Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B003008.842ON52352328220.0
NDAI0E002908.842ON52252020640.0
YML115C (VAN1)8.842ON53553719020.0
Suva_13.288.842ON53053219010.0
KAFR0A028308.842ON50749918850.0
ZYRO0G14234g8.842ON50948118750.0
KNAG0G034208.842ON51150818610.0
Smik_13.198.842ON53642618410.0
Skud_13.268.842ON53953218320.0
Kpol_541.158.842ON49852317860.0
TDEL0B005608.842ON50943017710.0
SAKL0D01430g8.842ON44742917530.0
TBLA0B032708.842ON52051517220.0
CAGL0B02321g8.842ON51252016740.0
KLTH0C03828g8.842ON40440516490.0
Ecym_46138.842ON52450316480.0
KLLA0D01529g8.842ON50149316310.0
TPHA0C047808.842ON52546716020.0
ABL124W8.842ON48543415300.0
Kwal_27.102468.842ON33933914250.0
Ecym_35731.479ON44736510151e-133
NCAS0G041101.479ON49436510151e-132
KAFR0I027701.479ON45536510101e-132
CAGL0L01331g1.479ON44736510041e-131
YEL036C (ANP1)1.479ON50035710061e-131
KNAG0I003001.479ON45736610011e-131
SAKL0D11792g1.479ON48338710021e-131
KLTH0C03432g1.479ON48936510011e-130
Kwal_27.101571.479ON4763659991e-130
NDAI0G003401.479ON5043599991e-130
Smik_5.571.479ON4913569961e-129
TBLA0B021701.479ON57236410021e-129
Suva_5.331.479ON4953579911e-129
Skud_5.541.479ON4913569911e-129
AFR357W1.479ON4343789841e-128
Kpol_370.51.479ON64535610001e-128
TPHA0O004301.479ON5483539861e-127
NDAI0B012501.479ON4463649771e-127
KLLA0E22155g1.479ON4503679681e-126
TDEL0C026001.479ON4623669591e-124
ZYRO0F05170g1.479ON6083589521e-121
KLLA0E12849g8.500ON3923585031e-57
SAKL0H11110g8.500ON3933684863e-55
NCAS0C023308.500ON3933594855e-55
Skud_16.2328.500ON3953584847e-55
KLTH0E11616g8.500ON3943524839e-55
YPL050C (MNN9)8.500ON3953584803e-54
KAFR0H013908.500ON3983584794e-54
Kwal_27.118648.500ON4533494825e-54
ZYRO0F08492g8.500ON3963584742e-53
NDAI0E030208.500ON3963594733e-53
TPHA0L013708.500ON3923584733e-53
Suva_16.2658.500ON3953584709e-53
TBLA0H033408.500ON3933614699e-53
CAGL0L12804g8.500ON3933594691e-52
KNAG0A021508.500ON3963584681e-52
Smik_16.1868.500ON3953584672e-52
Kpol_1031.788.500ON3923584629e-52
TDEL0B013708.500ON3963614612e-51
AGL259C8.500ON3893634444e-49
NCAS0B024408.500ON4003514384e-48
Ecym_25508.500ON3903564366e-48
NDAI0C052508.500ON4023574104e-44
KNAG0A039908.500ON3571752527e-23
SAKL0H20438gsingletonON5652101688e-12
YCR019W (MAK32)1.440ON363136810.27
ZYRO0G12540g3.295ON95073800.38
Smik_3.1141.440ON359138704.5
TBLA0B054602.503ON27453704.7
Ecym_81231.156ON40833697.4
TDEL0A027902.503ON26389679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00300
         (523 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...  1091   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   799   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   737   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   736   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   730   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   726   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   721   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   713   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   710   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   692   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   686   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   679   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   667   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   649   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   639   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   639   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   632   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   621   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   593   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   553   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   395   e-133
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    395   e-132
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   393   e-132
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   391   e-131
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   392   e-131
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   390   e-131
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   390   e-131
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   390   e-130
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   389   e-130
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   389   e-130
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   388   e-129
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   390   e-129
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   386   e-129
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   386   e-129
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   383   e-128
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   389   e-128
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   384   e-127
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   380   e-127
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   377   e-126
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   374   e-124
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   371   e-121
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   198   1e-57
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   191   3e-55
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   191   5e-55
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   191   7e-55
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   190   9e-55
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   189   3e-54
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   189   4e-54
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   190   5e-54
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   187   2e-53
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   186   3e-53
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   186   3e-53
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   185   9e-53
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   185   9e-53
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   185   1e-52
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   184   1e-52
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   184   2e-52
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   182   9e-52
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   182   2e-51
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   175   4e-49
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   173   4e-48
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   172   6e-48
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   162   4e-44
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...   101   7e-23
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    69   8e-12
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    36   0.27 
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    35   0.38 
Smik_3.114 Chr3 (152071..153150) [1080 bp, 359 aa] {ON} YCR019W ...    32   4.5  
TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {...    32   4.7  
Ecym_8123 Chr8 complement(257551..258777) [1227 bp, 408 aa] {ON}...    31   7.4  
TDEL0A02790 Chr1 (506257..507048) [792 bp, 263 aa] {ON} Anc_2.50...    30   9.3  

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/523 (100%), Positives = 523/523 (100%)

Query: 1   MDLLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLL 60
           MDLLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLL
Sbjct: 1   MDLLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLL 60

Query: 61  IIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVK 120
           IIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVK
Sbjct: 61  IIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVK 120

Query: 121 KFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHL 180
           KFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHL
Sbjct: 121 KFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHL 180

Query: 181 LLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGT 240
           LLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGT
Sbjct: 181 LLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGT 240

Query: 241 LSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVF 300
           LSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVF
Sbjct: 241 LSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVF 300

Query: 301 QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGS 360
           QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGS
Sbjct: 301 QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGS 360

Query: 361 VIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYA 420
           VIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYA
Sbjct: 361 VIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYA 420

Query: 421 EYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAF 480
           EYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAF
Sbjct: 421 EYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAF 480

Query: 481 GKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKRG 523
           GKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKRG
Sbjct: 481 GKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKRG 523

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/520 (73%), Positives = 438/520 (84%), Gaps = 5/520 (0%)

Query: 3   LLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLII 62
           LL K  +  +  A+ E  LP SRNNSN  DE  KK  F+PK++ T  ++   +V S  II
Sbjct: 4   LLHKFGRNSRKDAKLE--LPISRNNSNVADE-LKKQRFIPKKKSTAKNVAIGSVVSF-II 59

Query: 63  IVYIFWGSSLTEMTSKYDSVTNLHAGQNTK-TASYKTKQLTENEYYDHDFEDIEPAVVKK 121
              I+ G S    TS      NL+A +N K + SYKT +L++ EYY++DFE+IE  V+ K
Sbjct: 60  CALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGK 119

Query: 122 FDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLL 181
           F+NGVQHYLIS++GTDVLTP D E Y KEL M+LDASVEKYDL  F GS NGA NRDHLL
Sbjct: 120 FENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLL 179

Query: 182 LCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTL 241
           LCVPLRDAE VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD TL+ALL YS+HLQNGTL
Sbjct: 180 LCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTL 239

Query: 242 SQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQ 301
           SQVF +MD+Y+ +HS  ++GTKNLHLKYMN +YLK+V+T+F    H NYDKPFRS+Q+F+
Sbjct: 240 SQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFR 299

Query: 302 KDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSV 361
           KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYH+WVYWRDADIELCPG++
Sbjct: 300 KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTI 359

Query: 362 IEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAE 421
           +ED+M+ DYDV+VPNVWRPLPEFLD EQPYDLNSWIESDEALKLAKTL EDDVIVEGYAE
Sbjct: 360 VEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAE 419

Query: 422 YPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFG 481
           YPTWRVHLAYIR+A GDP  VVDLDGVGGVSILAKAK+FRSGV FPAFTFENHAETE FG
Sbjct: 420 YPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFG 479

Query: 482 KMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNK 521
           KMA++MG+RVGGLPHYTIWHIYEPSDDDL EIANKERQ++
Sbjct: 480 KMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSR 519

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/537 (66%), Positives = 421/537 (78%), Gaps = 20/537 (3%)

Query: 1   MDLLIKVKKGVQNKAQQEEL-LPTSRNNS--NYGDEEQKKNS------------FVPKRR 45
           M +   ++  ++ KA    L LP SRN S  N  D+  + NS              P + 
Sbjct: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60

Query: 46  KTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENE 105
           +   S+  L + ++L + ++I + S +    S  +  + L  G +  + +YKT  L + E
Sbjct: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLL--GSSKSSENYKTIDLEDEE 118

Query: 106 YYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLS 165
           YYD+DFEDI+P V+ KFD+GVQHYLISQ+G++VLTP D+E Y +EL M+ D++VE+YDLS
Sbjct: 119 YYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLS 178

Query: 166 TFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRT 225
            F G+ NG   RDH+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD T
Sbjct: 179 NFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTT 238

Query: 226 LDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKR 285
           LDAL+AYS+HLQNGTLSQ+F E+D        ++KGT  L+LKYM+  Y+  V  +F   
Sbjct: 239 LDALIAYSRHLQNGTLSQIFQEIDAV---IDSQTKGTDKLYLKYMDEGYINRVHQAFSPP 295

Query: 286 KHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHA 345
            H NYDKPFRS+Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+
Sbjct: 296 FHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHS 355

Query: 346 WVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKL 405
           WVYWRDAD+ELCPGSVI+DLMSK+YDVIVPNVWRPLP FL  EQPYDLNSW+ES EAL L
Sbjct: 356 WVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALAL 415

Query: 406 AKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQ 465
           AKTLDEDDVIVEGYAEYPTWRVHLAYIRDA GDPNE VDLDGVGGVSILAKAKIFR+GVQ
Sbjct: 416 AKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQ 475

Query: 466 FPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522
           FPAFTFENHAETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL EIA++ER+ +R
Sbjct: 476 FPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/532 (66%), Positives = 423/532 (79%), Gaps = 14/532 (2%)

Query: 1   MDLLIKVKKGVQNKAQQEEL-LPTSRNNSNYGDEEQK--------KNSFVPKRRKTLSSL 51
           M L + ++  ++ KA    L LP SRN S+   ++++        K  ++ + R + S  
Sbjct: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60

Query: 52  -MKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHD 110
            + + V SL+IIIV   +   L     K   ++  +      + +YKT  L + EYY++D
Sbjct: 61  QLAVNVISLVIIIVLSLYLMILFLSEMKL-GISIQNGNPLLGSENYKTIDLEDEEYYNYD 119

Query: 111 FEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGS 170
           FEDI+P VV KFD+GVQHYLI+Q+G++VLTP DNE Y +E+ M+LD++VEKYDL+ F G+
Sbjct: 120 FEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGA 179

Query: 171 SNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALL 230
            NG   RDH+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD TLDAL+
Sbjct: 180 PNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALI 239

Query: 231 AYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNY 290
           AYS+ LQNGTLS++F E+D        ++KGT  L+LKYM+ DY+  V  +F    H NY
Sbjct: 240 AYSRQLQNGTLSEIFQEIDAV---IDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296

Query: 291 DKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWR 350
           DKPFRS+QVFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWR
Sbjct: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356

Query: 351 DADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLD 410
           DAD+ELCPGSVI+DLMSK+YDVIVPNVWRPLP FL+ EQPYDLNSW+ES EAL LAKTLD
Sbjct: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416

Query: 411 EDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFT 470
           EDDVIVEGYAEYPTWRVHLAYIRDA GDPNEVVDLDGVGGVSILAKAKIFR+GVQFPAFT
Sbjct: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476

Query: 471 FENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522
           FENHAETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL EIA +ER+ +R
Sbjct: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/499 (69%), Positives = 407/499 (81%), Gaps = 14/499 (2%)

Query: 25  RNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTN 84
           R NS Y  + +KK +F PK RK   +  K+ +F   +  + +F   +     SK +  T 
Sbjct: 22  RTNSLYETDSEKKLNFTPKNRKRRLNYAKI-IFGFFVSFLILFLMLNFEFNASKLNK-TI 79

Query: 85  LHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDN 144
           +   Q       KT  L++ EYY+ DFEDI+P V++KFD G QHYLISQ+GTDVLTP D 
Sbjct: 80  IDIAQ-------KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQ 132

Query: 145 EVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLT 204
           E+Y +E+ M+ D+++E YDL  F G+ NGA NRDH+LLC+PLRDA HVLPLMF+HLMNLT
Sbjct: 133 EIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLT 192

Query: 205 YPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTK- 263
           YPHELIDLAFLVSDCSE D TLDAL+ +SK+LQNGTLSQV  E+D +    +K+   TK 
Sbjct: 193 YPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAF----TKEETSTKS 248

Query: 264 NLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGI 323
           NLHLKYM+P+YLK V  +F    H +YDKPFRS+Q+F+K+FGQIIGQGFSDRHAVKVQGI
Sbjct: 249 NLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGI 308

Query: 324 RRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPE 383
           RRKLMGRARNWL ANALKPYH+WVYWRDADIELCPGSVIEDLM+KDYDVIVPNVWRPLP 
Sbjct: 309 RRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPA 368

Query: 384 FLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVV 443
           FL GEQPYDLNSW ES EALKLA+TLDEDDVIVEGYAEYPTWRVHLAYIRD  G+P+EVV
Sbjct: 369 FLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVV 428

Query: 444 DLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIY 503
           D+DGVGGVSILAKAK+FRSGVQFPAFTFENHAETEAFGKMA+KMG++VGGLPHYT+WHIY
Sbjct: 429 DIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIY 488

Query: 504 EPSDDDLMEIANKERQNKR 522
           EPSDDDL E+ANKER+ +R
Sbjct: 489 EPSDDDLKEMANKEREERR 507

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/481 (70%), Positives = 403/481 (83%), Gaps = 4/481 (0%)

Query: 42  PKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQL 101
           PK +++     K+  + ++ ++V I + +    +    + +  +     + T+S   + L
Sbjct: 32  PKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTV----GSNTSSNDGQVL 87

Query: 102 TENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEK 161
            E+ YYD+DFEDI+P V++KFD GVQHYLI+Q+G DVLTP D EV+ +E +M+L ++VE 
Sbjct: 88  EEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVES 147

Query: 162 YDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 221
           YDLS F GS+NGA N +H+LLCVPLRDAE VLPLMFKHLMNLTYPHELIDLAFLVSDC+E
Sbjct: 148 YDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTE 207

Query: 222 GDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTS 281
            D+TLDAL+AYS+ LQ+GTLSQVF +MDQ   +  + SKGT+ L+LKYMNPDYL+ V  S
Sbjct: 208 DDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKES 267

Query: 282 FKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALK 341
           F    H NYDKPFRS+QVFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALK
Sbjct: 268 FSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 327

Query: 342 PYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDE 401
           PYH+WVYWRDAD+ELCPGSVIEDLMSKDYDV VPNVWRPLP+FLDGEQPYDLNSW+ES E
Sbjct: 328 PYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGE 387

Query: 402 ALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFR 461
           AL LAKTLDEDDVIVEGYAEYPT+RVHLAYIRD   DPNE++DLDGVGGVSILAKA++FR
Sbjct: 388 ALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFR 447

Query: 462 SGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNK 521
            G+QFPAFTFENHAETE FGKMA+KMG+RVGGLPHYT+WHIYEPSDDDL EIANKER+++
Sbjct: 448 RGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESR 507

Query: 522 R 522
           R
Sbjct: 508 R 508

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/508 (66%), Positives = 406/508 (79%), Gaps = 8/508 (1%)

Query: 15  AQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTE 74
           A Q   LPT       G ++ K   FVPKR++     +   +  ++ + V      SL+ 
Sbjct: 11  ASQSRELPTY-----MGTKDNKTAKFVPKRKRQTLLRLISLLGLVVFVAVSTV---SLSR 62

Query: 75  MTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQY 134
                 S+  +     +   +YKT  L ENEYY++DFE ++P V+ KFD GVQHYLIS++
Sbjct: 63  YLRGPASINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEF 122

Query: 135 GTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLP 194
           G DVLTP D E Y  E++ + D++V++YDL+ FTGS +G TNRDH+L+CVPLRDAE VLP
Sbjct: 123 GNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLP 182

Query: 195 LMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMD 254
           LMFKHLMNLTYPHELID+AFLVSDCS+ D TL+AL+AYS+ LQNGTLSQ+F EMD     
Sbjct: 183 LMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDY 242

Query: 255 HSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSD 314
            + K +    L+LKYM  +YL  V+ +F    H NYDKPFRS+Q+F+K+FGQIIGQGFSD
Sbjct: 243 LNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSD 302

Query: 315 RHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIV 374
           RHAVKVQGIRRKLMGR+RNWL ANALKPYH+WVYWRDADIELCPGSVI+D+M+KDYDV+V
Sbjct: 303 RHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLV 362

Query: 375 PNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 434
           PNVWRPLPEFL+GEQPYDLNSW+ES EAL+LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD
Sbjct: 363 PNVWRPLPEFLNGEQPYDLNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRD 422

Query: 435 AAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGL 494
             GDP+EVVDLDGVGGVSILA+AK+FR+GVQFPAFTFENHAETEAFGKMARK+GFRVGGL
Sbjct: 423 EEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGL 482

Query: 495 PHYTIWHIYEPSDDDLMEIANKERQNKR 522
           PHYT+WHIYEPSDDDL EIANKER+ +R
Sbjct: 483 PHYTLWHIYEPSDDDLREIANKEREKRR 510

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/426 (77%), Positives = 373/426 (87%), Gaps = 3/426 (0%)

Query: 88  GQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVY 147
           G +  + +YKT  L + EYYD+DFEDI+P VV KFDNGV+HYLISQ+G+DVLTP D+E Y
Sbjct: 101 GSSKSSDNYKTIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKY 160

Query: 148 AKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPH 207
             EL M+LD++VEKYDLS F G+SNG   RDH+LLCVPLR+A  VLPLMFKHLMNLTYPH
Sbjct: 161 QSELSMLLDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPH 220

Query: 208 ELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHL 267
           ELIDLAFLVSDCSE D TLDAL+AYS+ LQNGTLSQ+F E+D        ++KGT  L+L
Sbjct: 221 ELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAV---IDSQTKGTDKLYL 277

Query: 268 KYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKL 327
           +YM+ +Y+  V  +F    H NYDKPFRS+Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKL
Sbjct: 278 QYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKL 337

Query: 328 MGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDG 387
           MGRARNWL ANALKPYH+WVYWRDAD+ELCPGS+I+DLMSK+YDVIVPNVWRPLP FL+ 
Sbjct: 338 MGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLES 397

Query: 388 EQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDG 447
           EQPYDLNSW+ES E L+LAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA GDPNEV+DLDG
Sbjct: 398 EQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDG 457

Query: 448 VGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSD 507
           VGGVSILAKAK+FR+GVQFPAFTFENHAETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSD
Sbjct: 458 VGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 517

Query: 508 DDLMEI 513
           DDL EI
Sbjct: 518 DDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/532 (65%), Positives = 411/532 (77%), Gaps = 26/532 (4%)

Query: 1   MDLLIKVKKGVQNKAQQEEL-LPTSRNNSNYGDEEQK--------KNSFVPKRRKTLSSL 51
           M L + ++  ++ KA    L LP SRN S+   + ++        K  +  + R TLS L
Sbjct: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKL 60

Query: 52  M---------KLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLT 102
                      +TV SL ++I  +   + L    S  D         +  + +YKT  L 
Sbjct: 61  QLSVSFISIIIITVLSLYLLISRL---AGLNVNVSLRDG--KSLLSPSESSENYKTIDLE 115

Query: 103 ENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKY 162
           + EYY++DFEDI+P V+ KFD G QHYLISQ+G++VL P + E Y KEL M+LD++VEKY
Sbjct: 116 DEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKY 175

Query: 163 DLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEG 222
           DLS F G+ NG   RDH+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSEG
Sbjct: 176 DLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEG 235

Query: 223 DRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSF 282
           D TLDAL+AYS+ LQNGTLSQ+F ++D        ++KGT  L+LKYM+ DY+  V  +F
Sbjct: 236 DTTLDALIAYSRQLQNGTLSQIFQDIDAI---IDSQTKGTDKLYLKYMDEDYINRVHQAF 292

Query: 283 KKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKP 342
               H NYDKPFRS+Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKP
Sbjct: 293 SPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKP 352

Query: 343 YHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEA 402
           YH+WVYWRDAD+ELCPGSVIEDLMSK+YDV+VPNVWRPLP FL+ EQ YDLNSW+ES EA
Sbjct: 353 YHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREA 412

Query: 403 LKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRS 462
           L+LAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA G+PNEVVDLDGVGGVSILAKAKIFR+
Sbjct: 413 LELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRN 472

Query: 463 GVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           GVQFPAFTFENHAETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL EIA
Sbjct: 473 GVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/523 (63%), Positives = 420/523 (80%), Gaps = 25/523 (4%)

Query: 1   MDLLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLL 60
           MD L+  K+ ++ K +    LP S  +S +  + + ++ F P   +    +    + +L+
Sbjct: 1   MDFLLNNKRQLKKKDE----LPIS--DSRWAPKSKYRHKFNPANSENFVKIN--AIITLI 52

Query: 61  IIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVK 120
           + +V+I   S  +  ++  DS TN            + K L +NEYYD+DF++ +  +VK
Sbjct: 53  LFLVFICQNSFSSSSSNVVDSHTN------------EAKILEDNEYYDYDFKNFDEPLVK 100

Query: 121 KFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHL 180
           KFD+G +HYLIS+YG++VLTP D   Y +ELQ +L  +V+ YDLS ++G+ NG  NR+H+
Sbjct: 101 KFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHV 160

Query: 181 LLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGT 240
           LLCVPLRDAE VLPLMFK++MNLTYPHELIDLAFLVSDC+EGD TL++L+AYS+HLQ+GT
Sbjct: 161 LLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGT 220

Query: 241 LSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVF 300
           L+ +F EMD+   D SKK   ++ L+LKYMN DYLK+V+ ++    H++Y+KPFRS+Q+F
Sbjct: 221 LAGLFQEMDK---DDSKKD--SEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIF 275

Query: 301 QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGS 360
           QKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWLM NALKPYHAWVYWRDAD+ELCPG+
Sbjct: 276 QKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGT 335

Query: 361 VIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYA 420
           VIEDLMSK++DV+VPNVWRPLPEFL+ EQPYDLNSW+ES+EALKLAK LDEDDVIVEGYA
Sbjct: 336 VIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYA 395

Query: 421 EYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAF 480
           EYPTWRVHLAYIR+  G+PN+VVDLDGVGGVSIL KAK+FRSG+ FPAFTFENHAETEAF
Sbjct: 396 EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAF 455

Query: 481 GKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKRG 523
           GKMA+KMGFRVGGLPHYT+WHIYEPSDDDL+EIA+KER+N R 
Sbjct: 456 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNRS 498

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/430 (73%), Positives = 372/430 (86%), Gaps = 3/430 (0%)

Query: 93  TASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQ 152
           T SY T  L++  YYD+DFE+I+P V+KKFDNGV +Y I+Q+G + +T  +   + +E+ 
Sbjct: 82  TKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVS 141

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           M+LD++VEKYD+  F G++N A N++H+LLCVPLRDAE+VLPLMFKHLMN+TYPHELIDL
Sbjct: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
           AFLVSDCSEGD TLDAL+AYS+ LQNGTLSQVF E+   EM   ++ KG +NL+L+YM+ 
Sbjct: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEV---EMSEKERKKGGENLYLQYMDQ 258

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
           DYL+ V  SF    H NYDK FRS+Q+FQKDFGQ IGQGFSDRHAVKVQG+RRKLM RAR
Sbjct: 259 DYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARAR 318

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYD 392
           NWL ANALKPYH+WVYWRDAD+ELCPGSVI+DLM+KDYDV+VPNVWRPLP FLDG+QPYD
Sbjct: 319 NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYD 378

Query: 393 LNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVS 452
           LNSWIES EAL LAKTLDEDDVIVEGYAEYPTWR HLAY RDA GDPNEVV+LDGVGGVS
Sbjct: 379 LNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVS 438

Query: 453 ILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLME 512
           ILA+A++FR G+ FPAFTFENHAETEAFGKMA+KMGFRVGGLPHYT+WHIYEPSDDDL E
Sbjct: 439 ILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKE 498

Query: 513 IANKERQNKR 522
           I NKER+ +R
Sbjct: 499 IGNKEREKRR 508

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/429 (74%), Positives = 368/429 (85%), Gaps = 2/429 (0%)

Query: 94  ASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQM 153
            +YKT  L ++EYY++DF++I+  +++K+D G +H+LISQ G +VLTP DNE Y KE++M
Sbjct: 20  VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79

Query: 154 VLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLA 213
           +L A+V+ YDLS + GS NGA NRDH+LLCVPLR+A +VLPLMFKHLMNLTYPHELIDLA
Sbjct: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139

Query: 214 FLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPD 273
           FLVSDCSE D TLDAL+AYSK LQNGTLS++F E D  EM      KG+ +L+LKYMN D
Sbjct: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQD--EMRRKASIKGSPDLYLKYMNQD 197

Query: 274 YLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 333
           YL +V+ +FK   H +YDKPFRS+QVFQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARN
Sbjct: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257

Query: 334 WLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDL 393
           WL ANALKPYH+WVYWRD DIELCPGSVIEDLMS + DV VPNVWRPLPEFL GEQ YDL
Sbjct: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317

Query: 394 NSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSI 453
           NSW+ES EALKLA TLDEDDVIVEGYAEYPTWRVHL YIR+   +P E++DLDGVGGVSI
Sbjct: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377

Query: 454 LAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEI 513
           LAKAK+FR+GV FPAFTFENHAETEAFGKMA+KM +RVGGLPHYT+WHIYEPSDDDL EI
Sbjct: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEI 437

Query: 514 ANKERQNKR 522
           A KER+ +R
Sbjct: 438 AKKEREKRR 446

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/515 (61%), Positives = 395/515 (76%), Gaps = 15/515 (2%)

Query: 11  VQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGS 70
           ++ K +Q++ LPT+R+         KK+ +  KRR   S     T      + +Y+   +
Sbjct: 8   IKEKQKQKDELPTTRSKL-----YPKKSVYDRKRR---SPAFYWTCILATCLAIYLLCKA 59

Query: 71  SLTEMT-------SKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFD 123
           +L + +       + Y+S  +    +++       K+L + EYYD+DF  I+      FD
Sbjct: 60  TLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFD 119

Query: 124 NGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLC 183
            G QHYLI+QYG DV+T  D E Y +E++ +L +SV+KYDLS F G++NGA NR+HLL  
Sbjct: 120 QGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYL 179

Query: 184 VPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQ 243
            PLRDAEHVLP+MFKHLMNLTYPHELID+AFLVSDCSEGD+TLD L+ +++HLQ+GTL  
Sbjct: 180 TPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVD 239

Query: 244 VFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKD 303
           +F +MD       KK++     +LK+M+ +Y+K+ D SF    H+ Y+KPFRS+Q+FQKD
Sbjct: 240 IFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKD 299

Query: 304 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIE 363
           FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+ELCPGSVI+
Sbjct: 300 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQ 359

Query: 364 DLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYP 423
           DLMSK+YDVIVPNVWRPLPEFL+ EQPYDLNSW+ES EAL+LAKTLDEDDVIVEGYAEYP
Sbjct: 360 DLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYP 419

Query: 424 TWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKM 483
           TWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAK+FR GV FPAFTFENHAETEAFGKM
Sbjct: 420 TWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKM 479

Query: 484 ARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKER 518
           A+KMG+ VGGLP+Y +WHIYEPSDDDL ++A  ER
Sbjct: 480 AKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/520 (61%), Positives = 388/520 (74%), Gaps = 25/520 (4%)

Query: 4   LIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKR-----RKTLSSLMKLTVFS 58
           L K+++   NK   E  LP SR  S       K + F+ K+     RK  +  + + V  
Sbjct: 11  LAKLRRSADNKRGGEYSLPISRTGSE--ATLSKHDKFIAKKKNFKFRKLATGAIIVIVIV 68

Query: 59  LLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAV 118
            + ++ +    S ++  +S Y                Y   +  +  Y+  DFEDI+  +
Sbjct: 69  SIFLVFFNIEVSPISLPSSFYHK-------------EYLPFEFKDAAYHSFDFEDIDMDI 115

Query: 119 VKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRD 178
           V KFD G+ +YLIS+YGT+  + SD   Y   LQM+LD++VEKYDL  F GS++G   ++
Sbjct: 116 VSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQE 175

Query: 179 HLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQN 238
           H+L+CVPLRDAE VLPLMFK+LMNLTYPHELIDLAFLVSDCSEGD+TL+AL  YS+ LQ 
Sbjct: 176 HILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQE 235

Query: 239 GTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQ 298
           G L  +  +MD Y      K K  +++HLKYM PDYLK V  ++K   H NY KPFRS+Q
Sbjct: 236 GILPDILADMDNY-----NKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQ 290

Query: 299 VFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCP 358
           +FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLM+NALKPYH+WVYWRDAD+ELCP
Sbjct: 291 IFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCP 350

Query: 359 GSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEG 418
           GSVIEDLM +DYDVIVPNVWRPLP+FL+  QPYDLNSW+ES+EAL+LAKTLDEDDVIVEG
Sbjct: 351 GSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEG 410

Query: 419 YAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETE 478
           YAEYPT+RVHLAYIR+  GDP +VVDLDGVGGVSILA+A++FR GV F AFTFENHAETE
Sbjct: 411 YAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETE 470

Query: 479 AFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKER 518
           AFGKMA+K+GFRVGGLPHYT+WHIYEPSDDDL+ +A  E+
Sbjct: 471 AFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/405 (73%), Positives = 345/405 (85%), Gaps = 2/405 (0%)

Query: 118 VVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNR 177
           +++KFDNG +HYLIS+ G ++L  SD E Y +E++ +LD++VE YDL  F GS+ G  NR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 178 DHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQ 237
           +H+LL VPLR+AE VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D+TL+ALL Y K LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 238 NGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSI 297
           +GTLS VF      E     K KGT +L LKYM P YLK+V  ++    H  YDKPFRS+
Sbjct: 121 SGTLSDVFAAHSSDE--ELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178

Query: 298 QVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELC 357
           Q+FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+ELC
Sbjct: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238

Query: 358 PGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVE 417
           PGSVI+DLMS D+DV VPNVWRPLPEFL GEQPYDLNSWIESD AL+LA+TLDEDDVIVE
Sbjct: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298

Query: 418 GYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAET 477
           GYAEYPTWRVHLAY+RD   +P ++++LDGVGGVSILAKAK+FR+GV FPAFTFENHAET
Sbjct: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358

Query: 478 EAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522
           EAFGKMA+KMG+RV GLPHYT+WHIYEPSDDDL++IA +ER+ KR
Sbjct: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/503 (62%), Positives = 381/503 (75%), Gaps = 12/503 (2%)

Query: 21  LPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYD 80
           +P S  NS Y  + + K +F       LS  +K  + SLL I    F    + +   +  
Sbjct: 32  VPLSPQNSRYHPKVKGKFNF------RLSYKLKNVIVSLLTIACIFFL---IKQTMDRNG 82

Query: 81  SVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLT 140
           S    +AG  + + SY T  L E+EYY+ ++  ++   V+++D+G +H LI Q GT  L 
Sbjct: 83  STPRSYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LN 140

Query: 141 PSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHL 200
            +  E + + L M+L  +VE YDLS + G++NGA NR+H+L+CVPLR+AE+VLPLMF+HL
Sbjct: 141 SNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHL 200

Query: 201 MNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSK 260
           MNLTYPHELIDLAFLVSDCS+ D T+D+L++Y++ LQ GTLS+     D Y+M    KSK
Sbjct: 201 MNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSK 260

Query: 261 GTK-NLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVK 319
             + +LHLKYMN DYL +V+ + K+  H NYDKPFRS+Q+FQKDFGQIIGQGFSDRH VK
Sbjct: 261 NKEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVK 320

Query: 320 VQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWR 379
           VQG RRKLMG+ARNWL ANALKPYH+WVYWRDAD+ELCPGSVIEDLMS  YDVIVPNVWR
Sbjct: 321 VQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWR 380

Query: 380 PLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDP 439
           PLPEFL  EQ YDLNSWIESD AL LAKTLDEDDVIVEGYAEY TWR HLA  RD  G+ 
Sbjct: 381 PLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNT 440

Query: 440 NEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTI 499
            +V+DLDGVGGVSILAKAK+FR+GV F AF FENHAETEAFGKMA+KMG+RVGGL HYT+
Sbjct: 441 MDVLDLDGVGGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTL 500

Query: 500 WHIYEPSDDDLMEIANKERQNKR 522
           WHIYEPS+DDLMEIA KER ++R
Sbjct: 501 WHIYEPSNDDLMEIARKERSSRR 523

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 371/493 (75%), Gaps = 13/493 (2%)

Query: 32  DEEQKKNSFVPKRRKTL--SSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQ 89
           D +QK N F PK    L  + +  L      I+ ++     S   + SK         G 
Sbjct: 17  DSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLLSKL-------VGG 69

Query: 90  NTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAK 149
           N     Y    L E EYYD+DF+ ++   +KK+D GV HY+IS+ G + L+  D E + +
Sbjct: 70  NVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFER 129

Query: 150 ELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHEL 209
           E  M+L ++ + YDLS + G+SNGA NRDH+LLCVPLRDA  +LP++FK+LMNLTYPHEL
Sbjct: 130 EADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHEL 189

Query: 210 IDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKY 269
           ID+AFLVSDC++  RT+ +LL +SK LQNGTLS+   +   +E D   K    + L+LKY
Sbjct: 190 IDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQD---FEAD-KDKGNSAEQLYLKY 245

Query: 270 MNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMG 329
           M  DYLK+V  +F    H +YDKPFRSIQ+F+KDFGQ IGQGFSDRHAVKVQG+RRKLMG
Sbjct: 246 MGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMG 305

Query: 330 RARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ 389
           RARNWL ANALKPYH+WVYWRD D+ELCPG+VIEDLM  DYDVIVPNVWRPLP FL G Q
Sbjct: 306 RARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQ 365

Query: 390 PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVG 449
            YDLNSW+ES+EA+KLAKTLDEDDVIVEGYAEYPTWRVHL Y+R   G+P++++DLDGVG
Sbjct: 366 AYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVG 425

Query: 450 GVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDD 509
           GVSILA+A++FR G+ FPAFTFENHAETEAFGKMA+KMGF+VGGL HYT+WHIYEPSDDD
Sbjct: 426 GVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDD 485

Query: 510 LMEIANKERQNKR 522
           L EIA  ER+++R
Sbjct: 486 LREIAKLERESRR 498

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/467 (64%), Positives = 373/467 (79%), Gaps = 6/467 (1%)

Query: 58  SLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPA 117
           +L +I++ IF   +++   S Y   + +H  + T+T ++ T+ LT  EYY++DF D    
Sbjct: 57  ALSVILLCIFIAKTISVNVSIYKYNSFVHE-EETETVTFDTQVLTAPEYYNYDFHDYNLD 115

Query: 118 VVKKFDNGVQHYLISQYGTD---VLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGA 174
            + K+D GV+ YL+  Y TD    L+    E Y  EL  +L +SV+ YD+  F+G+S+G 
Sbjct: 116 TISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGV 175

Query: 175 TNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSK 234
           ++R+H+LLC+PLRDAE VLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++LL Y++
Sbjct: 176 SSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTR 235

Query: 235 HLQNGTLSQVFTEMDQYE--MDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDK 292
            LQNGTL  VF EMD+ +   D   ++     L+LKYM  +YL+ V  +FK   H NYDK
Sbjct: 236 FLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDK 295

Query: 293 PFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDA 352
           PFRSIQ+++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWLM NALKPYH+WVYWRDA
Sbjct: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355

Query: 353 DIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDED 412
           D+ELCPG+VIEDLMSKD+DVIVPNVWRPLPEF++ EQPYDLNSW+ES EA+ LAK L ED
Sbjct: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415

Query: 413 DVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFE 472
           +VIVEGYAEYPTWRVHLAY+R+  GDPN+VVD+DGVGGVSILA+A++FR+GV FPAFTFE
Sbjct: 416 EVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFE 475

Query: 473 NHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQ 519
           NHAETEAFGKMA+KMGFRVGGLPHYT+WHIYEPSDDDLM IA KE++
Sbjct: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/434 (62%), Positives = 344/434 (79%), Gaps = 4/434 (0%)

Query: 90  NTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAK 149
           + + A ++ + L + EYYD++F       + K+D G +HY +++ G       D+  + +
Sbjct: 54  DERAAEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEE 110

Query: 150 ELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHEL 209
           +++ ++ A+VE+YDL  + G+ NGA NR+H+L+C+PLR+A  VLP+MFKHLMNLTYPHEL
Sbjct: 111 QMEELVSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHEL 170

Query: 210 IDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFT-EMDQYEMDHSKKSKGTKNLHLK 268
           ID+AFLVSDCSE D+TL +L+ Y+ +LQ GTL+ V   E  + +   +K   G  +L+LK
Sbjct: 171 IDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLK 230

Query: 269 YMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLM 328
           YM+ +YL++V  +F    H NY+KPFRS+QVF+KDFGQ IGQGFSDRH VKVQGIRR+LM
Sbjct: 231 YMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLM 290

Query: 329 GRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE 388
           GRARNWL ANALKPYH+WVYWRD D+ELCPGSVIEDLMS  YDVIVPNVWRPLPEFL G+
Sbjct: 291 GRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGK 350

Query: 389 QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGV 448
           Q YDLNSWIES +AL LAK L+EDDVIVEGYAEY TWR HL   R+A G+P EV+DLDGV
Sbjct: 351 QGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGV 410

Query: 449 GGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDD 508
           GGVSILAKAK+FR G  F AF FENHAETEAFGKMA+KMG++VGGLPHYT+WHIYEPSDD
Sbjct: 411 GGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDD 470

Query: 509 DLMEIANKERQNKR 522
           D+M+IA +ER+N+R
Sbjct: 471 DIMDIARRERENRR 484

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/339 (75%), Positives = 291/339 (85%), Gaps = 2/339 (0%)

Query: 184 VPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQ 243
           VPLR+A+ VLPLMFK+LMNLTYPHELIDLAFLVSDCSE DRT +ALL Y+K LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 244 VFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKD 303
           VF   +  E  +  + +G+ +L LKYM P YLK+V  +F    H NYDKPFRS+Q+FQK+
Sbjct: 62  VFASHNSGE--NVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119

Query: 304 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIE 363
           FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWL ANALKPYH+WVYWRDAD+ELCPGSVIE
Sbjct: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179

Query: 364 DLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYP 423
           DLM+  YDV VPNVWRPLPEFL GEQ YDLNSW+ESD AL LAK LDEDDVIVEGYAEYP
Sbjct: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239

Query: 424 TWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKM 483
           TWRVHL YIR+  GDP   +DLDGVGGVSILAKA++FR+GV FPAFTFENHAETEAFGKM
Sbjct: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299

Query: 484 ARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522
           A+KMG+ V GLPHYT+WHIYEPSDDDL+++  +ER++KR
Sbjct: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  395 bits (1015), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 242/365 (66%), Gaps = 50/365 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            V+ YDLS + G+ +G    D +L CVPLRDA + LP+ FKHL ++TYPH LIDL+FLVS
Sbjct: 49  GVDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVS 108

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D +  D T+  LL     LQ+                   ++ GTK              
Sbjct: 109 DST--DDTMGVLLNSLHDLQS-------------------QADGTKR------------- 134

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F  I++FQKDFGQIIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 135 ----------------FGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 178

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            A+KPYH+WVYWRD D+E  P +++EDLM  D D+IVPNVWRPLP++L+  QPYDLNSW+
Sbjct: 179 AAIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWV 238

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA +L EDDVIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL+KA
Sbjct: 239 ESEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKA 298

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
           K+FR+G  FPAF+FE HAETEAFGK++R+M + V GLPHY IWH+YEPS DDL  +A   
Sbjct: 299 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 358

Query: 518 RQNKR 522
            + +R
Sbjct: 359 EEEQR 363

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  395 bits (1015), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 197/365 (53%), Positives = 241/365 (66%), Gaps = 50/365 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL  + G+ +G    D +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 81  GVEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVS 140

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL+   +LQN           Q + D SK+                   
Sbjct: 141 DSS--DNTMGVLLS---NLQNA----------QSQQDRSKR------------------- 166

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++F+KDFGQIIGQ FSDRH  K QG RRKLM RARNWL +
Sbjct: 167 ----------------FGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGS 210

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            A+KPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 211 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 270

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++L+G+GGVSIL+KA
Sbjct: 271 ESEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKA 330

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
           K+FRSG  FPAF+FE HAETEAFGK++R+M F V GLPHY IWHIYEPS +DL  +A   
Sbjct: 331 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMA 390

Query: 518 RQNKR 522
            + KR
Sbjct: 391 EEEKR 395

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  393 bits (1010), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/365 (53%), Positives = 242/365 (66%), Gaps = 50/365 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL  + G+S+G    D +L CVPLRDA   LP+ F+HL  +TYPH  IDL+FLVS
Sbjct: 61  GVEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVS 120

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL+   HLQ+           Q +MD SK+                   
Sbjct: 121 DSS--DDTMGVLLS---HLQSA----------QSQMDKSKR------------------- 146

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++++KDFGQIIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 147 ----------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 190

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALKPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 250

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA+ L+ED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KA
Sbjct: 251 ESEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 310

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
           K+FR+G  FPAF+FE HAETEAFG+++R+M + V GLPHY IWHIYEPS +DL  +A   
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMA 370

Query: 518 RQNKR 522
            + KR
Sbjct: 371 EEEKR 375

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 239/365 (65%), Gaps = 52/365 (14%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL+ +TG  +G    D +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 53  GVEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVS 112

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  L                       M H ++++  KN             
Sbjct: 113 DSS--DNTMGVL-----------------------MHHLQQAQKDKN------------- 134

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                         K F +I++F+KDFGQIIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 135 --------------KRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 180

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            A+KPYH+WVYWRD D+E+ P S++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW+
Sbjct: 181 VAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 240

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA TL ED VIVEGY EY TWR HLAY+RD  G+P + + LDG+GGVSIL+KA
Sbjct: 241 ESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKA 300

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
           ++FR+G  FPAF+F+ HAETEAFGK++R+MGF V GLPHY IWHIYEPS DDL  +A   
Sbjct: 301 RVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMA 360

Query: 518 RQNKR 522
            + KR
Sbjct: 361 EEEKR 365

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 195/357 (54%), Positives = 238/357 (66%), Gaps = 50/357 (14%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
           SVE YDL  + G+ +G    D +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL+   +LQ          M Q + D SK+                   
Sbjct: 121 DSS--DNTMGVLLS---NLQ----------MAQSQQDKSKR------------------- 146

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++++KDFGQIIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 147 ----------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALKPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKA
Sbjct: 251 ESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           K+FR+G  FPAF+FE HAETEAFG+++R+M + V GLPHY IWHIYEPS DDL  +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  390 bits (1001), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 196/366 (53%), Positives = 239/366 (65%), Gaps = 50/366 (13%)

Query: 157 ASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLV 216
           A+ E YDL  + G+SNG    D +L CVPLRDA   LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 217 SDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLK 276
           SD    D T+  LL+   +LQ            Q + D SK+                  
Sbjct: 125 SDSK--DDTMGVLLS---NLQTA----------QSQKDRSKR------------------ 151

Query: 277 LVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLM 336
                            F +I+ F+KDFGQIIGQ FSDRH    QG RRKLM RARNWL 
Sbjct: 152 -----------------FGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLG 194

Query: 337 ANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSW 396
           + A+KPYH+WVYWRD D+E  P +++EDLM    DVIVPNVWRPLPE+L   QPYDLNSW
Sbjct: 195 SVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSW 254

Query: 397 IESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAK 456
            ESD  L+LA +LD+D VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+K
Sbjct: 255 QESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSK 314

Query: 457 AKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANK 516
           A++FRSG  FPAF+FE HAETEAFGK++R+MG+ V GLPHY IWHIYEPS +DL  +A  
Sbjct: 315 ARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWM 374

Query: 517 ERQNKR 522
             + +R
Sbjct: 375 AEEEQR 380

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  390 bits (1002), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 246/387 (63%), Gaps = 56/387 (14%)

Query: 138 VLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMF 197
           V  P  N  Y   L+ V    VE YDL+ + G+++G    D +L CVPLRDA   LP+ F
Sbjct: 63  VSFPFLNSQYVPNLKNV--PQVEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFF 120

Query: 198 KHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSK 257
           KH+  ++YPH LIDL+FLVSD S  D T+  LL                           
Sbjct: 121 KHMDEISYPHNLIDLSFLVSDSS--DDTMGVLL--------------------------- 151

Query: 258 KSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKP--FRSIQVFQKDFGQIIGQGFSDR 315
                                  S  K+  SN DK   F +I++F+KDFGQ+IGQ FSDR
Sbjct: 152 -----------------------SSLKKAQSNQDKSQRFGNIEIFEKDFGQVIGQSFSDR 188

Query: 316 HAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVP 375
           H    QG RRKLM RARNWL + ALKPYH+WVYWRD D+E  P +++EDLM  + DVIVP
Sbjct: 189 HGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVP 248

Query: 376 NVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA 435
           NVWRPLP++L   QPYDLNSW ES+  L+LA +L+ED VIVEGY EY TWR HLAY+RD 
Sbjct: 249 NVWRPLPDWLGNIQPYDLNSWKESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDP 308

Query: 436 AGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLP 495
           +GDP   ++LDG+GGVSIL+KAK+FR+G  FPAF+FE HAETEAFGK++R+M + V GLP
Sbjct: 309 SGDPEAEMELDGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLP 368

Query: 496 HYTIWHIYEPSDDDLMEIANKERQNKR 522
           HY IWH+YEPS DDL  +A    + KR
Sbjct: 369 HYVIWHVYEPSSDDLKHMAWMAEEEKR 395

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  390 bits (1001), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 240/365 (65%), Gaps = 50/365 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
           +V+ YDL  + G ++G    DH+L  VPLRDA   LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL Y +  Q+                                 PD  + 
Sbjct: 112 DSS--DDTMGVLLEYLQKAQS--------------------------------KPDRTQR 137

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL +
Sbjct: 138 ----------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALKPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA++LDED VIVEGY EY TWR HLAY+RD +GDP + ++LDG+GGVSIL+KA
Sbjct: 242 ESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKA 301

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
           K+FR+G  FPAF+FE HAETEAFGK++R++G+ V GLPHY IWHIYEPS DDL  +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 518 RQNKR 522
            + KR
Sbjct: 362 EEEKR 366

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  389 bits (999), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 241/365 (66%), Gaps = 50/365 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL  + G+ +G    D +L  VPLRDA   LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  GVEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVS 111

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL                       DH KK++                 
Sbjct: 112 DSS--DDTMGVLL-----------------------DHLKKAQSK--------------- 131

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
             T  KKR        F +I++F+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL +
Sbjct: 132 --TDRKKR--------FGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALKPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  ++LA++LDED VIVEGY EY TWR HLAY+RD +G+P + ++LDG+GGVSIL+KA
Sbjct: 242 ESEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKA 301

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
           K+FR+G  FPAF+FE HAETEAFGK++R++G+ V GLPHY IWHIYEPS DDL  +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 518 RQNKR 522
            + KR
Sbjct: 362 EEEKR 366

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  389 bits (999), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 193/359 (53%), Positives = 238/359 (66%), Gaps = 50/359 (13%)

Query: 156 DASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFL 215
           +  VE YDL+ + G+ +G    D +L CVPLRDA   LP+ F HL  ++YPH  IDL+FL
Sbjct: 84  NPGVEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFL 143

Query: 216 VSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYL 275
           VSD S  D T+  LL+   +LQN           Q + D SK+                 
Sbjct: 144 VSDSS--DDTMGVLLS---NLQNA----------QSQQDKSKR----------------- 171

Query: 276 KLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 335
                             F +I++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL
Sbjct: 172 ------------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWL 213

Query: 336 MANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNS 395
            + A+KPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNS
Sbjct: 214 GSVAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 273

Query: 396 WIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILA 455
           W ES+  L+LA TL EDDVIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILA
Sbjct: 274 WKESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILA 333

Query: 456 KAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           KAK+FR+G  FPAF+FE HAETEAFGK++RKM + V GLPHY IWHIYEPS +DL  +A
Sbjct: 334 KAKVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  388 bits (996), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/356 (53%), Positives = 233/356 (65%), Gaps = 50/356 (14%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           VE YDL  + G+ +G    D +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 219 CSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLV 278
            S  D T+  LL+                                NLH            
Sbjct: 122 SS--DNTMGVLLS--------------------------------NLH------------ 135

Query: 279 DTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 338
               K +   +  K F +I++++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 136 ----KAQSQQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 339 ALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIE 398
           ALKPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 399 SDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAK 458
           S+  L+LA  L+ED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK
Sbjct: 252 SEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 459 IFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           +FR+G  FPAF+FE HAETEAFG+++R+M + V GLPHY IWHIYEPS DDL  +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  390 bits (1002), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 195/364 (53%), Positives = 235/364 (64%), Gaps = 50/364 (13%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           V  YDL+ + G+S+G    D +L CVPLRDA   LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 219 CSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLV 278
               D T+  LL+   HLQ     Q                                   
Sbjct: 132 SK--DDTMGVLLS---HLQTAQSQQ----------------------------------- 151

Query: 279 DTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 338
                     N  K F +I++++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 152 ----------NKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 201

Query: 339 ALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIE 398
           ALKPYH+WVYWRD D+E CP +++EDLM    DVIVPNVWRPLP++L   QPYDLNSW E
Sbjct: 202 ALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 261

Query: 399 SDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAK 458
           S+  L+LA +LDED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK
Sbjct: 262 SEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAK 321

Query: 459 IFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKER 518
           +FRSG  FPAF+FE HAETEAFGK++R+M + V GLPHY +WHIYEPS +DL  +A    
Sbjct: 322 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAE 381

Query: 519 QNKR 522
           + KR
Sbjct: 382 EEKR 385

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  386 bits (991), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 234/357 (65%), Gaps = 50/357 (14%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL  + G+ +G    D +L CVPLRDA   LP+ F HL  ++YPH LIDL+FLVS
Sbjct: 61  GVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVS 120

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL+               +M Q + D +K+                   
Sbjct: 121 DSS--DNTMGVLLSK-------------LQMAQSQQDKTKR------------------- 146

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++++KDFGQIIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 147 ----------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALKPYH+WVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKA
Sbjct: 251 ESEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           K+FR+G  FPAF+FE HAETEAFG+++R+M + V GLPHY IWHIYEPS DDL  +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  386 bits (991), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/356 (53%), Positives = 234/356 (65%), Gaps = 50/356 (14%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           VE YDL  + G+ +G    D +L CVPLRDA   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 219 CSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLV 278
            S  D T+  LL+    LQ            Q + D SK+                    
Sbjct: 122 SS--DNTMGVLLS---SLQTA----------QSQQDKSKR-------------------- 146

Query: 279 DTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 338
                          F +I++++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 147 ---------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 339 ALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIE 398
           ALKPYH+WVYWRD D++  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 399 SDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAK 458
           S+  L+LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK
Sbjct: 252 SEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 459 IFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           +FR+G  FPAF+FE HAETEAFG+++R+M + V GLPHY IWHIYEPS DDL  +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 195/378 (51%), Positives = 242/378 (64%), Gaps = 53/378 (14%)

Query: 146 VYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTY 205
           VY  +L  V    VE +DLS   G ++G    D +L CVPLRDA   LP+ FKHL  +TY
Sbjct: 31  VYTPQLDGV--DGVEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTY 88

Query: 206 PHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNL 265
           PH L+DL+FLVSD    D T+  L  + + LQ+             + D++++       
Sbjct: 89  PHNLVDLSFLVSDSK--DETMSVLRQHVRELQS-------------QPDNARQ------- 126

Query: 266 HLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRR 325
                                       F +I++FQKDFGQ IGQ FSDRH    QG RR
Sbjct: 127 ----------------------------FGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRR 158

Query: 326 KLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFL 385
           KLM RARNWL + ALKPYH+WVYWRD D+E  P ++IEDLM  D DVIVPNVWRPLP++L
Sbjct: 159 KLMARARNWLGSVALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWL 218

Query: 386 DGEQPYDLNSWIESDEALKLAK-TLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVD 444
              QPYDLNSW+ES+  L+LA  T DED VIVEGY EY TWRVHLAY+RD  GDP   ++
Sbjct: 219 GDIQPYDLNSWVESEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEME 278

Query: 445 LDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           LDG+GGVSIL++A++FRSG  FPAF+F+ HAETE FGK++R MG+ V GLPHY IWHIYE
Sbjct: 279 LDGIGGVSILSRARVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYE 338

Query: 505 PSDDDLMEIANKERQNKR 522
           PS DDL  +A    + +R
Sbjct: 339 PSSDDLKHMAWMAEEEQR 356

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  389 bits (1000), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 190/356 (53%), Positives = 236/356 (66%), Gaps = 50/356 (14%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           VE YDLS + G+ +G    D +L C+PLRDA   LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 219 CSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLV 278
            S  D T+  LL+   HLQ            Q + D SK+                    
Sbjct: 126 SS--DDTMGVLLS---HLQTV----------QSQQDKSKR-------------------- 150

Query: 279 DTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 338
                          F +I++++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL + 
Sbjct: 151 ---------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSV 195

Query: 339 ALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIE 398
           ALKPYH+WVYWRD DIE  P +++EDLM  D D+IVPNVWRPLP++L   QPYDLNSW E
Sbjct: 196 ALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQE 255

Query: 399 SDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAK 458
           S+  L+LA  LDE+ VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK
Sbjct: 256 SEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAK 315

Query: 459 IFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
           +FRSG  FPAF+FE HAETEAFGK++R+M + V GLPHY +WHIYEPS +DL  +A
Sbjct: 316 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  384 bits (986), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 232/353 (65%), Gaps = 50/353 (14%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
           +VE YDL  + G+ +G    D ++ CVPLRDA   LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL+   +LQ            Q + D SK+                   
Sbjct: 124 DSS--DDTMGVLLS---NLQTA----------QSQRDKSKR------------------- 149

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 150 ----------------FGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGS 193

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALKPYH+WVYWRD DIE  P +++EDLM  D D+IVPNVWRPLP++L   QPYDLNSW 
Sbjct: 194 VALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQ 253

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L+LA  L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA
Sbjct: 254 ESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKA 313

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDL 510
            +FRSG  FPAF+FE HAETEAFGK++R+MG+ V GLPHY +WHIYEPS +DL
Sbjct: 314 NVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  380 bits (977), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/364 (51%), Positives = 236/364 (64%), Gaps = 50/364 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
           SVE YD+S + G  +G    + +L+CVPL+DA + LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL   K LQ               +D     K                 
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ---------------IDGGTSGK----------------- 139

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++++KDFGQ+IGQGFSDRH    QG RRKLMG+ARNWL  
Sbjct: 140 ----------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNT 183

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            A+KPYH+WVYWRD D+E+ P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 184 VAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 243

Query: 398 ESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKA 457
           ES+  L L+ +L ED VIVEGY EY TWR HLAY+RD  GDP   ++LDGVGGVSIL+KA
Sbjct: 244 ESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKA 303

Query: 458 KIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKE 517
            +FRSG  FPAF+F+ HAETEAFGK+++ M F V GLP+Y +WHIYEPS +DL  +A  E
Sbjct: 304 NVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLE 363

Query: 518 RQNK 521
            + +
Sbjct: 364 EKER 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  377 bits (968), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 235/367 (64%), Gaps = 54/367 (14%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL  + G++NG    D ++ CVPLRDA   L + F  L  LTYPH LIDL+FLVS
Sbjct: 56  GVEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVS 115

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL+                                  HL+         
Sbjct: 116 DSS--DDTMKTLLS----------------------------------HLR--------- 130

Query: 278 VDTSFKKRKHSNYDKP--FRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 335
                  R  SN DK   F +I++F+KDFGQ +GQ FSDRH    QG RRK M RARNWL
Sbjct: 131 -------RAQSNQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWL 183

Query: 336 MANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNS 395
            + ALKPYH++VYWRD D++  P +++EDLM  D DVIVPNVWRPLP++L   QPYDLNS
Sbjct: 184 GSAALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 243

Query: 396 WIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILA 455
           W+ES+  L+LA +LDED  IVEGY EY TWR HLAY+RD +GDP   ++LDG+GGVSIL+
Sbjct: 244 WVESEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILS 303

Query: 456 KAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIAN 515
           KAK+FR+G  FPAF+FE HAETEAFGK++R+M + V GLPHY IWHIYEPS DDL  +A 
Sbjct: 304 KAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAW 363

Query: 516 KERQNKR 522
              + KR
Sbjct: 364 MAEEEKR 370

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  374 bits (959), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/366 (51%), Positives = 235/366 (64%), Gaps = 51/366 (13%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
            VE YDL  + G  +G    + +L  VPLRDA   LP  F H+  L+YPH LID++FLVS
Sbjct: 56  GVEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVS 115

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+  LL    HLQ          + Q + D +K+                   
Sbjct: 116 DSS--DDTMGELL---HHLQ----------IAQSQKDRNKR------------------- 141

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                           F +I++F+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 142 ----------------FGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 185

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
             LKPYH+WVYWRD D+E+ P S++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 186 VTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 245

Query: 398 ESDEALKLAKTL-DEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAK 456
           ES+  ++LA TL DED VIVEGY E+ TWR HLAY+RD  G+P + ++LDG+GGVSILAK
Sbjct: 246 ESEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAK 305

Query: 457 AKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANK 516
           AK+FR+G  FPAF+FE HAETEAFGK++R+M + V GLPHY IWHIYEPS +DL  +A  
Sbjct: 306 AKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWM 365

Query: 517 ERQNKR 522
             + KR
Sbjct: 366 AEEEKR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  371 bits (952), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 186/358 (51%), Positives = 234/358 (65%), Gaps = 51/358 (14%)

Query: 158 SVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVS 217
           +VE YDL  + G  +G    + +L  VPLRDA   LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 218 DCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKL 277
           D S  D T+ ALL+                       H +K++  K+             
Sbjct: 122 DSS--DDTMGALLS-----------------------HLEKAQSNKD------------- 143

Query: 278 VDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 337
                K R+       F +I++++KDFGQ IGQ FSDRH    QG RRKLM RARNWL  
Sbjct: 144 -----KTRR-------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGT 191

Query: 338 NALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWI 397
            ALK YH+WVYWRD D+ELCP S++EDLM  D DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 192 VALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 251

Query: 398 ESDEALKLAKTLDEDD-VIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAK 456
           ES+  ++LA +L +DD VIVEGY +Y TWR HLAY+RD  G+P + ++LDG+GGVSIL+K
Sbjct: 252 ESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSK 311

Query: 457 AKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIA 514
            K+FR+G  FPAF+FE HAETEAFGK++R+MG+ V GLPHY IWHIYEPS +DL  +A
Sbjct: 312 GKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  198 bits (503), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/358 (31%), Positives = 183/358 (51%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    +SN   N++ +L+  P++         + +L++LTYP  LI+L
Sbjct: 90  LIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F++   + GD  L  L                                           
Sbjct: 147 GFIIPRTASGDAALQKL------------------------------------------- 163

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
                 +++ ++ +    DK F  I + ++        G  DRHA++VQ  RR  M  AR
Sbjct: 164 ------ESAVREVQTGKQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + + P+ +W+ W DADI   P +VI+DL S +  V+  NV++   +F D +Q   
Sbjct: 218 NELLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKE 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ES+  LKLA+ L ++++IVEGY+E  T+R  +A+  DA G  N +++LD
Sbjct: 275 SIRPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  F  F F +  ETEAF KMA+++G+ V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  191 bits (486), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 186/368 (50%), Gaps = 62/368 (16%)

Query: 144 NEVYAKELQMVLDAS-VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMN 202
           N ++  +++ V+ A  +  YDL+  T + N A N++ +L+  P+++        + +L+ 
Sbjct: 79  NWLFNDKIEDVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQ 135

Query: 203 LTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGT 262
           LTYP ELI+L F+V     G+  L+ L A  K +Q G                 K+ +  
Sbjct: 136 LTYPRELIELGFIVPRTGSGNVALEQLEAAVKKVQTG----------------KKEDRFG 179

Query: 263 KNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQG 322
           K   L+  +  + KL++                                  +RHA++VQ 
Sbjct: 180 KITILRQASQSFDKLLE---------------------------------KERHALEVQK 206

Query: 323 IRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLP 382
            RR  M  ARN L+ + + PY +W+ W DADI   P SVIED+ + +  V+  NV++   
Sbjct: 207 ERRAAMALARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ--- 263

Query: 383 EFLDGEQ------PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAA 436
            + D EQ      PYD N+W ESD  L+LA  +  D+++VEGY E  T+R  +A+  + +
Sbjct: 264 RYYDQEQKKESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDS 323

Query: 437 GDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPH 496
                 ++LDGVGG   L KA + R G  FP F F +  ETE F KMA+++G+ V GLP+
Sbjct: 324 APATVEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPN 383

Query: 497 YTIWHIYE 504
           Y ++HI E
Sbjct: 384 YLVYHIDE 391

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  191 bits (485), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 180/359 (50%), Gaps = 61/359 (16%)

Query: 152 QMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELID 211
           +++ +  +  YDL+    +S+ A N++ +L+  P++         +++L+ LTYP ELI+
Sbjct: 87  EIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIE 143

Query: 212 LAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMN 271
           L F+      GD+ L AL A    +Q+   +Q F+++     D    +K T+        
Sbjct: 144 LGFIAPRTPTGDQALAALEAAVDKVQSDKKNQRFSKVTILRQDSVGFNKLTE-------- 195

Query: 272 PDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRA 331
                                                     +RHA++VQ  RR  M  A
Sbjct: 196 -----------------------------------------KERHALEVQKERRASMALA 214

Query: 332 RNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ-- 389
           RN L+ + + P+ +WV W DADI   P S+I+D+ + D  V+  NV++    + D E+  
Sbjct: 215 RNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQ 271

Query: 390 ----PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDL 445
               PYD N+W ESD  L+LA  + +D++IVEGYAE  T+R  +AY  D      E + L
Sbjct: 272 KAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRL 331

Query: 446 DGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           DGVGG   L KA++ R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E
Sbjct: 332 DGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  191 bits (484), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 182/358 (50%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    +S+ A N++H+L+  P++         + +L+ L+YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+    + GD  L       K+L+N                                  
Sbjct: 147 GFITPRTATGDLAL-------KNLENA--------------------------------- 166

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
             +K V T  K ++ S      ++ Q F K   +       +RHA+ VQ  RR  M  AR
Sbjct: 167 --IKKVQTDKKTQRFSKITILRQNSQSFDKLMEK-------ERHALDVQKERRAAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + + P+ +W+ W DADI   P S+I+D+   D  V+  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQP 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ESD  L++A  + +D++IVEGYAE  T+R  +A+  +A G PNE + LD
Sbjct: 275 SIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA + R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  190 bits (483), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 105/352 (29%), Positives = 180/352 (51%), Gaps = 61/352 (17%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           +  YDL+  T +     N++ +L+  P++         + +L+ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 219 CSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLV 278
            + GD  L                                                 + +
Sbjct: 153 TATGDTAL-------------------------------------------------RKL 163

Query: 279 DTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 338
           + + K+ +    D+ F  I + ++D          +RHA+KVQ  RR  M  ARN L+ +
Sbjct: 164 EAAVKRTQLGKKDQRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLFS 223

Query: 339 ALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLD------GEQPYD 392
            + P+ +W+ W DADI   P S+I+D+ + +  V+  NV++   ++++       E+PYD
Sbjct: 224 TIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKKIAERPYD 280

Query: 393 LNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVS 452
            N+W +S++AL++A  + +D+V+ EGYAE PT+R  +A++ DA+G     + LDGVGG  
Sbjct: 281 FNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGC 340

Query: 453 ILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
            L KA++ R G  FP+F F +  ETE F KMAR++ + + GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 179/358 (50%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    +S  A N++H+L+  P++         + +L+ L YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+    + GD  L       K L+N                                  
Sbjct: 147 GFITPRTATGDLAL-------KKLENA--------------------------------- 166

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
             +K V T  K ++ S      ++ Q F K   +       +RHA+ VQ  RR  M  AR
Sbjct: 167 --IKKVQTDKKTQRFSKITILRQNSQSFDKLMEK-------ERHALDVQKERRAAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + + P+ +WV W DADI   P S+I+D+   +  ++  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQP 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ESD  L++A  + +D++IVEGYAE  T+R  +A+  DA G P E + LD
Sbjct: 275 SIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  189 bits (479), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 179/358 (50%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    ++  A N++ +L+  P++         +++L+ LTYP ELI+L
Sbjct: 93  IIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIEL 149

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F++     G+  L                                              
Sbjct: 150 GFIIPRTKTGENAL---------------------------------------------- 163

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
              K ++ + KK +    ++ F  I + ++D          DRH++ VQ  RR  M  AR
Sbjct: 164 ---KELEIAIKKVQSDKKNQRFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALAR 220

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + L P+ AWV W DADI   P +VI+D+ S D  V+  NV++   ++ D ++   
Sbjct: 221 NELLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQ---KYFDNDEKKM 277

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ESD  L++A  +DE+++IVEGY+E  T+R  +A+  +A G   + ++LD
Sbjct: 278 AIRPYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELD 337

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA + R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E
Sbjct: 338 GVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  190 bits (482), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 175/349 (50%), Gaps = 55/349 (15%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           +  YDL+  T ++N A N++ +L+  P++         + +L+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 219 CSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLV 278
            + GD  L  L                                                 
Sbjct: 212 TTSGDNALRKL------------------------------------------------- 222

Query: 279 DTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 338
           + + KK + S  D+ F  I + ++D          DRHA++VQ  RR  M  ARN L+ +
Sbjct: 223 EAAVKKTQLSKKDQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFS 282

Query: 339 ALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ---PYDLNS 395
            + PY +WV W DADI   P ++I+D+ + D  V+  NV++   +   G++   PYD N+
Sbjct: 283 TIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNN 342

Query: 396 WIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILA 455
           W +SD AL++A ++ +D V+ EGY E  T+R  +A+       P+  + LDGVGG   L 
Sbjct: 343 WADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLV 402

Query: 456 KAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           KA++ R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 403 KAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 178/358 (49%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    ++  A N++H+L+  P++         + +L+ LTYP E  +L
Sbjct: 91  IIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTYPREFTEL 147

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F++   S GD  L  L                                           
Sbjct: 148 GFILPRTSSGDIALSKL------------------------------------------- 164

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
                 + + KK +    ++ F  I + +++          +RHA++VQ  RR  M  AR
Sbjct: 165 ------EAAVKKVQTDKKNQRFSKITILRQNSAGFDKLMEKERHALEVQKERRSAMASAR 218

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE---- 388
           N L+ ++L P  +WV W DADI   P ++I+D+ S +  V+  NV++   ++ D +    
Sbjct: 219 NELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQ---KYYDDQAKKV 275

Query: 389 --QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
             +PYD N+W ESD AL+LAK + +D+++VEGY +  T+R  +AY  DA G  N  ++LD
Sbjct: 276 QIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLD 335

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA + R G  FP F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 336 GVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  186 bits (473), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 104/359 (28%), Positives = 181/359 (50%), Gaps = 61/359 (16%)

Query: 152 QMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELID 211
           +++ +  + ++DL+    + + + N++ +L+  PL+         +++++ L+YP ELI+
Sbjct: 90  EIISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIE 146

Query: 212 LAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMN 271
           L F+V     GD  L +L                                          
Sbjct: 147 LGFIVPRTQTGDLALQSL------------------------------------------ 164

Query: 272 PDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRA 331
                  + + +K +    ++ F  + + ++D          +RHA+ VQ  RR  M  A
Sbjct: 165 -------EKAVEKTQTDKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALA 217

Query: 332 RNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ-- 389
           RN L+ + + P+ +WV W DADI   P ++I+D+ + D  V+  NV++    + D E+  
Sbjct: 218 RNELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQ---RYYDDEKKA 274

Query: 390 ----PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDL 445
               PYD N+W ES+  L+LA  +++D++IVEGY+E  T+R  +AY  D     +E + L
Sbjct: 275 SATRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMIL 334

Query: 446 DGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           DGVGG   L KA++ R G  FP+F F +  ETE F KMA+++G+ + GLP+Y ++HI E
Sbjct: 335 DGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  186 bits (473), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 178/358 (49%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    + +    ++H+L+  P++         + +L+ ++YP  L++L
Sbjct: 90  IIPEGHIAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F++     GD T                                               
Sbjct: 147 GFIIPRTPTGDET----------------------------------------------- 159

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
             LK ++ + K  +    +  F  I + ++D       G  +RH++ VQ  RR  M  AR
Sbjct: 160 --LKKLEAAVKNVQTGKVEDRFAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ +++ P  +WV W DADI   P +VI+D+ + +  V+  NV++    F D E+   
Sbjct: 218 NELLFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNEN 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ES++ L++AK ++ED++IVEGYAE  T+R  +A+  D AG  + ++ LD
Sbjct: 275 SIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  FP F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  185 bits (470), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 176/358 (49%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    + + A N++H+L+  P++         + +L+ L YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+    + GD  L                                              
Sbjct: 147 GFITPRTATGDSAL---------------------------------------------- 160

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
              K ++++ KK +     + F  I + +++          +RHA++VQ  RR  M  AR
Sbjct: 161 ---KKLESAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKERHALEVQKERRAAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + + P+ +WV W DADI   P S+I+D+   +  V+  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQA 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ESD  L +A  + +D++IVEGYAE  T+R  +A+  DA+   NE + LD
Sbjct: 275 SIRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  185 bits (469), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 110/361 (30%), Positives = 181/361 (50%), Gaps = 67/361 (18%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    +S+ A N++ +L+  P++         +++L+ LTYP ELI+L
Sbjct: 88  IIPENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIEL 144

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F++     GD  L                                              
Sbjct: 145 GFILPRSDSGDAAL---------------------------------------------- 158

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKD---FGQIIGQGFSDRHAVKVQGIRRKLMG 329
              K ++ + KK +    ++ F  I + ++D   FGQ++ +   +RHA+ VQ  RR  M 
Sbjct: 159 ---KALEAAVKKVQTDKKNQRFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMA 212

Query: 330 RARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ 389
            ARN L+ + + P+ +WV W DADI   P +VI+D+ + D  V+  NV++    + D E+
Sbjct: 213 LARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ---RYFDEEK 269

Query: 390 ------PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVV 443
                  YD N+W ESD  L++A  +++D++IVEGY+E  T+R  +A+  D     N  +
Sbjct: 270 KEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEM 329

Query: 444 DLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIY 503
            LDGVGG   L KA + R G  FP F F +  ETE F KMA+++ + V GLP+Y ++H+ 
Sbjct: 330 MLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHME 389

Query: 504 E 504
           E
Sbjct: 390 E 390

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/359 (31%), Positives = 177/359 (49%), Gaps = 59/359 (16%)

Query: 154 VLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLA 213
           + +  V KYDL+    +S+ A N++ +L+  P++         + +L+ LTYP +L++L 
Sbjct: 89  IPNGHVAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELG 145

Query: 214 FLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPD 273
           F++   + GD  L  L A  K  Q    +  F ++     D    SKG   L  K     
Sbjct: 146 FIIPKSASGDAALKQLEAAVKRAQTDKKNNRFGKVTILRQD----SKGFDKLQEK----- 196

Query: 274 YLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 333
                                                   +RHA+ VQ  RR  M  ARN
Sbjct: 197 ----------------------------------------ERHALAVQKERRSAMALARN 216

Query: 334 WLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE----- 388
            L+ + + P+ +WV W DADI     S+I+D+ + +  V+  NV++    F + E     
Sbjct: 217 ELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRY--FDEAENKPSI 274

Query: 389 QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGV 448
           +PYD N+W +S  A +L   + +D++IVEGYAE  T+R  +A+     G PNE++ LDGV
Sbjct: 275 RPYDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGV 334

Query: 449 GGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSD 507
           GG   L KA++ R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E +D
Sbjct: 335 GGGCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  184 bits (468), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 176/358 (49%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    +   A N++ +L+  P++         + +++++TYP ELI+L
Sbjct: 91  IIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIEL 147

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+      GD  L                                              
Sbjct: 148 GFIAPRTPTGDAAL---------------------------------------------- 161

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
              K ++ + KK +    ++ F  I + +++          DRHA+ VQ  RR  M  AR
Sbjct: 162 ---KKLEAAIKKIQSGKKNERFAKIIILRQESQSFDMLAEKDRHALAVQKQRRSAMALAR 218

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE---- 388
           N L+ + L P+ +WV W DADI   P +VI+DL + D  V+  NV++    F + E    
Sbjct: 219 NELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKA 275

Query: 389 --QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
             +PYD N+W ES+  L+LA +L  D++IVEGYAE  T+R  +A+  D +   +E + LD
Sbjct: 276 DIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALD 335

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  FP F F +  ETE F KMA+++G+ V GLP+Y ++HI E
Sbjct: 336 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  184 bits (467), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 178/358 (49%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    + + A N++H+L+  P++         + +L+ LTYP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+    + GD  L       K L+N                  KK +  K         
Sbjct: 147 GFITPRTATGDLAL-------KKLENAV----------------KKVQADKKAQ------ 177

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
              +    +  ++   ++DK                     +RHA+ VQ  RR  M  AR
Sbjct: 178 ---RFSKITIMRQNSQSFDKLMEK-----------------ERHALDVQKERRAAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + + P+ +WV W DADI   P ++I+D+   +  V+  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQS 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ESD  L++A  +D+D++IVEGYAE  T+R  +A+   A   P++ + LD
Sbjct: 275 SIRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  FP F F +  ETE F KMA+++ + V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  182 bits (462), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 177/358 (49%), Gaps = 61/358 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    +S+  ++++H+L+  P++         +++L+ L+YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIEL 146

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F++     GD  L                                              
Sbjct: 147 GFIIPRSDAGDAAL---------------------------------------------- 160

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
              K ++T+ K  +    +  F  I + +++          +RH++ VQ  RR  M  AR
Sbjct: 161 ---KKLETAVKNVQSDKKNNRFSKITILRQESQSFDKLEEKERHSLAVQKERRAAMALAR 217

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + L P+ +WV W D+DI   P +VIE +   D  V+  NV++    F D ++   
Sbjct: 218 NELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ---RFFDNDKQQD 274

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
              PYD N+W ESD  L+LA  + +D++IVEGYAE  T+R  +A+  + +GD  E + LD
Sbjct: 275 SIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALD 334

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GVGG   L KA++ R G  FP F F +  ETE F KMA+++ + V GLP++ ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  182 bits (461), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 177/361 (49%), Gaps = 61/361 (16%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    ++  A N++ +L+  P++         + +L+ LTYP ELI+L
Sbjct: 91  IIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIEL 147

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+V     GD  L  L    K +Q    +Q F                           
Sbjct: 148 GFIVPRTQSGDVALAKLEEAVKKVQTDKKNQRF--------------------------- 180

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332
                V  +  ++   ++DK        Q+           +RHA+ VQ  RR  M  AR
Sbjct: 181 -----VKVTILRQDSKSFDK-------LQE----------KERHALAVQKERRAAMALAR 218

Query: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQ--- 389
           N L+ + + P+ +WV W DADI   P ++I+D+ + +  V+  NV++    + D E+   
Sbjct: 219 NELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQ---RYYDEEKKES 275

Query: 390 ---PYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLD 446
               YD N+W ES+  L+LA  + ED++IVEGY+E  T+R  +AY  DA G P   + LD
Sbjct: 276 SIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALD 335

Query: 447 GVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPS 506
           GVGG   L +A + R G  FP F F +  ETE F KMA+++   V GLP+Y ++HI E +
Sbjct: 336 GVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWN 395

Query: 507 D 507
           D
Sbjct: 396 D 396

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  175 bits (444), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 111/363 (30%), Positives = 178/363 (49%), Gaps = 59/363 (16%)

Query: 144 NEVYA-KELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMN 202
           N +Y+ K  + V D  + +YDL+T   ++  A N + +L+  P++         + +L+ 
Sbjct: 78  NRLYSDKADEKVPDDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLL 134

Query: 203 LTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGT 262
           LTYP + I L FL+   S G+                                       
Sbjct: 135 LTYPRKYIHLGFLLPRTSSGNTA------------------------------------- 157

Query: 263 KNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQG 322
                       L+ ++ + +K +    D+ F  I + ++DF        S RH   VQ 
Sbjct: 158 ------------LRKLEKAVRKVQTGPKDQRFGKITILRQDFASFNKLSQSARHRFHVQK 205

Query: 323 IRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLP 382
            RR  M  ARN L+ + + PY +WV W D+DI   P ++IED+ S +  ++  NV++   
Sbjct: 206 ERRSAMALARNELLFSTIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYV 265

Query: 383 EFLDGE---QPYDLNSWIESDEALKLAKTLDEDDVIVEGYA-EYPTWRVHLAYIRDAAGD 438
           E  +GE   + YDLN+W ES+  LK+A  L ED +IVEGY  E+ T+R  +A++      
Sbjct: 266 E--NGEPAIRAYDLNNWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRP 323

Query: 439 PNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYT 498
            +E++ LDGVGG   L KA++ R G  FP F F +  ETE F KMA+++ + + GLP+Y 
Sbjct: 324 KDELMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYL 383

Query: 499 IWH 501
           ++H
Sbjct: 384 VYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  173 bits (438), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 173/351 (49%), Gaps = 54/351 (15%)

Query: 154 VLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLA 213
           + +  +  YDL+    S+N A N++H+L+  PL+  E      + +L+ L+YP + I+L 
Sbjct: 98  IPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELG 154

Query: 214 FLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPD 273
           F++    +GD +L  L +  K +Q       F+++     +    SKG + +      P+
Sbjct: 155 FIIPRTKKGDHSLKKLESAIKKVQTAKQGDKFSKITILRQN----SKGFETV------PE 204

Query: 274 YLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 333
             ++ +  ++K                     QI                 R  M  ARN
Sbjct: 205 KKEVSEIEYEK---------------------QI-----------------RAEMALARN 226

Query: 334 WLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE---QP 390
            L+A+ L P  AW+ W D+DI   P S+I+D+   D  V+  NV+    +   GE   +P
Sbjct: 227 ELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRP 286

Query: 391 YDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGG 450
           YD  +WIES EAL+LA  + ED++IVEG A   T R  + +     G P+  + LDGVG 
Sbjct: 287 YDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGA 346

Query: 451 VSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWH 501
             +L K+++ R G  FP F F +  E+E F KMA+++ + V GLP+Y ++H
Sbjct: 347 SCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  172 bits (436), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 173/356 (48%), Gaps = 60/356 (16%)

Query: 154 VLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLA 213
           + +  + KYD++T T +S+   N++ +L+  P++         +++L++LTYP +L  L 
Sbjct: 90  ISEGRIMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLG 146

Query: 214 FLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPD 273
           F++     GD  +                                               
Sbjct: 147 FIIPRTPTGDVAM----------------------------------------------- 159

Query: 274 YLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 333
             K ++ + KK +    ++ F  I + ++D          +RHA  VQ  RR  M  ARN
Sbjct: 160 --KRLEDAVKKVQSGKENQRFLKITILRQDSQSFNKLDEKERHAFNVQKERRAAMALARN 217

Query: 334 WLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE----- 388
            L+ + + P  +W+ W DADI   P +VI+D+ + D  ++  NV++    ++D +     
Sbjct: 218 ELVFSTIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQ---RYIDDQNQENI 274

Query: 389 QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGV 448
           +PYD N+W ES   L++A ++ +D++IVE Y E  T+R  +A + D  G P+  + LDGV
Sbjct: 275 RPYDFNNWQESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGV 334

Query: 449 GGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYE 504
           GG   L KA++ R G  FP F F +  ETE F  MA+++ + V GLP+Y ++H  E
Sbjct: 335 GGGCTLVKAQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  162 bits (410), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 175/357 (49%), Gaps = 61/357 (17%)

Query: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212
           ++ +  +  YDL+    S+N   N++H+L+  PL+  +      +++L+NL+YP +LI+L
Sbjct: 96  IIPEGHIAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIEL 152

Query: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272
            F+V +  +GD+ L       K L+N                  K  +G           
Sbjct: 153 GFMVPNTKKGDQIL-------KQLENAV----------------KNVQG----------- 178

Query: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVF-QKDFGQIIGQGFSDR------HAVKVQGIRR 325
                +D      K       F  I +  QKD G      F+DR      + ++++  +R
Sbjct: 179 -----IDKKLGSNK-------FAKITILRQKDSG---FHKFNDRKDKKEMNDIELEKEKR 223

Query: 326 KLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFL 385
             M  ARN L+++ L    AW+ W D+++   P ++I+D+   D  V+  NV+       
Sbjct: 224 AEMALARNELLSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDK 283

Query: 386 DGE--QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVV 443
           D    +PYD  +WIESD AL+LA  + ED++IVEG A   T R  +    ++ G P E +
Sbjct: 284 DKANIRPYDFRNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEEL 343

Query: 444 DLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIW 500
            LDG+G    L K+++ R G  FP F F +  E+E F KMA+++ + V GLP+Y ++
Sbjct: 344 ALDGIGAACTLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score =  101 bits (252), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 88/175 (50%), Gaps = 3/175 (1%)

Query: 325 RKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEF 384
           RK +   +N L+ + L PY +WV W D+ I   P ++++DL +    ++  +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSDGS 242

Query: 385 LDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVD 444
            D E    LN+W+ SD    LA  +    V++EG +   T R  +    DAA      ++
Sbjct: 243 PDSET---LNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 445 LDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTI 499
           LD V     L KA++ R G  FP F F +  ETE F +MAR +  +  GLP+Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 159 VEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSD 218
           +  Y+L+    S +   + +H+L+ +PL +        F++L  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 219 CSEGDRTLDAL 229
                  L AL
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 89/210 (42%), Gaps = 35/210 (16%)

Query: 314 DRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVI 373
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFLY-NRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 374 VPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVH--LAY 431
           VP + R     +  ++ YD N+WI         +T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGE-------RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 432 IRDAAGD----------PNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTF---------- 471
           ++D   +           + VV+LD VGG  +    KIF  G+QFP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 472 ENHAETEAFGKMARKMGFRVGGLPHYTIWH 501
            +  ETE     A+ +G++  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 16/136 (11%)

Query: 356 LCPGS----VIEDLM----SKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIE-SDEALKLA 406
           LC GS    +I DL+    SK    IV  +W P P+  D +   D+ S ++ +D  + L+
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIV--IWEPFPDLCDFDHQNDIKSVMQRNDVTVILS 202

Query: 407 KTLDEDDVIVEGYAEYPTW---RVHLAYIRDAAGDPNEVVDL--DGVGGVSILAKAKIFR 461
              +E   +    ++ PT     + LA+  D   D N +  L    +G +S+  K K  R
Sbjct: 203 PNAEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR 262

Query: 462 SGVQFPAFTFENHAET 477
           +   FPA+ F+  ++ 
Sbjct: 263 TYDHFPAYHFKTQSKV 278

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 442 VVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWH 501
           V++L+G G   I  KA +FR+     A  ++N  ++  FG    + GF  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 502 IYEPSDDDLMEIA 514
           IYE +     +IA
Sbjct: 272 IYESNGLRGFDIA 284

>Smik_3.114 Chr3 (152071..153150) [1080 bp, 359 aa] {ON} YCR019W
           (REAL)
          Length = 359

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 20/138 (14%)

Query: 356 LCPGS----VIEDLM----SKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEA-LKLA 406
           LC GS    +I+DL+    +K    +V  +W P P+  D +   D+ S ++ D+  + L+
Sbjct: 141 LCSGSRCLEIIDDLLRVKSTKSLKPVV--IWEPFPDLCDFDHQSDIKSVVQRDDVIIILS 198

Query: 407 KTLDEDDVIVEGYAEYPTW---RVHLAYIRDAAGDPNE--VVDLDGVGGVSILAKAKIFR 461
              +E + +   + + PT     + LA+  D   + N   V+    +G +SI  K    R
Sbjct: 199 PNAEESNRLFGLHDKEPTSLEECLKLAHYFDDFMNENNMCVLRCGSLGSLSISEKVADKR 258

Query: 462 SGVQFPAFTFENHAETEA 479
               FPA+    H++T++
Sbjct: 259 CYEYFPAY----HSKTQS 272

>TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {ON}
           Anc_2.503 YKL007W
          Length = 274

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 284 KRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKL-MGRAR-NW 334
           K  + N  +  ++I+ F+ DF + +   F+D +  K + +RR+L + RAR NW
Sbjct: 205 KEDNVNLSEILKTIKSFESDFEKQLDVSFNDLNEKKFKTLRRRLPVSRARVNW 257

>Ecym_8123 Chr8 complement(257551..258777) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AEL142W
          Length = 408

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 36 KKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFW 68
          +K    PKRR+T  +L  +  FSL  I V+ +W
Sbjct: 25 RKRFLSPKRRRTQLTLFSMLAFSLFSIYVFAYW 57

>TDEL0A02790 Chr1 (506257..507048) [792 bp, 263 aa] {ON} Anc_2.503
           YKL007W
          Length = 263

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 11/89 (12%)

Query: 251 YEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKP---FRSIQVFQKDFGQI 307
           Y++D ++ + GT ++H+ Y         + SF+  K     K     ++IQ  +KDF  +
Sbjct: 164 YDIDSTELT-GTIDVHVHYYEDG-----NVSFRSNKEVEIIKTKDVVKTIQEIEKDFEDL 217

Query: 308 IGQGFSDRHAVKVQGIRRKL-MGRAR-NW 334
           +   FS+ +  K + +RR+L + R++ NW
Sbjct: 218 LDVSFSELNEKKFKTLRRRLPITRSKVNW 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,332,282
Number of extensions: 2801214
Number of successful extensions: 9170
Number of sequences better than 10.0: 90
Number of HSP's gapped: 9421
Number of HSP's successfully gapped: 134
Length of query: 523
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 409
Effective length of database: 40,409,475
Effective search space: 16527475275
Effective search space used: 16527475275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)