3 (114805..117915) [3111 bp, 1036 aa] {ON} some ...    30   8.4  

>NCAS0B00320 Chr2 complement(39886..40695) [810 bp, 269 aa] {ON} 
          Length = 269

 Score =  391 bits (1004), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 203/224 (90%), Positives = 203/224 (90%)

Query: 1   MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATYTDINLSEFSAMVEPM 60
           MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATYTDINLSEFSAMVEPM
Sbjct: 1   MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATYTDINLSEFSAMVEPM 60

Query: 61  PMYTVRVSEQLVQAVASVERTYTTPFSLPTPYTTTIGDGTLSEVISYISTNVNGNAXXXX 120
           PMYTVRVSEQLVQAVASVERTYTTPFSLPTPYTTTIGDGTLSEVISYISTNVNGNA    
Sbjct: 61  PMYTVRVSEQLVQAVASVERTYTTPFSLPTPYTTTIGDGTLSEVISYISTNVNGNAETRT 120

Query: 121 XXXXXXXXXXXXXXXXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAY 180
                            TVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAY
Sbjct: 121 TTSTLPPPFSLPEPYTTTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAY 180

Query: 181 NTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDRTHTF 224
           NTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDRTHTF
Sbjct: 181 NTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDRTHTF 224

>NCAS0G00540 Chr7 (92284..93192) [909 bp, 302 aa] {ON} 
          Length = 302

 Score =  285 bits (729), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 174/225 (77%), Gaps = 2/225 (0%)

Query: 1   MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATYTDINLSEFSAMVEPM 60
           MNILLSDFTNNEI+YVSYIYM+APSLG++LYSYQ+IY TNK ATYTDINLSEFSAMV+PM
Sbjct: 34  MNILLSDFTNNEISYVSYIYMNAPSLGAMLYSYQEIYETNKQATYTDINLSEFSAMVQPM 93

Query: 61  PMYTVRVSEQLVQAVASVERTYTTPFSLPTPYTTTIGDG--TLSEVISYISTNVNGNAXX 118
           PMYTVRVSEQL QAVASVERTY +PFSLPT YTTT+ +G  T+SEVIS+ISTNVNG    
Sbjct: 94  PMYTVRVSEQLEQAVASVERTYVSPFSLPTAYTTTVVEGASTVSEVISFISTNVNGLPAT 153

Query: 119 XXXXXXXXXXXXXXXXXXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPT 178
                              T+ +  +T+SEVISFISTN+NG PAT+T+ SVIPP YSQP 
Sbjct: 154 QTTTSTIPPPFSLPSAYTTTIADGASTVSEVISFISTNMNGLPATQTTTSVIPPAYSQPA 213

Query: 179 AYNTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDRTHT 223
            YNTT VY++ TVTGL+SFSPK   +G T TA  TSL+PV R  T
Sbjct: 214 VYNTTFVYENTTVTGLISFSPKIGASGQTITATATSLFPVLRMRT 258

>NCAS0B07880 Chr2 (1494639..1495625) [987 bp, 328 aa] {ON} 
          Length = 328

 Score = 89.7 bits (221), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 78/133 (58%)

Query: 85  PFSLPTPYTTTIGDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVNDGT 144
           PFSLP  YTTT+ +G +SEV+S+ STNV+GN                       +V+  +
Sbjct: 95  PFSLPQAYTTTVDNGDVSEVVSFYSTNVDGNPATGTITSVIPPPFSIPSPYTTLLVDGSS 154

Query: 145 TISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSFSPKNAGN 204
           TISE+IS+ STN+ G PAT T+ SVIPPP+S P+ Y TT+V    +V+ +VSF   N  N
Sbjct: 155 TISEIISYYSTNVAGIPATVTTTSVIPPPFSLPSPYTTTVVTGFSSVSEIVSFISTNDVN 214

Query: 205 GLTKTAAFTSLYP 217
           G   T   TS+ P
Sbjct: 215 GAAVTVTTTSVIP 227

 Score = 80.9 bits (198), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 6/128 (4%)

Query: 83  TTPFSLPTPYTTTIGDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           TT FSLP PYTTT G  T+SE+IS+  T+++GNA                     T V++
Sbjct: 8   TTAFSLPAPYTTTAG--TVSELISFFETSIDGNAAATGTITSVIPPPFSLPQAYTTTVDN 65

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSFSPKNA 202
           G  +SEV+SF STN++G+PAT T  SVIPPP+S P AY TT+  D+  V+ +VSF   N 
Sbjct: 66  GD-VSEVVSFYSTNVDGNPATGTITSVIPPPFSLPQAYTTTV--DNGDVSEVVSFYSTNV 122

Query: 203 -GNGLTKT 209
            GN  T T
Sbjct: 123 DGNPATGT 130

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 48/85 (56%), Gaps = 3/85 (3%)

Query: 92  YTTTIGDG--TLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVNDGTTISEV 149
           YTT + DG  T+SE+ISY STNV G                       TVV   +++SE+
Sbjct: 145 YTTLLVDGSSTISEIISYYSTNVAGIPATVTTTSVIPPPFSLPSPYTTTVVTGFSSVSEI 204

Query: 150 ISFISTN-INGSPATETSISVIPPP 173
           +SFISTN +NG+  T T+ SVIPPP
Sbjct: 205 VSFISTNDVNGAAVTVTTTSVIPPP 229

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 9/51 (17%)

Query: 75  VASVERTYTT------PFSLPTPYTTTI--GDGTLSEVISYISTN-VNGNA 116
           VA +  T TT      PFSLP+PYTTT+  G  ++SE++S+ISTN VNG A
Sbjct: 167 VAGIPATVTTTSVIPPPFSLPSPYTTTVVTGFSSVSEIVSFISTNDVNGAA 217

>NDAI0B00680 Chr2 (152736..155096) [2361 bp, 786 aa] {ON} 
          Length = 786

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 74/139 (53%), Gaps = 3/139 (2%)

Query: 81  TYTTPFSLPTPYTTTIGDG--TLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXT 138
           T + PF +P PYTTTI  G  T+SEVIS+ ST V G+A                      
Sbjct: 365 TLSHPFYIPKPYTTTIASGSSTISEVISFYSTTVGGSAATGTKISTIPPPFSIPKPYTTK 424

Query: 139 VVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSFS 198
           +   G+TISEV+SF ST + G PAT TSIS IPPP+S P  Y TT+     T++ +VSF+
Sbjct: 425 ITTGGSTISEVVSFASTQVGGKPATVTSISTIPPPFSIPKPYTTTITTGGSTISEVVSFA 484

Query: 199 PKNAGNGLTKTAAFTSLYP 217
               G G   TA   S  P
Sbjct: 485 STQVG-GKPATATRVSTIP 502

 Score = 60.8 bits (146), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 67/132 (50%), Gaps = 6/132 (4%)

Query: 87  SLPTPYTTT--IGDGTLSEVISYISTN-VNGNAXXXXXXXXXXXXXXXXXXXXXTVVNDG 143
           +LP P TT   I + T+SE++SY ST   +G A                     T+ +  
Sbjct: 325 TLPKPITTAAAIREYTVSEIVSYYSTTYSDGFAGIVTTISTLSHPFYIPKPYTTTIASGS 384

Query: 144 TTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSFSPKNAG 203
           +TISEVISF ST + GS AT T IS IPPP+S P  Y T +     T++ +VSF+    G
Sbjct: 385 STISEVISFYSTTVGGSAATGTKISTIPPPFSIPKPYTTKITTGGSTISEVVSFASTQVG 444

Query: 204 NGLTKTAAFTSL 215
               K A  TS+
Sbjct: 445 G---KPATVTSI 453

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 77/136 (56%), Gaps = 4/136 (2%)

Query: 67  VSEQLVQAVASVERTYTTP--FSLPTPYTTTIGDGTL--SEVISYISTNVNGNAXXXXXX 122
           VS Q+    A+V    T P  FSLP PYTTTI       SEV+S++ST ++G        
Sbjct: 527 VSTQISGKPATVTSVSTIPPPFSLPAPYTTTITTDGTTISEVVSFVSTQISGKPATVTSV 586

Query: 123 XXXXXXXXXXXXXXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNT 182
                          T+  DGTTISEV+SF+ST I+G PAT TS+S IPPP+S P  Y T
Sbjct: 587 STIPPPFSLPVPYTTTITTDGTTISEVVSFVSTEISGKPATVTSVSTIPPPFSLPAPYTT 646

Query: 183 TLVYDDVTVTGLVSFS 198
           T+  D  T++ ++SF+
Sbjct: 647 TITTDGTTISEVISFA 662

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 68/115 (59%), Gaps = 4/115 (3%)

Query: 85  PFSLPTPYTTTIGDGTLS--EVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           PFS+P PYTTTI  G  +  EV+S+ ST V G                       T    
Sbjct: 459 PFSIPKPYTTTITTGGSTISEVVSFASTQVGGKPATATRVSTIPPPFSXXXXTTITTDG- 517

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            TTISEV+SF+ST I+G PAT TS+S IPPP+S P  Y TT+  D  T++ +VSF
Sbjct: 518 -TTISEVVSFVSTQISGKPATVTSVSTIPPPFSLPAPYTTTITTDGTTISEVVSF 571

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 57/96 (59%)

Query: 102 SEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVNDGTTISEVISFISTNINGSP 161
           SEV+S++ST ++G                       T+  DGTTISEV+SF+ST I+G P
Sbjct: 521 SEVVSFVSTQISGKPATVTSVSTIPPPFSLPAPYTTTITTDGTTISEVVSFVSTQISGKP 580

Query: 162 ATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
           AT TS+S IPPP+S P  Y TT+  D  T++ +VSF
Sbjct: 581 ATVTSVSTIPPPFSLPVPYTTTITTDGTTISEVVSF 616

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 67  VSEQLVQAVASVERTYTTP--FSLPTPYTTTIGDGTL--SEVISYISTNVNGNAXXXXXX 122
           VS Q+    A+V    T P  FSLP PYTTTI       SEV+S++ST ++G        
Sbjct: 572 VSTQISGKPATVTSVSTIPPPFSLPVPYTTTITTDGTTISEVVSFVSTEISGKPATVTSV 631

Query: 123 XXXXXXXXXXXXXXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPY 174
                          T+  DGTTISEVISF ST I+G  AT TSIS I P Y
Sbjct: 632 STIPPPFSLPAPYTTTITTDGTTISEVISFASTEISGKKATVTSISTILPSY 683

>NCAS0A00140 Chr1 complement(7200..10586) [3387 bp, 1128 aa] {ON} 
          Length = 1128

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           PFSLP PYTTT+  G  ++SEV+S+ ST   G                       TV +D
Sbjct: 642 PFSLPKPYTTTVVSGSSSISEVVSFYSTQSGGRPVTRTTTSTIPPPFSLPDAYITTVTDD 701

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPT 178
            +T SE+I + ST  NG+PAT TS   IPPPY+ P+
Sbjct: 702 SSTYSEIIEYFSTQSNGNPATATSTYTIPPPYTFPS 737

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 83  TTPFSLPTPYTTT--IGDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVV 140
           T PFSLP+PYTTT  +G  T+SEV S++S++   NA                     TV 
Sbjct: 281 TLPFSLPSPYTTTQVVGGSTISEVFSFLSSSSGTNAITVTKVSTIPPPFSTPPAYLTTVT 340

Query: 141 NDGTTISEVISFIS-TNINGSPATETSISVIPPP 173
            DG+TIS V+ F S TN NG+  T TS   IPPP
Sbjct: 341 TDGSTISGVVEFYSTTNSNGAQMTATSTLTIPPP 374

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (63%), Gaps = 1/77 (1%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVS- 196
           TVV+  ++ISEV+SF ST   G P T T+ S IPPP+S P AY TT+  D  T + ++  
Sbjct: 652 TVVSGSSSISEVVSFYSTQSGGRPVTRTTTSTIPPPFSLPDAYITTVTDDSSTYSEIIEY 711

Query: 197 FSPKNAGNGLTKTAAFT 213
           FS ++ GN  T T+ +T
Sbjct: 712 FSTQSNGNPATATSTYT 728

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
           T V  G+TISEV SF+S++   +  T T +S IPPP+S P AY TT+  D  T++G+V F
Sbjct: 293 TQVVGGSTISEVFSFLSSSSGTNAITVTKVSTIPPPFSTPPAYLTTVTTDGSTISGVVEF 352

Query: 198 SPKNAGNGLTKTA 210
                 NG   TA
Sbjct: 353 YSTTNSNGAQMTA 365

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 16/69 (23%)

Query: 142 DGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF-SPK 200
           DG+  S+VI  I T               PPP+S P  Y TT+V    +++ +VSF S +
Sbjct: 626 DGSATSDVIIVIET---------------PPPFSLPKPYTTTVVSGSSSISEVVSFYSTQ 670

Query: 201 NAGNGLTKT 209
           + G  +T+T
Sbjct: 671 SGGRPVTRT 679

>NCAS0G04320 Chr7 complement(802990..803487) [498 bp, 165 aa] {ON}
          Length = 165

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 54/101 (53%), Gaps = 23/101 (22%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIP------------------PPYSQPTA 179
           TV ++GT +SE+IS+ ST+     AT T+ S IP                  P +S P A
Sbjct: 28  TVTDNGTVLSEIISYFSTD----GATGTTTSTIPAAQVTSSSAAVTSSAVDAPTFSLPDA 83

Query: 180 YNTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTSLYPVDR 220
           Y TT  YD   V+ +VSF   N  +G+T+TA  TS +PVDR
Sbjct: 84  YTTTFTYDGYPVSEVVSFE-ANEVDGVTQTATVTSQFPVDR 123

>NCAS0F02360 Chr6 complement(467592..470405) [2814 bp, 937 aa] {ON} 
          Length = 937

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (55%), Gaps = 3/97 (3%)

Query: 84  TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVN 141
           +P+SLP+PY +T+  G  T+SE+IS+ ST ++ +                      TV  
Sbjct: 281 SPYSLPSPYVSTVVNGGSTVSELISFYSTKIS-DWPATATVISTIPPFSLPSPYLTTVTK 339

Query: 142 DGTTISEVISFISTNINGSPATETSISVIPPPYSQPT 178
           DG+TISEVI + ++  NG   T T  +VIPPP+S P+
Sbjct: 340 DGSTISEVIEYFTSTSNGMLVTGTDTAVIPPPFSFPS 376

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 2/80 (2%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
           TVVN G+T+SE+ISF ST I+  PAT T IS I PP+S P+ Y TT+  D  T++ ++ +
Sbjct: 292 TVVNGGSTVSELISFYSTKISDWPATATVISTI-PPFSLPSPYLTTVTKDGSTISEVIEY 350

Query: 198 SPKNAGNGLTKTAAFTSLYP 217
              +  NG+  T   T++ P
Sbjct: 351 F-TSTSNGMLVTGTDTAVIP 369

>NCAS0F02550 Chr6 (511178..513430) [2253 bp, 750 aa] {ON} 
          Length = 750

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 84  TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVN 141
           +P+SLP+PY +T   G  T+SE+IS+ ST ++ +                       V  
Sbjct: 281 SPYSLPSPYVSTFVNGGSTVSELISFYSTKIS-DWPATATVVSTIPPFSLPSPYLTMVTK 339

Query: 142 DGTTISEVISFISTNINGSPATETSISVIPPPYSQPT 178
           DG+TISE+I + ST  NG   T T  +VIPPP+S P+
Sbjct: 340 DGSTISEIIEYYSTMSNGMLVTGTDTAVIPPPFSFPS 376

>NCAS0F02540 Chr6 (504855..508988) [4134 bp, 1377 aa] {ON} 
          Length = 1377

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 84  TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVN 141
           +P+SLPTP+ +T      T+SE+IS+ ST V  N                      TV  
Sbjct: 627 SPYSLPTPFVSTFVTKGSTVSELISFYST-VADNWPATGTVISTIPPFSLPSPYLTTVTT 685

Query: 142 DGTTISEVISFISTNINGSPATETSISVIPPPYSQPT 178
            G+T SEVI+F ST  +G   T  S + IPPP++ P+
Sbjct: 686 GGSTFSEVIAFYSTLSSGKMVTGASTATIPPPFTFPS 722

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
           T V  G+T+SE+ISF ST  +  PAT T IS IPP +S P+ Y TT+     T + +++F
Sbjct: 638 TFVTKGSTVSELISFYSTVADNWPATGTVISTIPP-FSLPSPYLTTVTTGGSTFSEVIAF 696

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 155 TNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSFSPKNAGNGLTKTAAFTS 214
           T  +G P     + V  P +S P  + TT V    T++G+VSF+P  +G         ++
Sbjct: 264 TGSDGLPTVTKVVIVETPSFSLPPPFTTTFVSGTATLSGVVSFNPTVSGTDTVTATKTST 323

Query: 215 LYP 217
           +YP
Sbjct: 324 MYP 326

>NCAS0C00240 Chr3 (28852..30168) [1317 bp, 438 aa] {ON}
          Length = 438

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 19/87 (21%)

Query: 1   MNILLSDFTNNEITYVSYIYMHAPSLGSVL--------YSYQQIYSTNKFATYTDINLSE 52
           MN+++SD   N ++Y          +G VL         +Y  +++    + Y+ +NLS+
Sbjct: 178 MNLVMSDMEQNFLSY----------MGDVLTITGKKAFLTYYPLFTAGSLSDYS-MNLSQ 226

Query: 53  FSAMVEPMPMYTVRVSEQLVQAVASVE 79
           FS++V  +P YT R+S +L   V+S+E
Sbjct: 227 FSSLVTDLPDYTARLSTKLAVLVSSME 253

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 1  MNILLSDFTNNEITYVSYIYMHAPSLGSVL--YSYQQIYSTNKFATYTDINLSEFSAMVE 58
          M++L++DF +N   Y   + +  P+   ++  Y   +  S  +  TYT +NLS+  A+V 
Sbjct: 32 MDVLMADFVSNPADYFKDL-LGVPNEAIIMNYYLSYKAKSAGQSLTYT-LNLSQLDAIVT 89

Query: 59 PMPMYTVRV 67
           +P YT R+
Sbjct: 90 GLPEYTERL 98

>NDAI0I00800 Chr9 complement(178142..180745) [2604 bp, 867 aa] {ON} 
          Length = 867

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVT 192
           T+V++ +TISE++SF ST  +G P   +++S IPPP + P     T+     T+T
Sbjct: 340 TIVSNTSTISEIVSFYSTQSDGIPVVGSTVSTIPPPITAPQPVTVTITQSGRTIT 394

>NCAS0B05660 Chr2 complement(1074748..1076346) [1599 bp, 532 aa]
           {ON} 
          Length = 532

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 138 TVVNDGTTISEVISFIST--------NINGSPATETSISVIPPPYSQPTAYNTTLVYDDV 189
           T+VN G TI+EV+S+ +T         +   P   T+   +  P+S P  Y +TL  DD+
Sbjct: 384 TLVNGGKTITEVVSYFTTTGYISQLPELTTLPFVGTTTRTLSDPFSIPPPYTSTLTEDDM 443

Query: 190 TVTGLVSFSPKNAGNG 205
           TV+ ++S+      +G
Sbjct: 444 TVSEIISYYSTTGSDG 459

>NDAI0K02500 Chr11 (558027..559457) [1431 bp, 476 aa] {ON} 
          Length = 476

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 28/36 (77%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPP 173
           TVV++ +T+SEV+SF ++  +G P   ++IS+IPPP
Sbjct: 339 TVVSELSTLSEVVSFFASTSDGIPVVASTISIIPPP 374

>CAGL0E00231g Chr5 complement(15452..21046) [5595 bp, 1864 aa] {OFF}
            no similarity
          Length = 1864

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 92   YTTTI--GDGTL-SEVISYIST-NVNGNAXXXXXXXXXXXXXXXXXXXXXTVVNDGTTIS 147
            YTTTI  G+G   ++++S+I+T + +G                       T+ +DG TI+
Sbjct: 1243 YTTTIDKGNGDFETDLVSHITTKDSDGKPTTITTTIPLKPSDAGEADYTTTITSDGHTIT 1302

Query: 148  EVISFIST-NINGSPAT-----------ETSISVIPPPYSQPTAYNTTLVYDD-VTVTGL 194
            EV+S I+T + +G+  T           +  +    PPYSQP    TT+  DD  + T +
Sbjct: 1303 EVVSHITTTDSDGNTVTYTTTMASFDQVDDGVYTSAPPYSQPPVVTTTVTEDDGSSKTVV 1362

Query: 195  VSFSPKNAGNGL 206
            +S+SP    +G+
Sbjct: 1363 ISYSPSEGEDGV 1374

>Kpol_1054.64 s1054 (170299..175680) [5382 bp, 1793 aa] {ON}
            (170299..175680) [5382 nt, 1794 aa]
          Length = 1793

 Score = 36.2 bits (82), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1626 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSG 1685

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +      TS +    P S P AY T +V    T T +VSF  +  
Sbjct: 1686 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTN 1745

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1746 SAGDEVVASTTYT 1758

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         +V+ 
Sbjct: 1311 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAAYTSEIVSG 1370

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +      TS +    P S P  Y T +V    TVT +VSF  +  
Sbjct: 1371 SSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSFYSTTN 1430

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1431 SAGDEVVASTTYT 1443

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 186 PLSVPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAAYTSEVVSG 245

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 246 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSF 300

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 538 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAA 597

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +
Sbjct: 598 YTSEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSGSSTVTEV 657

Query: 195 VSF 197
           VSF
Sbjct: 658 VSF 660

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ I  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1356 PLSVPAAYTSEIVSGSSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAVYTTEVVSG 1415

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1416 SSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1475

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1476 SAGDEVVASTTYT 1488

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1131 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAAYTSEVVSG 1190

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P AY T +V    T T +VSF
Sbjct: 1191 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTTEVVSGSSTATEVVSF 1245

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 231 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 290

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 291 SSTVTEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 350

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 351 SAGDEVVASTTYT 363

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1491 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 1550

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1551 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1610

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1611 SAGDEVVASTTYT 1623

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 988  VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 1047

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY + +V    T T +
Sbjct: 1048 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAAYTSEVVSGSSTATEV 1107

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1108 VSFYSTTNSAGDEVVASTTYT 1128

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 771 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTSEVVSG 830

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +       S +    P S P AY + +V    T T +VSF  +  
Sbjct: 831 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSGSSTATEVVSFYSTTN 890

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 891 SAGDEVVASTTYT 903

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T++EV+S+ ST  +                         VV  
Sbjct: 636 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVPG 695

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 696 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 755

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 756 SAGDEVVASTTYT 768

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T++EV+S+ ST  +                     
Sbjct: 943  VSTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAV 1002

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1003 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 1062

Query: 195  VSF 197
            VSF
Sbjct: 1063 VSF 1065

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 276 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSG 335

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 336 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 390

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 673 VSTTYTLDPLSVPAVYTTEVVPGSSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAV 732

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 733 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 792

Query: 195 VSF--SPKNAGNGLTKTAAFT 213
           VSF  +  +AG+ +  +  +T
Sbjct: 793 VSFYSTTNSAGDEVVASTTYT 813

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 403 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 462

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 463 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSGSSTATEV 522

Query: 195 VSF 197
           VSF
Sbjct: 523 VSF 525

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1176 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTTEVVSG 1235

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1236 SSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1295

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1296 SAGDEVVASTTYT 1308

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 591 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSG 650

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 651 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVPGSSTATEVVSF 705

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 906  PLSVPAVYTSEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 965

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 966  SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1025

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1026 SAGDEVVASTTYT 1038

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1671 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAAYTTEVVSG 1730

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1731 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 1785

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 366 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 425

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 426 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 480

>Kpol_1054.65 s1054 (175616..182530,182532..185309) [9693 bp, 3231
           aa] {ON} (175616..182530,182532..185309) [9693 nt, 3231
           aa]
          Length = 3231

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 79  PLSVPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAAYTSEVVSG 138

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +      TS +    P S P  Y T +V    TVT +VSF  +  
Sbjct: 139 SSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSFYSTTN 198

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 199 SAGDEVVASTTYT 211

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 169 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 228

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +      TS +    P S P AY + +V    T T +VSF  +  
Sbjct: 229 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAAYTSEVVSGSSTATEVVSFYSTTN 288

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 289 SAGDEVVASTTYT 301

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 799 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 858

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T++EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 859 SSTVTEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 918

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 919 SAGDEVVASTTYT 931

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1699 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1758

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1759 SSTVTEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1818

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1819 SAGDEVVASTTYT 1831

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 3096 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 3155

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 3156 SSTVTEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 3215

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 3216 SAGDEVVASTTYT 3228

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 57/132 (43%), Gaps = 4/132 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 971  VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 1030

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T++EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1031 YTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEV 1090

Query: 195  VSF-SPKNAGNG 205
            VSF S  N+  G
Sbjct: 1091 VSFYSTTNSAGG 1102

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1924 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1983

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 1984 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTVTEVVSF 2038

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 529 PLSVPAVYTSEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSG 588

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +      TS +    P S P AY T +V    T T +VSF  +  
Sbjct: 589 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTN 648

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 649 SAGDEVVASTTYT 661

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2646 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2705

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P AY T +V    T T +VSF  +  
Sbjct: 2706 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTN 2765

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2766 SAGDEVVASTTYT 2778

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2376 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSG 2435

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2436 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 2495

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2496 SAGDEVVASTTYT 2508

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 664 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 723

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +       S +    P S P AY T +V    T T +VSF  +  
Sbjct: 724 SSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAAYTTEVVSGSSTATEVVSFYSTTN 783

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 784 SAGDEVVASTTYT 796

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1114 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1173

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P AY T +V    T T +VSF  +  
Sbjct: 1174 SSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTN 1233

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1234 SAGDEVVASTTYT 1246

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 2141 VSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAA 2200

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 2201 YTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 2260

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 2261 VSFYSTTNSAGDEVVASTTYT 2281

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 2051 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 2110

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY T +V    T T +
Sbjct: 2111 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAAYTTEVVSGSSTATEV 2170

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 2171 VSFYSTTNSAGDEVVASTTYT 2191

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 349 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSG 408

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 409 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 468

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 469 SAGDEVVASTTYT 481

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 259 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSG 318

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 319 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 378

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 379 SAGDEVVASTTYT 391

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 394 PLSVPAAYTSEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 453

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF  +  
Sbjct: 454 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSFYSTTN 513

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 514 SAGDEVVASTTYT 526

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 304 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSG 363

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P AY + +V    TVT +VSF
Sbjct: 364 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSGSSTVTEVVSF 418

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 1969 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 2028

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 2029 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 2083

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1196 VSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAA 1255

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1256 YTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 1315

Query: 195  VSF 197
            VSF
Sbjct: 1316 VSF 1318

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 934  PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 993

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 994  SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSF 1048

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 124 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAVYTTEVVSG 183

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 184 SSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 238

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 1744 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSG 1803

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1804 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1863

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1864 SAGDEVVASTTYT 1876

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1159 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAAYTTEVVSG 1218

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P AY + +V    T T +VSF  +  
Sbjct: 1219 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSGSSTATEVVSFYSTTN 1278

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1279 SAGDEVVASTTYT 1291

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1556 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAV 1615

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY + +V    T T +
Sbjct: 1616 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAAYTSEVVSGSSTATEV 1675

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1676 VSFYSTTNSAGDEVVASTTYT 1696

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2691 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTTEVVSG 2750

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2751 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 2810

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2811 SAGDEVVASTTYT 2823

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1789 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1848

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1849 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1908

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1909 SAGDEVVASTTYT 1921

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1331 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 1390

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1391 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLSVPAVYTTEVVSGSSTATEV 1450

Query: 195  VSF 197
            VSF
Sbjct: 1451 VSF 1453

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 2953 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 3012

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 3013 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 3072

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 3073 VSFYSTTNSAGDEVVASTTYT 3093

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1421 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 1480

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1481 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLDPLSVPAVYTTEVVSGSSTATEV 1540

Query: 195  VSF 197
            VSF
Sbjct: 1541 VSF 1543

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1294 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 1353

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1354 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 1408

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2871 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 2930

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 2931 SSTFTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 2985

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ S   +                         VV+ 
Sbjct: 2511 PLSVPAVYTTEVVSGSSTATEVVSFYSNTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2570

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 2571 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSF 2625

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1519 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 1578

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1579 SSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 1633

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P  +P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 2096 VSTTYTLGPLLVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAA 2155

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY + +V    T T +
Sbjct: 2156 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSGSSTATEV 2215

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 2216 VSFYSTTNSAGDEVVASTTYT 2236

>Kpol_1054.67 s1054 (185410..192264) [6855 bp, 2284 aa] {ON}
           (185410..192264) [6855 nt, 2285 aa]
          Length = 2284

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 759 PLSVPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAAYTSEVVSG 818

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +      TS +    P S P AY T +V    T T +VSF
Sbjct: 819 SSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSF 873

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 121 VSTTYTLGPLSVPAVYTTEVVSGSSTFTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAV 180

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P AY T +V    T T +
Sbjct: 181 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTTEVVSGSSTATEV 240

Query: 195 VSF--SPKNAGNGLTKTAAFT 213
           VSF  +  +AG+ +  +  +T
Sbjct: 241 VSFYSTTNSAGDEVVASTTYT 261

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1336 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 1395

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY T +V    T T +
Sbjct: 1396 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAAYTTEVVSGSSTATEV 1455

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1456 VSFYSTTNSAGDEVVASTTYT 1476

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1524 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1583

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1584 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1643

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1644 SAGDEVVASTTYT 1656

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         +V+ 
Sbjct: 939  PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAAYTSEIVSG 998

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 999  SSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1058

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1059 SAGDEVVASTTYT 1071

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 579 PLSVPAVYTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 638

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +      TS +    P S P AY + +V    T T +VSF  +  
Sbjct: 639 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAAYTSEVVSGSSTATEVVSFYSTTN 698

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 699 SAGDEVVASTTYT 711

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1074 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSG 1133

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1134 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1193

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1194 SAGDEVVASTTYT 1206

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1479 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1538

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 1539 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSF 1593

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 166 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAA 225

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 226 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 285

Query: 195 VSF--SPKNAGNGLTKTAAFT 213
           VSF  +  +AG+ +  +  +T
Sbjct: 286 VSFYSTTNSAGDEVVASTTYT 306

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T++EV+S+ ST  +                     
Sbjct: 1111 VSTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAV 1170

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1171 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 1230

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1231 VSFYSTTNSAGDEVVASTTYT 1251

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 624 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAAYTSEVVSG 683

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P AY + +V    T T +VSF
Sbjct: 684 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAAYTSEVVSGSSTATEVVSF 738

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1156 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 1215

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1216 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 1275

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1276 VSFYSTTNSAGDEVVASTTYT 1296

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 391 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 450

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 451 YTTEVVSGSSTFTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEV 510

Query: 195 VSF--SPKNAGNGLTKTAAFT 213
           VSF  +  +AG+ +  +  +T
Sbjct: 511 VSFYSTTNSAGDEVVASTTYT 531

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 1569 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 1628

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 1629 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 1688

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 1689 SAGDEVVASTTYT 1701

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 444 PLSVPAVYTTEVVSGSSTFTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 503

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 504 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 563

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 564 SAGDEVVASTTYT 576

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 804 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAAYTTEVVSG 863

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 864 SSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 923

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 924 SAGDEVVASTTYT 936

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1209 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1268

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1269 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 1323

>NCAS0C05130 Chr3 complement(1045330..1046934) [1605 bp, 534 aa]
           {ON} 
          Length = 534

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query: 85  PFSLPTPYTTTIGDGTL--SEVISYISTNVN 113
           PFS+P PYT T  D +L  SE++SY STNVN
Sbjct: 431 PFSIPPPYTNTFTDLSLTVSEIVSYYSTNVN 461

>Kpol_324.1 s324 (1..16356) [16356 bp, 5451 aa] {ON} (1..16356) [16356
            nt, 5452 aa]
          Length = 5451

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P   TT +  G  T +EVIS+ ST  +                     
Sbjct: 4049 VSTTYTLGPLSVPVASTTEVVSGSSTATEVISFYSTTNSAGDEVLVSTTYTLGPLSVPAA 4108

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T++EVISF ST          SI+  P P S P A  T +V     VT +
Sbjct: 4109 STTEVVSGSSTVTEVISFYSTTNPAGDEVLVSITYTPGPLSVPAASTTEVVSGSSIVTEV 4168

Query: 195  VSF 197
            VSF
Sbjct: 4169 VSF 4171

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 51/115 (44%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2797 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2856

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +      TS +    P S P AY + +V    TVT +VSF
Sbjct: 2857 SSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAAYTSEVVSGSSTVTEVVSF 2911

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2842 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVTSTTYTLGPLSVPAAYTSEVVSG 2901

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF  +  
Sbjct: 2902 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTVTEVVSFYSTTN 2961

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2962 SAGDEVVASTTYT 2974

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 592 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 651

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T++EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 652 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTVTEVVSF 706

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1034 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 1093

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY T +V    T T +
Sbjct: 1094 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSAPAAYTTEVVSGSSTATEV 1153

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1154 VSFYSTTNSAGDEVVASTTYT 1174

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 2527 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2586

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +      TS +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2587 SSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 2646

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2647 SAGDEVVASTTYT 2659

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 3337 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 3396

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P AY T +V    T T +VSF  +  
Sbjct: 3397 SSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTN 3456

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 3457 SAGDEVVASTTYT 3469

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 224 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 283

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +
Sbjct: 284 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEV 343

Query: 195 VSF 197
           VSF
Sbjct: 344 VSF 346

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1394 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 1453

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +
Sbjct: 1454 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEV 1513

Query: 195  VSF 197
            VSF
Sbjct: 1514 VSF 1516

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 899  VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 958

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +
Sbjct: 959  YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEV 1018

Query: 195  VSF 197
            VSF
Sbjct: 1019 VSF 1021

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 2887 PLSVPAAYTSEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 2946

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2947 SSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 3006

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 3007 SAGDEVVASTTYT 3019

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 3104 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAV 3163

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T++EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 3164 YTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEV 3223

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 3224 VSFYSTTNSAGDEVVASTTYT 3244

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 637 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 696

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 697 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 751

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T++EV+S+ ST  +                     
Sbjct: 2924 VSTTYTLDPLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 2983

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 2984 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 3043

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 3044 VSFYSTTNSAGDEVVASTTYT 3064

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2032 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2091

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 2092 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSF 2146

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 3247 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 3306

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    TVT +VSF
Sbjct: 3307 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTVTEVVSF 3361

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2482 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2541

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 2542 SSTVTEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 2596

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 3419 VSTTYTLGPLSVPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 3478

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 3479 YTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 3538

Query: 195  VSF 197
            VSF
Sbjct: 3539 VSF 3541

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 277 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 336

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 337 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 391

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 952  PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1011

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1012 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 1066

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1447 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1506

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1507 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 1561

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2077 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2136

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 2137 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 2191

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 3292 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 3351

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T++EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 3352 SSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 3406

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 60/141 (42%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1124 VSTTYTLGPLSAPAAYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAA 1183

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1184 YTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 1243

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1244 VSFYSTTNSAGDEVVASTTYT 1264

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T++EV+S+ ST  +                     
Sbjct: 674 VSTTYTLDPLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAV 733

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 734 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLSVPAVYTTEVVSGSSTATEV 793

Query: 195 VSF--SPKNAGNGLTKTAAFT 213
           VSF  +  +AG+ +  +  +T
Sbjct: 794 VSFYSTTNSAGDEVVASTTYT 814

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1844 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAV 1903

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P AY + +V    T T +
Sbjct: 1904 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAAYTSEVVSGSSTATEV 1963

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1964 VSFYSTTNSAGDEVVASTTYT 1984

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 2159 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAA 2218

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                +V+  +T++EVISF ST  +       S +    P S P A  T +V    T T +
Sbjct: 2219 STTEIVSGSSTVTEVISFYSTTNSAGDEVLVSTTYTLGPLSVPAASTTEVVSGSSTATEV 2278

Query: 195  VSF 197
            +SF
Sbjct: 2279 ISF 2281

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1889 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAA 1948

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1949 YTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 2008

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 2009 VSFYSTTNSAGDEVVASTTYT 2029

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2617 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2676

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2677 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 2736

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2737 SAGDEVVASTTYT 2749

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2662 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 2721

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2722 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 2781

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2782 SAGDEVVASTTYT 2794

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 44  VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 103

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 104 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEV 163

Query: 195 VSF 197
           VSF
Sbjct: 164 VSF 166

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 764 VSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAV 823

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 824 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEV 883

Query: 195 VSF 197
           VSF
Sbjct: 884 VSF 886

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 719 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLSVPAV 778

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 779 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 838

Query: 195 VSF 197
           VSF
Sbjct: 839 VSF 841

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78  VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
           V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 359 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 418

Query: 135 XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
               VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 419 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 478

Query: 195 VSF--SPKNAGNGLTKTAAFT 213
           VSF  +  +AG+ +  +  +T
Sbjct: 479 VSFYSTTNSAGDEVVASTTYT 499

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1529 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLLVPAV 1588

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1589 YTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEV 1648

Query: 195  VSF--SPKNAGNGLTKTAAFT 213
            VSF  +  +AG+ +  +  +T
Sbjct: 1649 VSFYSTTNSAGDEVVASTTYT 1669

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 457 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 516

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 517 SSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 576

Query: 201 NAGNGLTKTAAFT 213
           +AG+ +  +  +T
Sbjct: 577 SAGDEVVASTTYT 589

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 2122 PLSVPAVYTTEVVSGSSTVTEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 2181

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P A  T +V    TVT ++SF
Sbjct: 2182 SSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAASTTEIVSGSSTVTEVISF 2236

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 4/133 (3%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2572 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLTSTTYTLGPLSVPAVYTTEVVSG 2631

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF--SPK 200
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF  +  
Sbjct: 2632 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSFYSTTN 2691

Query: 201  NAGNGLTKTAAFT 213
            +AG+ +  +  +T
Sbjct: 2692 SAGDEVVASTTYT 2704

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P   TT +  G  T++EV+S+ ST  +                         VV+ 
Sbjct: 4417 PLSVPAASTTEVVSGSSTVTEVVSFYSTTNSAGDEVLASTTYTLGPLSVPVASTTEVVSG 4476

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             + ++EV+SF ST  +       S +  P P S P A  T +V    T T ++SF
Sbjct: 4477 SSIVTEVVSFYSTTNSAGDEVLVSTTYTPVPLSVPAASTTEVVSGSSTATEVISF 4531

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 2977 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 3036

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 3037 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 3091

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 78   VERTYT-TPFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXX 134
            V  TYT  P S+P  YTT +  G  T +EV+S+ ST  +                     
Sbjct: 1799 VSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAV 1858

Query: 135  XXXTVVNDGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGL 194
                VV+  +T +EV+SF ST  +       S +    P S P  Y T +V    T T +
Sbjct: 1859 YTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEV 1918

Query: 195  VSF 197
            VSF
Sbjct: 1919 VSF 1921

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1672 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLASTTYTLGPLSVPAVYTTEVVSG 1731

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1732 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 1786

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1222 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1281

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1282 SSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 1336

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1717 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1776

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1777 SSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSGSSTATEVVSF 1831

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 7   PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVVVSTTYTLGPLSVPAVYTTEVVSG 66

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 67  SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 121

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YT+ +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1177 PLSVPAAYTSEVVSGSSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSG 1236

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1237 SSTATEVVSFYSTTNSAGDEVVASTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 1291

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P   TT +  G  T +EV+S+ ST                            VV+ 
Sbjct: 3877 PLSVPAASTTEVVSGSSTATEVVSFYSTTNPAGDEVLVSTTYTLGPLSVPVASTTEVVSG 3936

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             + ++EV+SF ST  +       S +  P P S P  Y T +V    T T +VSF
Sbjct: 3937 SSIVTEVVSFYSTTNSAGDEVLVSTTYTPVPLSVPAVYTTEVVSGSSTATEVVSF 3991

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85  PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
           P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 97  PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 156

Query: 143 GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
            +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 157 SSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 211

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 48/115 (41%), Gaps = 2/115 (1%)

Query: 85   PFSLPTPYTTTI--GDGTLSEVISYISTNVNGNAXXXXXXXXXXXXXXXXXXXXXTVVND 142
            P S+P  YTT +  G  T +EV+S+ ST  +                         VV+ 
Sbjct: 1267 PLSVPAVYTTEVVSGSSTATEVVSFYSTTNSAGDEVLVSTTYTLDPLSVPAVYTTEVVSG 1326

Query: 143  GTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
             +T +EV+SF ST  +       S +    P S P  Y T +V    T T +VSF
Sbjct: 1327 SSTATEVVSFYSTTNSAGDEVLVSTTYTLGPLSVPAVYTTEVVSGSSTATEVVSF 1381

>Smik_2.200 Chr2 complement(353976..354085,354146..354668) [633 bp,
           210 aa] {ON} YBR067C (REAL)
          Length = 210

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 29  VLYSYQQI--YSTNKFAT-YTDINLSEFSAMVEPMPMYTVRVSEQLVQAVASVER 80
           VL  YQQ+  YS + + T +++++    +  +  +P YT R+S ++  AVASV +
Sbjct: 58  VLSVYQQVITYSDDAYTTLFSELDFDAITKTIVALPWYTTRLSSEIAAAVASVSQ 112

>KNAG0I02500 Chr9 complement(483170..486460) [3291 bp, 1096 aa] {ON}
           
          Length = 1096

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 64/137 (46%), Gaps = 7/137 (5%)

Query: 74  AVASVERTYTTPFSLPTPYTTTIGD---GTLSEVISYISTNVNGNAXXXXXXXXXXXXXX 130
           +VA++    T PF++P+ Y+TT  D    + +EV+SY  T    +               
Sbjct: 394 SVATLTSVTTIPFTIPSEYSTTATDEAGSSATEVVSYF-TKTGADKGLETGTTTITIPFT 452

Query: 131 XXXXXXXTVVN-DGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLV-YDD 188
                  T  N D ++++E++S+  T I  +   ET ++    P++ P+AY TT    +D
Sbjct: 453 VPSAYTTTAANGDDSSVTEIVSYF-TKIGSAGDLETGMTTTTVPFTIPSAYTTTAANGND 511

Query: 189 VTVTGLVSFSPKNAGNG 205
            + T ++S+  K    G
Sbjct: 512 SSATEIISYFTKTGSAG 528

>NCAS0C05460 Chr3 (1108362..1109945) [1584 bp, 527 aa] {ON} 
          Length = 527

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 75  VASVERTYTTPFSLPTPYTTTIGD--GTLSEVISYISTNVNGN 115
           + +   T + PFS+P PYT+T  D   T+SE+ISY ST  NG 
Sbjct: 414 LGTTTSTISVPFSIPHPYTSTFTDLNMTVSEIISYYSTLSNGR 456

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 2/27 (7%)

Query: 86  FSLPTPYTTTIGDGTL--SEVISYIST 110
           FSLP+PYTTT+ +G L  +EV+SY +T
Sbjct: 372 FSLPSPYTTTVTNGLLTQTEVVSYFTT 398

>TBLA0C00110 Chr3 complement(1..3039) [3039 bp, 1013 aa] {ON} 
          Length = 1013

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 86  FSLPTPYTTTI--GDGTLSEVIS-YISTNVNG--NAXXXXXXXXXXXXXXXXXXXXXTVV 140
           ++LP  YTTT+  G  T++EV+S Y +T+ NG  +                      TVV
Sbjct: 774 YNLPPVYTTTVVSGSSTVTEVVSPYTTTDSNGLPSTGTTTYAISGTSSESGSSVYTTTVV 833

Query: 141 NDGTTISEVIS-FISTNINGSPATETSISVIPPPYSQ------PTAYNTTLVYDDVTVTG 193
           +  +T++EV+S + +T+ NG P+T T+   I    S+      P  Y TT+V    TVT 
Sbjct: 834 SGSSTVTEVVSPYTTTDYNGLPSTGTTTYAISGTSSESGSSGLPPVYTTTVVSGSSTVTE 893

Query: 194 LVSFSPKNAGNGLTKTA 210
           +VS       NGL  T 
Sbjct: 894 VVSPYTTTDSNGLPSTG 910

>NCAS0E03100 Chr5 complement(615182..616771) [1590 bp, 529 aa] {ON} 
          Length = 529

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 22/27 (81%), Gaps = 2/27 (7%)

Query: 86  FSLPTPYTTTIGDGTL--SEVISYIST 110
           FSLP+PYTTTI +G L  +EV+SY +T
Sbjct: 373 FSLPSPYTTTITNGLLTQTEVVSYFTT 399

>NCAS0F02620 Chr6 complement(530092..534018) [3927 bp, 1308 aa] {ON}
           
          Length = 1308

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 138 TVVNDGTTISEVISFISTNINGSPATETSISVIPPP 173
           T    G+T S V+ + ST  NG PAT T+   IPPP
Sbjct: 298 TATTRGSTWSGVVEYYSTQSNGKPATGTTTFTIPPP 333

>TBLA0A01140 Chr1 (260819..261526) [708 bp, 235 aa] {ON} 
          Length = 235

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 1   MNILLSDFTNNEITYVSYI-YMHAPSLGSVLYSYQQIYSTNKFATYT----DINLSEFSA 55
           M I+LSD  +N   YV  +  M  P     L+    I +T    +YT     +++++ SA
Sbjct: 29  MQIILSDVNDNLQDYVGLVGSMDIPQ---ALFDLYAIKATATDDSYTKLMAQLDMNQISA 85

Query: 56  MVEPMPMYTVRVSEQLVQ 73
           M+  +P Y+ R+  ++ Q
Sbjct: 86  MLTVLPWYSSRLEAKVAQ 103

>CAGL0L10092g Chr12 (1084445..1088695) [4251 bp, 1416 aa] {ON} no
           similarity
          Length = 1416

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 138 TVVNDGTTISEVISFI-STNINGSPAT-----------ETSISVIPPPYSQPTAYNTTLV 185
           T+V+DG TI+EV+S + +T+ +G   T           +  +   P PYSQP    TT+ 
Sbjct: 808 TIVSDGHTITEVVSHVTTTDSDGKTITYITTMASYDQVDEGVFTSPAPYSQPPVVTTTIT 867

Query: 186 YDD 188
            DD
Sbjct: 868 EDD 870

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 138 TVVNDGTTISEVISFI-STNINGSPAT-----------ETSISVIPPPYSQPTAYNTTLV 185
           T+V+DG TI+EV+S + +T+ +G   T           +  +   P PYSQP    TT+ 
Sbjct: 910 TIVSDGHTITEVVSHVTTTDSDGKTITYITTMASYDQVDEGVFTSPAPYSQPPVVTTTIT 969

Query: 186 YDD 188
            DD
Sbjct: 970 EDD 972

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 138  TVVNDGTTISEVISFI-STNINGSPAT-----------ETSISVIPPPYSQPTAYNTTLV 185
            T+V+DG TI+EV+S + +T+ +G   T           +  +   P PYSQP    TT+ 
Sbjct: 1012 TIVSDGHTITEVVSHVTTTDSDGKTITYITTMASYDQVDEGVFTSPAPYSQPPVVTTTIT 1071

Query: 186  YDD 188
             DD
Sbjct: 1072 EDD 1074

>NCAS0E03550 Chr5 complement(706081..707667) [1587 bp, 528 aa] {ON} 
          Length = 528

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 22/27 (81%), Gaps = 2/27 (7%)

Query: 86  FSLPTPYTTTIGDGTL--SEVISYIST 110
           FSLP+PYTTTI +G L  +EV+SY +T
Sbjct: 372 FSLPSPYTTTITNGFLTQTEVVSYFTT 398

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 2/32 (6%)

Query: 81  TYTTPFSLPTPYTTTIGD--GTLSEVISYIST 110
           T + PFS+P PYT+T  D   T+SE+ISY ST
Sbjct: 420 TISVPFSIPHPYTSTFTDLNMTVSEIISYYST 451

>NCAS0J00380 Chr10 (55926..57737) [1812 bp, 603 aa] {ON} 
          Length = 603

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 146 ISEVIS--FISTNINGSPATE------TSISVIPPPYSQPTAYNTTLVYDDVTVTGLVSF 197
           +SE++S  F    I+G PA        T+ S IP  +S P  Y TT++ D + V+ LVSF
Sbjct: 469 VSELVSYSFTHGAISGMPALSDVPMYITTTSTIPAGFSIPPPYTTTVITDSMAVSELVSF 528

>KNAG0I02620 Chr9 (505371..508961) [3591 bp, 1196 aa] {ON} 
          Length = 1196

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 63/137 (45%), Gaps = 7/137 (5%)

Query: 74  AVASVERTYTTPFSLPTPYTTTIGD---GTLSEVISYISTNVNGNAXXXXXXXXXXXXXX 130
           +VA++    T PF++P+ Y+TT  D    + +EV+SY  T    +               
Sbjct: 369 SVATLTSVTTIPFTIPSEYSTTATDEAGSSATEVVSYF-TKTGADKGLETGTTTITIPFT 427

Query: 131 XXXXXXXTVVN-DGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTLV-YDD 188
                  T  N D ++++E++S+  T I  +   ET  +    P++ P+AY TT    +D
Sbjct: 428 VPSAYTTTAANGDDSSVTEIVSYF-TKIGSAGDLETGTTTTTVPFTIPSAYTTTAANGND 486

Query: 189 VTVTGLVSFSPKNAGNG 205
            + T ++S+  K    G
Sbjct: 487 SSATEIISYFTKTGSAG 503

>NDAI0F00150 Chr6 complement(16653..18713) [2061 bp, 686 aa] {ON} 
          Length = 686

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%), Gaps = 2/27 (7%)

Query: 86  FSLPTPYTTTI--GDGTLSEVISYIST 110
           F++P P TT++  GD T+SEVISY ST
Sbjct: 327 FTIPDPITTSVVSGDATVSEVISYYST 353

>ADR378W Chr4 (1382492..1385557) [3066 bp, 1021 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR349W (CIN1)
          Length = 1021

 Score = 30.8 bits (68), Expect = 4.4,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 142 DGTTISEVISFISTNINGSPATETSISVIPPPYSQPTAYNTTL 184
           D  T+ E++  IS+N+NG P  ET+I  I    + P   +  L
Sbjct: 2   DLKTVDELLESISSNLNGGPNKETAIRAINEFQADPLQLDRKL 44

>TPHA0I02140 Chr9 (475414..476148) [735 bp, 244 aa] {ON} Anc_7.161
          YER011W
          Length = 244

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 1  MNILLSDFTNNEITYVSYIYMHAPSLGSVLYSYQQIYSTNKFATY----TDINLSEFSAM 56
          + +L++D T+N+  Y+S I     +L + L +   +Y+T   + Y    T IN +E  ++
Sbjct: 28 IQLLVNDITSNQQEYLSLIANGQITLPADLLALYGVYATATDSAYTTLFTQINPTEVQSL 87

Query: 57 VEPMPMYTVRV 67
          V  +P Y+ R+
Sbjct: 88 VTQLPWYSSRL 98

>NCAS0G02790 Chr7 (508184..511636) [3453 bp, 1150 aa] {ON}   null
           allele or possible pseudogene; frameshift artificially
           corrected by inserting NN; Sanger sequence data also
           requires the same frameshift
          Length = 1150

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 22/126 (17%)

Query: 88  LPTPYTTTIGDGTLSE--VIS-YISTNVNGNAXXXXXX---XXXXXXXXXXXXXXXTVVN 141
           +P PYTTTI  GT S+  ++S YI+T+ +G                          T+V+
Sbjct: 632 VPPPYTTTIVSGTSSQTDIVSFYITTDSSGKPTTVATTYPIGASSSVSGVPPPYTTTIVS 691

Query: 142 DGTTISEVISF-ISTNINGSPAT---------ETSISVIPPPYSQPTAYNTTLVYDDVTV 191
             ++ ++V+SF  +T+ +G P T          +S+S +PPP      Y TT+V+   + 
Sbjct: 692 GSSSQTDVVSFYTTTDSSGKPTTVATTYPVGASSSVSGVPPP------YTTTVVFGTSSE 745

Query: 192 TGLVSF 197
           T +VSF
Sbjct: 746 TDIVSF 751

>CAGL0C00968g Chr3 (96914..100018) [3105 bp, 1034 aa] {ON} some
           similarities with uniprot|Q08294 Saccharomyces
           cerevisiae YOL155c
          Length = 1034

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 12/65 (18%)

Query: 138 TVVNDGTTISEVISFIST-NINGSPAT-----------ETSISVIPPPYSQPTAYNTTLV 185
           T+ +DG TI+EV+S I+T + +G   T           +  +   P PYSQP    +T+ 
Sbjct: 410 TITSDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEGVFTSPEPYSQPPVVTSTVT 469

Query: 186 YDDVT 190
            DD T
Sbjct: 470 EDDGT 474

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 138 TVVNDGTTISEVISFIST-NINGSPAT-----------ETSISVIPPPYSQPTAYNTTLV 185
           T+ +DG TI+EV+S I+T + +G   T           +  +   P PYSQP    +T+ 
Sbjct: 512 TITSDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEGVFTSPEPYSQPPVVTSTVT 571

Query: 186 YDD 188
            DD
Sbjct: 572 EDD 574

>CAGL0C01133g Chr3 (114805..117915) [3111 bp, 1036 aa] {ON} some
           similarities with uniprot|Q08294 Saccharomyces
           cerevisiae YOL155c
          Length = 1036

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 13/82 (15%)

Query: 138 TVVNDGTTISEVISFIST-NINGSPAT-----------ETSISVIPPPYSQPTAYNTTLV 185
           T  +DG TI+EV+S I+T + +G   T           +  +   P PYSQP    +T+ 
Sbjct: 425 TYTSDGHTITEVVSHITTTDSDGKTVTITTTMASFDQVDEGVFTSPEPYSQPPVVTSTVT 484

Query: 186 YDD-VTVTGLVSFSPKNAGNGL 206
            DD  + T ++S+ P    +G+
Sbjct: 485 EDDGSSKTVVISYFPSEGEDGV 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,170,541
Number of extensions: 857757
Number of successful extensions: 4243
Number of sequences better than 10.0: 123
Number of HSP's gapped: 3395
Number of HSP's successfully gapped: 830
Length of query: 269
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 161
Effective length of database: 41,097,471
Effective search space: 6616692831
Effective search space used: 6616692831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)