Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B003108.838ON56456427590.0
NDAI0E003008.838ON6646567869e-96
TDEL0B005908.838ON5413715702e-65
ZYRO0G14146g8.838ON5073665472e-62
YML114C (TAF8)8.838ON5104845113e-57
Suva_13.298.838ON5094484912e-54
Kpol_1068.108.838ON6173474893e-53
Smik_13.208.838ON5104484833e-53
Kwal_27.102728.838ON5513854432e-47
TPHA0I002308.838ON6143874392e-46
KLTH0C03916g8.838ON5703654242e-44
Skud_13.278.838ON5144734212e-44
TBLA0D032508.838ON6835084159e-43
KAFR0A028208.838ON4533494041e-42
SAKL0D01518g8.838ON5745524073e-42
ABL128W8.838ON4743563841e-39
Ecym_46098.838ON5204323762e-38
KLLA0D01617g8.838ON5623962651e-23
KNAG0G034108.838ON5263892481e-21
CAGL0B02299g8.838ON6432102286e-19
KNAG0M002504.372ON25691780.45
KNAG0A019608.542ON75445724.4
TPHA0J013905.670ON66956714.9
YMR277W (FCP1)8.839ON73270715.7
Smik_13.4908.839ON73270706.6
NDAI0B002501.175ON46830689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00310
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...  1067   0.0  
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   307   9e-96
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   224   2e-65
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   215   2e-62
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   201   3e-57
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   193   2e-54
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   192   3e-53
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   190   3e-53
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   175   2e-47
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   173   2e-46
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   167   2e-44
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   166   2e-44
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   164   9e-43
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   160   1e-42
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   161   3e-42
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   152   1e-39
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   149   2e-38
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   106   1e-23
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   100   1e-21
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    92   6e-19
KNAG0M00250 Chr13 complement(38240..39010) [771 bp, 256 aa] {ON}...    35   0.45 
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...    32   4.4  
TPHA0J01390 Chr10 (323615..325624) [2010 bp, 669 aa] {ON} Anc_5....    32   4.9  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...    32   5.7  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...    32   6.6  
NDAI0B00250 Chr2 complement(44784..46190) [1407 bp, 468 aa] {ON}...    31   9.6  

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/564 (94%), Positives = 534/564 (94%)

Query: 1   MAETVTSSSSPTLKKEQDLILNDTQEEPLMNELTNPTEIPSNSSDEQVRKLLNKSIALQL 60
           MAETVTSSSSPTLKKEQDLILNDTQEEPLMNELTNPTEIPSNSSDEQVRKLLNKSIALQL
Sbjct: 1   MAETVTSSSSPTLKKEQDLILNDTQEEPLMNELTNPTEIPSNSSDEQVRKLLNKSIALQL 60

Query: 61  KPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSE 120
           KPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSE
Sbjct: 61  KPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSE 120

Query: 121 LHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFE 180
           LHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFE
Sbjct: 121 LHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFE 180

Query: 181 ISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSI 240
           ISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQ                  DITEQSSI
Sbjct: 181 ISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSI 240

Query: 241 ENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGN 300
           ENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGN
Sbjct: 241 ENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGN 300

Query: 301 YAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVSRSDLKLEIKNSLQRSYKSI 360
           YAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVSRSDLKLEIKNSLQRSYKSI
Sbjct: 301 YAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVSRSDLKLEIKNSLQRSYKSI 360

Query: 361 FRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQLLAALSMETSGENTKTE 420
           FRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQLLAALSMETSGENTKTE
Sbjct: 361 FRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQLLAALSMETSGENTKTE 420

Query: 421 SNLTGVNDQKLNEFSTIATNIEDVEDDGIGLFGDLESSDEDNDDKVXXXXXXXXXXXXLP 480
           SNLTGVNDQKLNEFSTIATNIEDVEDDGIGLFGDLESSDEDNDDKV            LP
Sbjct: 421 SNLTGVNDQKLNEFSTIATNIEDVEDDGIGLFGDLESSDEDNDDKVNNTNTSIDNNNILP 480

Query: 481 VDGTPDNETASVASNIIAVAPNQPEEIISSVSDSINENVTLKNPNEPKHTESDDSGTFDD 540
           VDGTPDNETASVASNIIAVAPNQPEEIISSVSDSINENVTLKNPNEPKHTESDDSGTFDD
Sbjct: 481 VDGTPDNETASVASNIIAVAPNQPEEIISSVSDSINENVTLKNPNEPKHTESDDSGTFDD 540

Query: 541 QNFLFQDVATSEIDKLNNGNDTIV 564
           QNFLFQDVATSEIDKLNNGNDTIV
Sbjct: 541 QNFLFQDVATSEIDKLNNGNDTIV 564

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  307 bits (786), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 234/656 (35%), Positives = 332/656 (50%), Gaps = 135/656 (20%)

Query: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISE 89
           MNE+  P EI  N  D Q+ KLL KSIA+QLK   ++ S+LAFN+L+LLV+DQL+ LI+E
Sbjct: 12  MNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITE 71

Query: 90  LHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSK-NGKDYDTL------ 142
           LHR+S++QRRN+ AK D+EL +RG N+N S+L+YQ + S +++ K +GK+Y  L      
Sbjct: 72  LHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEE 131

Query: 143 -------IKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFE-ISIPNWLPAFPPDH 194
                  I +SST  D+ D      + S   + SNILIKP NPF+ I+I +WLP+FPPDH
Sbjct: 132 VVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDH 191

Query: 195 TYKFTPQFNKPITDQVLIKQXXXXXXXXXXXXXXXXXXDIT------------------- 235
           TYKFTPQFN PITD+ LIKQ                  +I+                   
Sbjct: 192 TYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSL 251

Query: 236 -----------EQSSIENEET----------SNFDSELAREENIAIYGYDAMS----RKK 270
                      E+   +NE+            + D  LA EE +AIYG  + S    R  
Sbjct: 252 SNEGPITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDS 311

Query: 271 RKPPHLISIHDTE-QNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFL 329
              P++ISIHD +  NFF H    K F+V  Y+H RVEL RK+VE FE ++L+ EKNPFL
Sbjct: 312 SSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFL 371

Query: 330 RLSRMINDKKV--------------------------------SRSDLKLEIKNSLQRSY 357
           +LS+++  +K                                  R+ +  EI ++L+RS+
Sbjct: 372 KLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSF 431

Query: 358 KSIFRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQLLAALSMETSGENT 417
            SI  NYPKLK+ + +R++LA +KR++++++L+   E+ +K ++ +LL      T  EN 
Sbjct: 432 YSILNNYPKLKKAKKQRVKLAIEKRDQRLQELRKIQEEERKVKEQKLL------TKSENP 485

Query: 418 KTESNLTGVNDQKLNEFSTIATNIEDVE---DDGIGLFGDLESSDEDNDDKVXXXXXXXX 474
              SN + V       FST  T+I DVE   +DG+GLF  L SS+E+ +++         
Sbjct: 486 LLSSNTSIV-------FSTHPTDIADVEAEGEDGLGLFAGLGSSEEEEEEEEEEEEGEQQ 538

Query: 475 XXXX---LPVDGTPDNE---TASVASNI----------IAVAPNQPEEIISSVSDSINEN 518
                  L   G+   E   T +   N           I+V PN  E    S  D I   
Sbjct: 539 TATTHNVLQQLGSQRKEKEGTMTTTGNTSVKIGEKQTDISVEPNNHETTEGSTQD-IRTT 597

Query: 519 VTLKNPNEPKHTESDDSG----------TFDDQNFLFQDVATSEIDKLNNGNDTIV 564
               N  + K   +D  G           FDD NFLF+DV TSE DK    N + +
Sbjct: 598 EEQTNVEQAKQKPTDGQGKEELEDEEEDDFDDHNFLFEDVVTSEFDKPGEDNKSTI 653

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  224 bits (570), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 209/371 (56%), Gaps = 18/371 (4%)

Query: 38  EIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQ 97
           EI    ++  V K+L+K++ALQLKP+  ++S+ AF  L +L++DQL+ +I +LHR S +Q
Sbjct: 20  EIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMIGQLHRFSNVQ 79

Query: 98  RRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMA 157
           RR + AK D+ L L+G NL  ++L  Q Q S +     GK++D+L     T  D+     
Sbjct: 80  RRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKETFTDAVVDED 139

Query: 158 NPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXX 217
           N G + ++N     L++PNNP    IP W+PAFPPDHTYKFTPQ+N+PITD+ +I++   
Sbjct: 140 N-GSEDVINE----LVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQPITDETIIRRRIV 194

Query: 218 XXXXXXXXXXXXXXXDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLI 277
                          ++   +   + + +++D  L REE  AIYG +   RKK       
Sbjct: 195 DEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYGNEQKKRKK------- 247

Query: 278 SIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMI-- 335
           +   +       PQ +  F++  YA  RVE+ RK+V E+E  Q+K ++NPF++ S++   
Sbjct: 248 NASSSSDLLSKLPQTN--FSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALS 305

Query: 336 -NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLKIQNE 394
            +  K  R     EI + LQRS + + ++ P+L+  +      A QKR+E++++L+ +  
Sbjct: 306 NSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQELRDKKA 365

Query: 395 Q-LKKDRDAQL 404
           Q LK   D QL
Sbjct: 366 QKLKNFTDQQL 376

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  215 bits (547), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 213/366 (58%), Gaps = 25/366 (6%)

Query: 48  VRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDI 107
           V K+L KS+ALQLKP+N +++Q AF+ L  LV+ QL+ +IS+LHRMS +QRR   AK DI
Sbjct: 25  VVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIAKGDI 84

Query: 108 ELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMAN---PGHD-- 162
            +L+ G N++ S +  Q ++S F   K  K+++ L     ++ D   ++A+   P  D  
Sbjct: 85  SMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHL----HSLRDLQSSLAHEMVPFEDQE 140

Query: 163 SMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXXXXXXX 222
           ++  N S +L+ P NP +  +P WLP FPPDHTYKFTPQ++ PITD+  I++        
Sbjct: 141 AVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIVEEAKQ 200

Query: 223 XXXXXXXXXXDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIHDT 282
                            I N   S +DSELA +E +AIYG     RK + P       ++
Sbjct: 201 SELALSHLSQKKNPTDDIVNR--SQYDSELAEQETLAIYGSQLKKRKTQHPQ-----ANS 253

Query: 283 EQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRM----INDK 338
                  PQ +  F+V  YAH R+E+ RK+V EFE  QL+ +++PFL+LSR+     ND 
Sbjct: 254 ADLLSKLPQTN--FSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCND- 310

Query: 339 KVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKK 398
           K ++  +  E + +LQRS+  + ++ P+L++ +    E A+++R +++++L+ Q E+ +K
Sbjct: 311 KFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSKRLQELRAQREEQEK 370

Query: 399 --DRDA 402
             +RD 
Sbjct: 371 KGERDV 376

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  201 bits (511), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 157/484 (32%), Positives = 244/484 (50%), Gaps = 53/484 (10%)

Query: 37  TEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVI 96
           TEI     D  V ++L K++  QL  LN+ +S  A +EL  LV  Q+D +   LH ++++
Sbjct: 26  TEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMFRNLHNLTLL 85

Query: 97  QRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTM 156
           QRR+ A++ D++LLLR  NL+   L+ Q Q S F+KSK+  +Y+ L+  SS        +
Sbjct: 86  QRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSS--------L 137

Query: 157 ANPGHDSMV-----------NNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKP 205
           A   H+               N  N+L+ P+NP E  IP+WLP FPPDHTYKFTP+FN P
Sbjct: 138 AALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFNHP 197

Query: 206 ITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENE-ETSNFDSELAREENIAIYGYD 264
           ITD   IK+                   ++  SS  N  +    D E A E+ + I+G +
Sbjct: 198 ITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQLEIWG-N 256

Query: 265 AMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWE 324
           A+  ++RKP    +I  TE++F  +       N+  YA +RVEL R+RV +FE+ QLK  
Sbjct: 257 AL--EERKP----TI--TEKSFNEN-------NIEQYAKYRVELARERVTKFEVNQLKRT 301

Query: 325 KNPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQK 381
           KNPFL++S  +        S   ++  I+   ++S      N PK+++ +  ++ +A   
Sbjct: 302 KNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMA--- 358

Query: 382 REEKIEKLKIQNEQL---KKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIA 438
           +EE+ + LK + E+L   +  R+      L +  + E+ +  ++ T   +   N    I 
Sbjct: 359 KEERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVIN 418

Query: 439 TNIEDVEDDGIGLFGDLESSDEDNDDKVXXXXXXXXXXXXLPVDGTPDNETASVASNIIA 498
           TN ED EDD I LFG L SS+++N+               L  +  P   TA   +N   
Sbjct: 419 TNAED-EDDDINLFGILGSSEDENE-------MSSMPAENLVAESEPPTMTAQDTTNTTP 470

Query: 499 VAPN 502
           VA N
Sbjct: 471 VAHN 474

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  193 bits (491), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 147/448 (32%), Positives = 232/448 (51%), Gaps = 36/448 (8%)

Query: 30  MNELTN-P--TEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFL 86
           M +LTN P  TE+     D  V ++L KS+  QL  LN+ +S  A +E+  LV  Q+D +
Sbjct: 16  MVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGM 75

Query: 87  ISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDS 146
              LH ++++QRR+  ++ D++LL R  NLN + L  QLQ+S  +KSK+  +Y+ L+K S
Sbjct: 76  FRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKSS 135

Query: 147 STIFDSSDTMANPGHDSMV---NNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFN 203
           S    S          + +    N  N+L+ P+NP E  IP+WLP FPPDHTYKFTP+FN
Sbjct: 136 SFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195

Query: 204 KPITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENEETSNFDSELAREENIAIYGY 263
            PITD   IK+                   +   SS  +  +          E + I+G 
Sbjct: 196 HPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWGN 255

Query: 264 DAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKW 323
               RK    P +I+    E+            N+  YA +R+EL R+RV +FE+ QLK 
Sbjct: 256 TLHERK----PAIIAKSFNEK------------NIEQYAKYRIELARERVSKFEVNQLKR 299

Query: 324 EKNPFLRLSRMINDKK---VSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQ 380
            KNPFL++S  +   K    S   ++  I   L++S      N PK+++ +  +++LA++
Sbjct: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359

Query: 381 KREEKI----EKLKIQNEQLKKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFST 436
           +R++ +    E+L  Q ++ ++D    L   L+ E + E+T   +NL  +N       ST
Sbjct: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALN------VST 413

Query: 437 IATNI-EDVEDDGIGLFGDLESSDEDND 463
           I  N   D +DD + LFG L SS+++N+
Sbjct: 414 IDINANADGDDDDMNLFGILGSSEDENE 441

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  192 bits (489), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 124/347 (35%), Positives = 184/347 (53%), Gaps = 19/347 (5%)

Query: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLE--LSQLAFNELSLLVNDQLDFLI 87
           + EL   TE     ++  + K+L K++ALQLK +N +  +++ AF  L  LV  Q+D ++
Sbjct: 11  LTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMV 70

Query: 88  SELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSS 147
            ELHR+S +QRRN  AK DI + LRG NL   +L  Q Q S ++     KDY++L K ++
Sbjct: 71  LELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLTKIAT 130

Query: 148 TIFDSSDTMA--NPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKP 205
           T   +  T    +  H       ++ L+  +NP +  IP+WLP FPPD+TYKFTPQ+N P
Sbjct: 131 TTTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFTPQYNTP 190

Query: 206 ITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENEETSNFDSELAREENIAIYGYDA 265
           ITD+ +I++                     E     + + S+ + ELA EE +A Y    
Sbjct: 191 ITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSSEMELATEETLATYSAIT 250

Query: 266 MSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEK 325
           +  K     HL S       FF         NV  YA  RVE+ RK+V  +E  QL+ ++
Sbjct: 251 LRNK-----HLTS-------FFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQR 298

Query: 326 NPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQ 369
           NPFL++SR+I   ND KVS+S    EI+  L+RS  +   + PK +Q
Sbjct: 299 NPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  190 bits (483), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 230/448 (51%), Gaps = 38/448 (8%)

Query: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISE 89
           +  L + TEI     D  V ++L K++  QL  LN+ +S  A +EL  LV  Q+D +   
Sbjct: 19  LRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMFRN 78

Query: 90  LHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTI 149
           LH ++++QRR+ A++ D++LL R  N++ + L+ Q QVS F+KS +  +Y  L++ SS  
Sbjct: 79  LHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSSFP 138

Query: 150 F------DSSDTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFN 203
                  D  D ++N        +  N+L+ P+NP E  IP+WLP FPPDHTYKFTP+FN
Sbjct: 139 ALAHNEEDEEDELSNIEEQ---QSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195

Query: 204 KPITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENEETSN-FDSELAREENIAIYG 262
            PITD   IK+                   ++  SS  +       D   A E+ + I+G
Sbjct: 196 HPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLDDADATEQQLEIWG 255

Query: 263 YDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLK 322
            +A+  ++RKP    +I  T  N           N+  YA +RVEL R+RV +FEL QLK
Sbjct: 256 -NAL--QERKP----TITATSLN---------ESNIEQYAKYRVELARERVAKFELNQLK 299

Query: 323 WEKNPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELAR 379
             KNPFL+LS  +        S   ++  I    ++S      N PK+++ +  R+ +A+
Sbjct: 300 RTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAK 359

Query: 380 QKREEKI----EKLKIQNEQLKKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFS 435
           ++R + +    E+L  + ++ ++D    L   L+ E + E T   +     N+  +    
Sbjct: 360 EERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPNVANNSTI---- 415

Query: 436 TIATNIEDVEDDGIGLFGDLESSDEDND 463
            I  N  D EDD + LFG L SS+++N+
Sbjct: 416 IINANAND-EDDDMNLFGILGSSEDENE 442

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  175 bits (443), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 213/385 (55%), Gaps = 42/385 (10%)

Query: 38  EIPSNSSDEQVRKLLNKSIALQLKPLNLE--LSQLAFNELSLLVNDQLDFLISELHRMSV 95
           EIP    D+ ++KLL K+IA+QLK +N +  +SQLAF  L +LV + L  ++ +LH+M+ 
Sbjct: 29  EIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMAN 88

Query: 96  IQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDT 155
           IQRR+  +K D+ L++ G NL+ S+L  +L+ S +++S++ +    + +DS  +     T
Sbjct: 89  IQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSKYVEKQEHT 148

Query: 156 ------MANPGHDS--MVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPIT 207
                 + +  H    +++     L+ P+      +P WLP FPPDHTY+FT Q+NKPIT
Sbjct: 149 PLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYRFTAQYNKPIT 208

Query: 208 DQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENEETSN--FDS----ELAREENIAIY 261
           D+ L+K+                   +   S + +EE S+   DS    E A++E   ++
Sbjct: 209 DERLMKRKLAEEANLSEKA-------LIHLSMLSHEEASSGPIDSDTIYEEAQQETQLLF 261

Query: 262 GYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQL 321
           G      KK+K   +  ++D  +     PQ  ++F+V  YA  RVE+ R+RV E+E  QL
Sbjct: 262 G----PVKKKKTAAINEVNDLLRTL---PQ--QNFSVEEYARNRVEIARRRVNEYERHQL 312

Query: 322 KWEKNPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELA 378
           + +K  F++ + ++   + K+ S   ++ EI+  L RS   + ++ P LK+ R R + LA
Sbjct: 313 QLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372

Query: 379 RQKREEKIEKLKIQNEQLKKDRDAQ 403
            + R       ++++E+L+K+R+A+
Sbjct: 373 EENR-------RLRDEKLRKEREAR 390

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 205/387 (52%), Gaps = 41/387 (10%)

Query: 51  LLNKSIALQLKPLNLE--LSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIE 108
           +L K+IALQLK +N +  +++ AF  L+ LV++QL  +++++ +++ +QRR   AK DI+
Sbjct: 69  ILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKKDID 128

Query: 109 LLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSS------TIFDSSDTMANPGHD 162
           L LRG NL  S+L    Q S ++K K G +   L + ++      T+F  +D       D
Sbjct: 129 LWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVLTVFKKTDKTLK--DD 186

Query: 163 SMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXXXXXXX 222
           S +      L+   N  E  IP+WLP+FPPD+TYKFTPQFNK ITD  +I++        
Sbjct: 187 STLETLK--LVPITNTLENIIPDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKK 244

Query: 223 XXXX--XXXXXXDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIH 280
                        IT    +  ++  + D + A+ E  A+Y   +  RKKR      +  
Sbjct: 245 SEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDALYSGGSCDRKKR-----TAFF 299

Query: 281 DTEQNFFNHPQG---SKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMIN- 336
           + E++      G   S  F++  Y H R+ + R +V+++E +QL+ + +PFL+++ +++ 
Sbjct: 300 EDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSE 359

Query: 337 --DKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQ-----------ERDRRLELARQKRE 383
             DKKVSR  +   I+N L+RS+  +  + P L Q           E+ RR +   ++RE
Sbjct: 360 QTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRRHDEWLKRRE 419

Query: 384 EKIEKLKIQNEQLKKDRDAQLLAALSM 410
           EK++KL    EQ K  R AQ   A+ +
Sbjct: 420 EKLKKL----EQEKNLR-AQAFGAIDL 441

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 194/365 (53%), Gaps = 22/365 (6%)

Query: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLI 87
           +  L N  EIP  + D+ +RKLL K++A+QLK +N  + +SQ AF  L +LV   L  ++
Sbjct: 21  LRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNML 80

Query: 88  SELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSS 147
            +LH+M  IQRR+  +K D+ L++ G NL  ++L  +L+ S +++S N +    + ++S 
Sbjct: 81  VDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREESE 140

Query: 148 TI-------FDSSDTMANPGHDSMVNNPSNILIKPNNPFEIS-IPNWLPAFPPDHTYKFT 199
            +           + + +   +  + +   + + P  P     +P WLP FPPDHTY+FT
Sbjct: 141 VVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYRFT 200

Query: 200 PQFNKPITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENEETSNFDSELAREENIA 259
            QFN+PITD+ L+K+                     E+S  E  ++     E ++++   
Sbjct: 201 SQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKE-SQQDTQL 259

Query: 260 IYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELE 319
           I+G      KK K   + +I+         PQ  +++NV  YA  RVE+ R++VEE+E  
Sbjct: 260 IFG----PAKKTK---IAAINGASDLLRTLPQ--QNYNVEEYARNRVEIARRKVEEYERH 310

Query: 320 QLKWEKNPFLRLSRMIN--DKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLEL 377
           QL  +K  F++ + +++   KK +   ++ E++  L RSY  + ++ P L+++R R +EL
Sbjct: 311 QLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVEL 370

Query: 378 ARQKR 382
           A + R
Sbjct: 371 AEENR 375

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  166 bits (421), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 141/473 (29%), Positives = 227/473 (47%), Gaps = 47/473 (9%)

Query: 37  TEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVI 96
           TEI     D  V ++L K++  QL  L++ +S  A +EL  LV  Q+D +   LH ++++
Sbjct: 26  TEISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMFRNLHNLALL 85

Query: 97  QRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTM 156
           QRR+ A + D++LL +  NL+ + L+ QLQ+S F+KS +  +Y+ L+  SS    S +  
Sbjct: 86  QRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVSSSSFSASSHNEE 145

Query: 157 ANPGHDSMVNNPSN---ILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIK 213
                 + +    N   +L+ P+NP E  +P+WLP FPPDHTY+FTP+FN PITD   IK
Sbjct: 146 DEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIK 205

Query: 214 QXXXXXXXXXXXXXXXXXXDITEQSSIENEETSNF-DSELAREENIAIYGYDAMSRKKRK 272
           +                   +   S   +       D   A E+ + I+G +A+  +KR 
Sbjct: 206 REIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDADAGEQQLEIWG-NALQEEKRT 264

Query: 273 PPHLISIHDTEQNFFNHPQGSKHFNVGN---YAHFRVELTRKRVEEFELEQLKWEKNPFL 329
                               SK FN  N   YA +RVEL R+RV +FE+ QLK  KNPFL
Sbjct: 265 ------------------AISKSFNENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFL 306

Query: 330 RLSRMINDKKVSRS---DLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKI 386
           R+S  +   K        ++  I    ++S      N PK+++ +  ++ +A ++R   +
Sbjct: 307 RISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSL 366

Query: 387 ----EKLKIQNEQLKKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIATNIE 442
               E+L ++ ++ ++D    L   L  E + E+T+  +N    +      F+       
Sbjct: 367 KRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSS-----FTIDINANA 421

Query: 443 DVEDDGIGLFGDLESSDEDNDDKVXXXXXXXXXXXXLPVDGTPDNETASVASN 495
           D EDD + LFG L SS ++N+                 V G P+  TA+V  N
Sbjct: 422 DDEDDDMNLFGILGSSGDENEAPSIQNGN---------VAGEPEPPTATVQDN 465

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  164 bits (415), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 230/508 (45%), Gaps = 133/508 (26%)

Query: 48  VRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKT 105
           + +LL KSIALQLKP+N    +S +AFN L  LV+ QL+ +I +L R+S+ QRR   A  
Sbjct: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASN 119

Query: 106 DIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDT---LIKDSSTIFDSSDTMANPGHD 162
           D+ L LR  NLN S+L   L+ SNF+KSK  KDY+    L++D +T  +++    NP + 
Sbjct: 120 DLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNT--ETNHNFKNPNYS 177

Query: 163 S--MVNNPSNI-----LIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQX 215
           +  ++NN S+      ++ P+N    S+P WLP+ PPDHTYKFTP +N+PITD+ ++K+ 
Sbjct: 178 TSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKI 237

Query: 216 XXXXXXXXXXX----------------------------------XXXXXXDITEQSSIE 241
                                                               +T +S  E
Sbjct: 238 LVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSE 297

Query: 242 NEETSN----FDSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNF---FNHPQGSK 294
           NE+T+      D  LA++E  AIYG     RK +K   L+     E      F +P    
Sbjct: 298 NEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPST-- 355

Query: 295 HFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMIND----------------- 337
            FNV  YA  +V+  R++V  +E +QL+ +KNPF + S+MI                   
Sbjct: 356 -FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQFHHGPHHHHHHHHH 414

Query: 338 ----------------------KKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRL 375
                                   VS+  +  +I+    RS  ++  + P L +E+    
Sbjct: 415 HHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSLNNLINSLPNLAKEKASAR 474

Query: 376 ELARQKREEKIEKLKIQNEQLKKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNE-- 433
           E+A  +RE+K++      E LKK +                            ++LNE  
Sbjct: 475 EIAENEREKKVQ------EMLKKKQ----------------------------KELNEKQ 500

Query: 434 FSTIATNIEDVEDDGIGLFGDLESSDED 461
            S  A ++ D++ +  GLF DL SSD+D
Sbjct: 501 SSAGALDLHDLQKENDGLFADLGSSDDD 528

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  160 bits (404), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 189/349 (54%), Gaps = 35/349 (10%)

Query: 47  QVRKLLNKSIALQLKPLNL--ELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNA-AA 103
           Q+  LL KS+A++LKP+NL  +L   AF+ L  L++ QL+ LI +L R+S++QRRN+ A 
Sbjct: 25  QLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNAT 84

Query: 104 KTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMANPGHDS 163
           K+DI LLL+G NL+ SEL+ +L++SN +K    +D   L +DS      +D    P    
Sbjct: 85  KSDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDSIHYNQHTD-FVGP---- 139

Query: 164 MVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXXXXXXXX 223
            V   S  L+ P NP + +IP+W P+ PPDHTYKFTP++N  I D  +IKQ         
Sbjct: 140 -VETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTV 198

Query: 224 XXXXXXXXXDITEQSSIENEETSNFDSELAREENIAIYGY--DAMSRKKRKPPHLISIHD 281
                     I +  S E     ++D  LA+ E+ A++G   + M+  K+    L SI  
Sbjct: 199 KTALFNL---INKIESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSI-- 253

Query: 282 TEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVS 341
                         F++  Y+H RV + R +V +FE + L  + NPF+ L   IND+   
Sbjct: 254 --------IVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINL---INDQT-- 300

Query: 342 RSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLK 390
                 ++K+ L RS++ +  + P+L  E+ + +  A  +R+E+I +L+
Sbjct: 301 ------DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLR 343

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  161 bits (407), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 157/552 (28%), Positives = 256/552 (46%), Gaps = 56/552 (10%)

Query: 40  PSNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLISELHRMSVIQ 97
           P +S ++ + K+L++++A++LKP+N  + +SQ AF  L  LV++ L F+++ LHR   IQ
Sbjct: 31  PHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQ 90

Query: 98  RRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFD------ 151
           RR   +K D+ LLL+G +L+ SEL  +L+ S ++ S + +  + + + S  +        
Sbjct: 91  RRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQKSKELKSKLLKPM 150

Query: 152 SSDTMANPGHDSMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITD- 208
           +   + N  H        +IL  + P N     IP WLP FPPDHTY+FT Q+NKP+ D 
Sbjct: 151 TEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYRFTSQYNKPVVDE 210

Query: 209 -QVLIKQXXXXXXXXXXXXXXXXXXDITEQSSIENEETSNFD-SELAREENIAIYGYDAM 266
            Q+  K                   D T Q    NE        E  +EE   I+G    
Sbjct: 211 RQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRSLYEETQEETFLIFG---- 266

Query: 267 SRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKN 326
              +RK  H  +  ++ +     P   K+F+V  YA  RVE+ R++V E+E  QL+ +KN
Sbjct: 267 --PERKKSH--TTENSHELLRTLP--LKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKN 320

Query: 327 PFLRLSRMINDKK---VSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKRE 383
           PF++ + + +  K   +SR  +  E+K+ LQRSY  + R+ PKL + + R  ELA ++R 
Sbjct: 321 PFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKARERELANERRR 380

Query: 384 EKIEKLKIQNEQLKKDRDAQ---------------LLAAL-SMETSGENTKTESNLTGVN 427
           E +EKL   NE+ ++  +A                LLA   S ++ GE+ + ++      
Sbjct: 381 EMLEKL---NEERQRQAEAGGGDEVLDLNNLNEDPLLAGFDSSDSEGEDGEAKALAGNAQ 437

Query: 428 DQKLNEFSTIATNIEDVEDDGIGLFGDLESSDEDNDDKVXXXXXXXXXXXXLPVDGT--- 484
             +L +     T     E + I LF + E   +                      GT   
Sbjct: 438 HTELEQVEPSQTK-SSQEQEQI-LFEEGEDKRQSQSQSQSQSQQPYVSPIQTQEAGTLLQ 495

Query: 485 --PDNETASVASNIIAVAPNQPEEIISSVSDSINENVTLKNPNEPKHTESDDS----GTF 538
              +  T +++  +  VA  Q E  IS VS    +        +PK +  + S       
Sbjct: 496 SSSEAHTTNLSPQLATVAETQIEASISDVSSDYQDGPGAATTAQPKPSNQELSDDDDDEN 555

Query: 539 DDQNFLFQDVAT 550
           D   +LF+DV T
Sbjct: 556 DGGGYLFEDVVT 567

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  152 bits (384), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/356 (27%), Positives = 177/356 (49%), Gaps = 32/356 (8%)

Query: 48  VRKLLNKSIALQLKPL--NLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKT 105
           ++KLL +++ L LK +  ++ ++QL F  L   V  QLD ++  LHR + +QRRN  +  
Sbjct: 36  MQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLK 95

Query: 106 DIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFD------SSDTMANP 159
           D+ L L G  +    L+ +   S +++ ++     ++ + S+++        S + + + 
Sbjct: 96  DVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSASLMGHWHQPMSEEELLSS 155

Query: 160 GHDSMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXX 217
            H        +IL  + P N     +P WLP FPPDHTYKFT  +N+PITD+  +K+   
Sbjct: 156 SHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLF 215

Query: 218 XXXXXXXXXXXXXXXDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLI 277
                            T++   ++ +     S+  ++EN+ IYG +   R++  P    
Sbjct: 216 EESKLSEKALLHMLGTATKKPRADDAQLPQIISD-GQQENLLIYGPE---RRRLAP---- 267

Query: 278 SIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMIN- 336
                       P  ++ FN+ +YA  RVEL R+RVEEFE ++L+ +KNPF+R +   + 
Sbjct: 268 -----------EPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAAAACSP 316

Query: 337 --DKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLK 390
               ++SR  ++ E    L RSY  +    P+L++ + R L  A ++   + E ++
Sbjct: 317 YATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAAYERERARQESMR 372

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  149 bits (376), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 116/432 (26%), Positives = 217/432 (50%), Gaps = 26/432 (6%)

Query: 51  LLNKSIALQLKPL--NLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIE 108
           LL++S+ALQLK +  +  +++L FN +   +  Q++ +   LHR + IQRRN  +  D++
Sbjct: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLK 98

Query: 109 LLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDS------SDTMANPGHD 162
           L L+G  + +  L+ + + S ++K     ++  + + S  + +        + + +  H 
Sbjct: 99  LFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHA 158

Query: 163 SMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQXXXXXX 220
                  +IL  + P N     +P WLP FPPDHTYKFT  +NKPI+D+  +K+      
Sbjct: 159 EFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEG 218

Query: 221 XXXXXXXXXXXXDITEQS-SIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISI 279
                           +   +E+EET     + ++EE   IYG +   R +R+  ++   
Sbjct: 219 KLSEKALLNMLGSAQAKMLKVEDEETIAQTYKESQEETQLIYGVEK-QRPRRENAYVGGN 277

Query: 280 HDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMI---- 335
                +   +   SK FN+  YA  R+ L R++VEEFE  +L+ +KNPF+R S +     
Sbjct: 278 STNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYG 337

Query: 336 NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELA--RQKREEKIEKLKIQN 393
           N +K +R   + E    L+RSY  + ++ PKL+Q +   +  A  R++ ++K  +++++ 
Sbjct: 338 NAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQLKANEMAAAIERERIKQKEREMELEK 397

Query: 394 EQLKK---DRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIATNIED----VED 446
           + L++   D +A    AL  +    +++ +  + G   Q+L  FS IA  ++      +D
Sbjct: 398 KHLQQGVVDLNALHEDALLADLDSTDSEDDEPMMGSKKQELG-FSEIANPLQAKKILAQD 456

Query: 447 DGIGLFGDLESS 458
             + +  D+ES+
Sbjct: 457 STLNVSSDIEST 468

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 103/396 (26%), Positives = 189/396 (47%), Gaps = 37/396 (9%)

Query: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLI 87
           +++L N  E+P  +  E   +L  +++ LQLK LN  + +SQLAF++L  +   QLD L+
Sbjct: 23  LDKLPNLNEVPHANPME---RLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLL 79

Query: 88  SELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTL----- 142
             L +++ +QRR   +K D+ L  +G+ +++ +L+ Q+++SNF+  K   + + L     
Sbjct: 80  QSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVL 139

Query: 143 -IKDSSTIFDSSDTMANPGHDSMVNNPSNI--LIKPNNPFEISIPNWLPAFPPDHTYKFT 199
            +K           + +  H        +I  L+  +N     +P+WLP  PPDHTYKFT
Sbjct: 140 KVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFT 199

Query: 200 PQFNKPITDQVLIKQXXXXXXXXXXXXXXXXXXDITEQ-----------SSIENEETSNF 248
             + +PITD+ L+K+                   +  Q            S  N   S  
Sbjct: 200 SLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEH 259

Query: 249 DSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVEL 308
             E   E ++    +  +   K      + +H  E +F   P   K+FNV  Y   R  +
Sbjct: 260 IKESQLETDLIFDPHKTIPTDKEWGTTTV-LHGIE-SFNLSP--VKNFNVLEYCKKRDAI 315

Query: 309 TRKRVEEFELEQLKWEKNPFLRLSRMIN----DKKVSRSDLKLEIKNSLQRSYKSIFRNY 364
            ++R E  E +     +NPF+R + + +        SR  ++ ++K  L+RSY  +  + 
Sbjct: 316 VKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSI 375

Query: 365 PKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDR 400
           P++K+ R+R    AR++ EE+ E+L  +  +++K++
Sbjct: 376 PRVKEVRER----ARKEAEER-ERLLQEQRRIEKEK 406

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 97/389 (24%), Positives = 177/389 (45%), Gaps = 51/389 (13%)

Query: 29  LMNELTNPTEIPSNSSDEQVRKLLNKSIALQL--------KPLNLELSQLAFNELSLLVN 80
           L+ +++ P E+P    D +V ++L  S+A Q+            + ++  AF  L  LV 
Sbjct: 16  LVGDVSAPVELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVE 75

Query: 81  DQLDFLISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVS---NFMKSKNGK 137
           +QL  +++ELHR++ +QRR  A   D+ LLL+G  L   ++  Q+ +S    + + +  +
Sbjct: 76  EQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPR 135

Query: 138 DYDTLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYK 197
           +    ++D++  +D    + N     + +  S   +    P    IP WLP  PP+HTYK
Sbjct: 136 EQTVQLQDATGSYDRFKLVEN--QQLIASGLSGSDMSQELPIAEKIPAWLPKLPPNHTYK 193

Query: 198 FTPQFNKPITDQVLIKQXXXXXXXXXXXXXX--XXXXDITEQSSIENEETSNFDSELAR- 254
           FT ++NK + D+ ++K+                    D    + ++         EL R 
Sbjct: 194 FTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDERARETPPEELKRI 253

Query: 255 -EENIAIYG--------YDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFR 305
            +E +A+YG        ++    K+R P +L                 K F+V  Y+  R
Sbjct: 254 DDEIVALYGPLEEIAERHEGPRTKRRTPLYL----------------KKSFDVQAYSLGR 297

Query: 306 VELTRKRVEEFELEQLKWEKNPFLRLSRMI--NDKKVSRSDLKLEIKNSLQRSYKSIFRN 363
           V+L R  V+ FE E     +NPFL   R +  N KKV        ++NSL    + +  +
Sbjct: 298 VKLARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSM-----LENSLN---ELVQVD 349

Query: 364 YPKLKQERDRRLELARQKREEKIEKLKIQ 392
            P+L+  +   +  A ++R+ K+ +L+ +
Sbjct: 350 LPRLESRKAAAIAHAVEQRDAKLAELRAK 378

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 104/210 (49%), Gaps = 44/210 (20%)

Query: 41  SNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLISELHRMSVIQR 98
           SN  D Q+ +LL +++ +QL+ ++  + ++++A ++L L   DQL+ L+  LHR+S++QR
Sbjct: 27  SNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQR 86

Query: 99  RNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMAN 158
           R + A +D+E+ +RG NL  S+L+   + S F++     D   + KD +        + N
Sbjct: 87  RQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDIN--------IDN 138

Query: 159 PGHDSM----VNNPSNI---------------------------LIKPNNPFEISI---P 184
           P   ++    + N  NI                           L K +     ++   P
Sbjct: 139 PMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNLRYKP 198

Query: 185 NWLPAFPPDHTYKFTPQFNKPITDQVLIKQ 214
            WLP FPPDHTYK+TP +   +  +  I+Q
Sbjct: 199 GWLPDFPPDHTYKYTPSYVNVVKPETEIRQ 228

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 102/216 (47%), Gaps = 49/216 (22%)

Query: 294 KHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVSRSDLKLEIKNSL 353
           K F+V  YA  R+E+ R++V +FE EQL  + NP LRL++M        SD + E +  +
Sbjct: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKM-KYYDAEESDFETEYQKCI 454

Query: 354 QRSYKSIFRNYPKLKQERD--RRLELARQ-----KREEKIEKLKIQNEQ--LKKDRDAQ- 403
           +R+     RN P +K++R   R+  + R+     KR   I++ K++ EQ  ++K R+ + 
Sbjct: 455 KRTMDRFKRNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKKEQEIVRKSREMEA 514

Query: 404 -----------------LLAALSMETSGENTKTESNLTG----------------VNDQK 430
                            +L   S  ++GE++ T + +                  V+ +K
Sbjct: 515 IENANKFGILPGEKPLEVLQDASNASTGESSTTTAQIPQGAPLLVNPVNSTLVPLVDSEK 574

Query: 431 ---LNEFSTIATNIEDVEDDG--IGLFGDLESSDED 461
              L E  TI    +DVEDD   +GLFG   SS +D
Sbjct: 575 PKPLEEVQTIDVIAKDVEDDDEDLGLFGGFNSSSDD 610

>KNAG0M00250 Chr13 complement(38240..39010) [771 bp, 256 aa] {ON}
           Anc_4.372 YHR200W
          Length = 256

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 350 KNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQLLAALS 409
           +N LQR    +F   P  ++ERDR L LAR+ R+  +    +   +++++ D  LLA + 
Sbjct: 104 QNGLQRQRICLFVCSPIREEERDRLLTLARRFRKNMVALDVVNFGEMQQNAD--LLAEVV 161

Query: 410 METSGENTKTESNLTGVNDQKLNEFSTIATN 440
              + E     S+L  V       + T+AT+
Sbjct: 162 AAVNAEGETYGSHLVNVERGPRLLYETVATS 192

>KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.542
           YPL074W
          Length = 754

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 32/45 (71%)

Query: 360 IFRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQL 404
           + +N  ++K+ER R LE A+ +RE+K+++ K+  +QL++ ++  L
Sbjct: 145 VMQNAERIKEERRRDLEAAKLEREQKLKEQKLMEQQLEQQKERLL 189

>TPHA0J01390 Chr10 (323615..325624) [2010 bp, 669 aa] {ON} Anc_5.670
           YKR078W
          Length = 669

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 502 NQPEEIISSVSDSINENVTLKNPNEPKHTESDDSGTFDDQNFLFQDVATSEIDKLN 557
           ++PEEIIS    SI   +  KN   P+ TE +   TFD  + +    +TS  DKLN
Sbjct: 163 DKPEEIISPTKQSIKGKLLYKNKRIPRKTEVNSIPTFDPLSIM-HAASTSLPDKLN 217

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 25  QEEPLMNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLA--FNELSLLV--N 80
           QEE L ++L    E P+N S E++ K L  S +L+++  N  L++L    ++  LLV  +
Sbjct: 402 QEEKLNHQLATAEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDD 461

Query: 81  DQLDFLISEL 90
           D+L +L+  L
Sbjct: 462 DELYYLMGTL 471

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 25  QEEPLMNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLA--FNELSLLV--N 80
           QEE L ++L    E P+N S E++ K L  S +L+++  N  L++L    ++  LLV  +
Sbjct: 402 QEEKLNHQLATAEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDD 461

Query: 81  DQLDFLISEL 90
           D+L +L+  L
Sbjct: 462 DELYYLMGTL 471

>NDAI0B00250 Chr2 complement(44784..46190) [1407 bp, 468 aa] {ON}
           Anc_1.175 YKL172W
          Length = 468

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 4/30 (13%)

Query: 377 LARQKREEKIEKLKIQNEQLKKDRDAQLLA 406
           LA QK+EEKI+K     EQLKKD+ AQ LA
Sbjct: 51  LANQKQEEKIQK----EEQLKKDKKAQQLA 76

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,910,449
Number of extensions: 2985272
Number of successful extensions: 16455
Number of sequences better than 10.0: 544
Number of HSP's gapped: 17055
Number of HSP's successfully gapped: 607
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)